| Basic Information | |
|---|---|
| Family ID | F086805 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRELSKRGNLVAGIAIGLLVAGLIWLSGNLWYVEGEGYCIGTLAQCFH |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 82.73 % |
| % of genes near scaffold ends (potentially truncated) | 19.09 % |
| % of genes from short scaffolds (< 2000 bps) | 62.73 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (42.727 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (26.364 % of family members) |
| Environment Ontology (ENVO) | Unclassified (65.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.79% β-sheet: 10.53% Coil/Unstructured: 48.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02767 | DNA_pol3_beta_2 | 33.64 |
| PF04545 | Sigma70_r4 | 1.82 |
| PF07659 | DUF1599 | 0.91 |
| PF00145 | DNA_methylase | 0.91 |
| PF07275 | ArdA | 0.91 |
| PF08281 | Sigma70_r4_2 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 33.64 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.91 |
| COG4734 | Antirestriction protein ArdA | Defense mechanisms [V] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.27 % |
| Unclassified | root | N/A | 32.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000558|Draft_10374927 | All Organisms → Viruses → Predicted Viral | 2814 | Open in IMG/M |
| 3300002220|MLSBCLC_10142168 | All Organisms → Viruses → Predicted Viral | 3775 | Open in IMG/M |
| 3300003860|Ga0031658_1104687 | Not Available | 515 | Open in IMG/M |
| 3300004112|Ga0065166_10037432 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
| 3300004124|Ga0066178_10061911 | Not Available | 969 | Open in IMG/M |
| 3300004126|Ga0066179_10135217 | Not Available | 658 | Open in IMG/M |
| 3300004448|Ga0065861_1015878 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
| 3300004481|Ga0069718_13909700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300004481|Ga0069718_14517651 | All Organisms → Viruses → Predicted Viral | 2024 | Open in IMG/M |
| 3300005527|Ga0068876_10005955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 8355 | Open in IMG/M |
| 3300005527|Ga0068876_10059071 | All Organisms → Viruses → Predicted Viral | 2326 | Open in IMG/M |
| 3300005527|Ga0068876_10538278 | Not Available | 638 | Open in IMG/M |
| 3300005527|Ga0068876_10636161 | Not Available | 575 | Open in IMG/M |
| 3300005583|Ga0049085_10074323 | Not Available | 1193 | Open in IMG/M |
| 3300005805|Ga0079957_1061771 | Not Available | 2219 | Open in IMG/M |
| 3300006037|Ga0075465_10155510 | Not Available | 522 | Open in IMG/M |
| 3300006805|Ga0075464_10130619 | All Organisms → Viruses → Predicted Viral | 1464 | Open in IMG/M |
| 3300006805|Ga0075464_10253108 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
| 3300007544|Ga0102861_1012994 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
| 3300007974|Ga0105747_1031469 | All Organisms → Viruses → Predicted Viral | 1501 | Open in IMG/M |
| 3300007974|Ga0105747_1059975 | All Organisms → Viruses → Predicted Viral | 1137 | Open in IMG/M |
| 3300008107|Ga0114340_1016735 | All Organisms → Viruses → Predicted Viral | 3501 | Open in IMG/M |
| 3300008107|Ga0114340_1037800 | All Organisms → Viruses → Predicted Viral | 2174 | Open in IMG/M |
| 3300008113|Ga0114346_1031852 | All Organisms → Viruses → Predicted Viral | 2754 | Open in IMG/M |
| 3300008266|Ga0114363_1190295 | Not Available | 641 | Open in IMG/M |
| 3300008448|Ga0114876_1007808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6404 | Open in IMG/M |
| 3300008448|Ga0114876_1007821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6401 | Open in IMG/M |
| 3300008448|Ga0114876_1015512 | All Organisms → Viruses | 4124 | Open in IMG/M |
| 3300008448|Ga0114876_1022163 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 3270 | Open in IMG/M |
| 3300008450|Ga0114880_1027590 | All Organisms → Viruses → Predicted Viral | 2566 | Open in IMG/M |
| 3300008450|Ga0114880_1041978 | Not Available | 1980 | Open in IMG/M |
| 3300008450|Ga0114880_1062451 | All Organisms → Viruses → Predicted Viral | 1536 | Open in IMG/M |
| 3300009068|Ga0114973_10014447 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5007 | Open in IMG/M |
| 3300009068|Ga0114973_10189379 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
| 3300009152|Ga0114980_10411297 | Not Available | 775 | Open in IMG/M |
| 3300009155|Ga0114968_10066568 | All Organisms → Viruses → Predicted Viral | 2269 | Open in IMG/M |
| 3300009168|Ga0105104_10938803 | Not Available | 509 | Open in IMG/M |
| 3300009169|Ga0105097_10186292 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300009183|Ga0114974_10030362 | All Organisms → Viruses → Predicted Viral | 3740 | Open in IMG/M |
| 3300010885|Ga0133913_10538121 | All Organisms → Viruses → Predicted Viral | 3073 | Open in IMG/M |
| 3300010965|Ga0138308_142535 | All Organisms → Viruses → Predicted Viral | 1912 | Open in IMG/M |
| 3300012006|Ga0119955_1013561 | All Organisms → Viruses → Predicted Viral | 3006 | Open in IMG/M |
| 3300012012|Ga0153799_1089575 | Not Available | 550 | Open in IMG/M |
| 3300013004|Ga0164293_10009909 | Not Available | 7990 | Open in IMG/M |
| 3300013004|Ga0164293_10115317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2041 | Open in IMG/M |
| 3300013004|Ga0164293_10324531 | Not Available | 1059 | Open in IMG/M |
| 3300013005|Ga0164292_10980107 | Not Available | 528 | Open in IMG/M |
| 3300017716|Ga0181350_1072140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
| 3300017736|Ga0181365_1039065 | All Organisms → Viruses → Predicted Viral | 1194 | Open in IMG/M |
| 3300017736|Ga0181365_1078482 | Not Available | 810 | Open in IMG/M |
| 3300017774|Ga0181358_1056510 | Not Available | 1473 | Open in IMG/M |
| 3300017777|Ga0181357_1050598 | All Organisms → Viruses → Predicted Viral | 1622 | Open in IMG/M |
| 3300017784|Ga0181348_1036982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2034 | Open in IMG/M |
| 3300017785|Ga0181355_1023642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2676 | Open in IMG/M |
| 3300019784|Ga0181359_1018539 | All Organisms → Viruses → Predicted Viral | 2610 | Open in IMG/M |
| 3300020048|Ga0207193_1802978 | Not Available | 591 | Open in IMG/M |
| 3300020162|Ga0211735_11405056 | Not Available | 896 | Open in IMG/M |
| 3300021519|Ga0194048_10038252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1981 | Open in IMG/M |
| 3300022179|Ga0181353_1078868 | Not Available | 833 | Open in IMG/M |
| 3300022190|Ga0181354_1108368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
| 3300022752|Ga0214917_10422478 | Not Available | 541 | Open in IMG/M |
| 3300027759|Ga0209296_1359241 | Not Available | 558 | Open in IMG/M |
| 3300027763|Ga0209088_10072441 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
| 3300027793|Ga0209972_10063406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 1961 | Open in IMG/M |
| 3300027793|Ga0209972_10203651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
| 3300027797|Ga0209107_10289185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 775 | Open in IMG/M |
| 3300027798|Ga0209353_10233001 | Not Available | 797 | Open in IMG/M |
| 3300027805|Ga0209229_10115683 | All Organisms → Viruses → Predicted Viral | 1209 | Open in IMG/M |
| 3300027816|Ga0209990_10032711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 2776 | Open in IMG/M |
| 3300027963|Ga0209400_1030527 | All Organisms → Viruses → Predicted Viral | 3005 | Open in IMG/M |
| 3300028025|Ga0247723_1008400 | All Organisms → Viruses → Predicted Viral | 4269 | Open in IMG/M |
| 3300028025|Ga0247723_1009786 | All Organisms → Viruses → Predicted Viral | 3807 | Open in IMG/M |
| 3300028025|Ga0247723_1010017 | All Organisms → Viruses → Predicted Viral | 3746 | Open in IMG/M |
| 3300028025|Ga0247723_1011774 | All Organisms → Viruses → Predicted Viral | 3329 | Open in IMG/M |
| 3300028025|Ga0247723_1021525 | All Organisms → Viruses → Predicted Viral | 2162 | Open in IMG/M |
| 3300028394|Ga0304730_1179711 | Not Available | 821 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1166969 | Not Available | 881 | Open in IMG/M |
| 3300031784|Ga0315899_11518926 | Not Available | 560 | Open in IMG/M |
| 3300031787|Ga0315900_10672049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
| 3300031857|Ga0315909_10009097 | Not Available | 10787 | Open in IMG/M |
| 3300031857|Ga0315909_10480833 | Not Available | 864 | Open in IMG/M |
| 3300031951|Ga0315904_10062017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 4103 | Open in IMG/M |
| 3300031951|Ga0315904_10537088 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
| 3300031963|Ga0315901_10372781 | All Organisms → Viruses → Predicted Viral | 1154 | Open in IMG/M |
| 3300031963|Ga0315901_11188052 | Not Available | 518 | Open in IMG/M |
| 3300032116|Ga0315903_10322261 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300032116|Ga0315903_10759244 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300033979|Ga0334978_0552377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300033981|Ga0334982_0469821 | Not Available | 560 | Open in IMG/M |
| 3300033993|Ga0334994_0232440 | Not Available | 976 | Open in IMG/M |
| 3300033996|Ga0334979_0010173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6489 | Open in IMG/M |
| 3300033996|Ga0334979_0033717 | All Organisms → Viruses → Predicted Viral | 3393 | Open in IMG/M |
| 3300033996|Ga0334979_0047025 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
| 3300033996|Ga0334979_0206166 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
| 3300033996|Ga0334979_0421490 | Not Available | 734 | Open in IMG/M |
| 3300034012|Ga0334986_0275535 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300034020|Ga0335002_0126570 | All Organisms → Viruses → Predicted Viral | 1692 | Open in IMG/M |
| 3300034022|Ga0335005_0001540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acIB-AMD-7 | 18090 | Open in IMG/M |
| 3300034062|Ga0334995_0046353 | All Organisms → Viruses → Predicted Viral | 3587 | Open in IMG/M |
| 3300034092|Ga0335010_0178526 | All Organisms → Viruses → Predicted Viral | 1317 | Open in IMG/M |
| 3300034092|Ga0335010_0535550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300034093|Ga0335012_0074934 | All Organisms → Viruses → Predicted Viral | 1919 | Open in IMG/M |
| 3300034101|Ga0335027_0128748 | All Organisms → Viruses → Predicted Viral | 1888 | Open in IMG/M |
| 3300034101|Ga0335027_0675573 | Not Available | 617 | Open in IMG/M |
| 3300034104|Ga0335031_0038203 | All Organisms → Viruses → Predicted Viral | 3487 | Open in IMG/M |
| 3300034106|Ga0335036_0423886 | Not Available | 849 | Open in IMG/M |
| 3300034122|Ga0335060_0096177 | All Organisms → Viruses → Predicted Viral | 1792 | Open in IMG/M |
| 3300034284|Ga0335013_0225579 | All Organisms → Viruses → Predicted Viral | 1229 | Open in IMG/M |
| 3300034284|Ga0335013_0483982 | Not Available | 744 | Open in IMG/M |
| 3300034356|Ga0335048_0330188 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 26.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.09% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.36% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 4.55% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.64% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.73% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.73% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.82% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.82% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.82% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.91% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.91% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.91% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.91% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.91% |
| Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.91% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.91% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.91% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_103749278 | 3300000558 | Hydrocarbon Resource Environments | VRELSKRGNLVAGIAIGLLIAGIVWVSGNLWYVPGEGYCPGSMVECYGKEFTR* |
| MLSBCLC_101421685 | 3300002220 | Hydrocarbon Resource Environments | MRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGRICLGSMLKCM* |
| Ga0031658_11046871 | 3300003860 | Freshwater Lake Sediment | VKDLSKLGNLLLGVVIGLGLALLWYISGHLWYVEGEGYCLGTLAQCFH* |
| Ga0065166_100374325 | 3300004112 | Freshwater Lake | MRELSKRGNLVAGIAIGLLIAGLFWLSGNVWYTGDGYCIGTLASCFH* |
| Ga0066178_100619111 | 3300004124 | Freshwater Lake | IDNGYQEKGVNVMNNLTPRGWLVLGIALGLALAGLWYISGHLWYVEGEGYCLGTLAQCFH |
| Ga0066179_101352171 | 3300004126 | Freshwater Lake | VNVMNNLTPRGWLVLGIALGLALAGLWYISGHLWYVEGEGYCLGTLAQCFH* |
| Ga0065861_10158783 | 3300004448 | Marine | MRELSKRGNLVAGIAIGLLIAGLIWVSGHVWFTGDGYCIGTLASCFH* |
| Ga0069718_139097002 | 3300004481 | Sediment | MRYLTKRGYLVAGIAIGLLIAGLIWLSGNLWYVPTDTGGHYCFDTMANCYADSFH* |
| Ga0069718_145176513 | 3300004481 | Sediment | MRELSKRGNLVAGIAIGLLVAALIWISGNLWYVPGKGYCPGSMSECYAEEFTR* |
| Ga0068876_1000595513 | 3300005527 | Freshwater Lake | MRDLNKRGHLVAGILIGLALAGLIWFSGHVWYVPDTGYCIGSMSECYK* |
| Ga0068876_100590715 | 3300005527 | Freshwater Lake | MRELSKRGNLVAGIAIGLLIAGIIWLSGNLWYVEGKGYCRGSMVECYK* |
| Ga0068876_105382782 | 3300005527 | Freshwater Lake | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGTGYCIGTMLECLGKEFTR* |
| Ga0068876_106361611 | 3300005527 | Freshwater Lake | MRELSKRGNLVAGIAIGLIIAGLIWVSGNVWYTGTGY |
| Ga0049085_100743233 | 3300005583 | Freshwater Lentic | MSNLTPRGNLVAGLALGLALAGLIWVSGNLWYVEGEGYCVGSLVKCFH* |
| Ga0079957_10617714 | 3300005805 | Lake | MRDLSKRGNLVLGVVIGLAIAGLIWVSGHVWYVPGEGYCIGTMLECYGPDFH* |
| Ga0075465_101555102 | 3300006037 | Aqueous | MRELSKRGNLVLGVVIGLLIAGLIWVSGHVWYVPGEGYCIGTMLECYGPDFH* |
| Ga0075464_101306195 | 3300006805 | Aqueous | MRELSKRGNLVAGVLIGLLIAGLIWVSANLWYVEGEGYCLGTLAQCFH* |
| Ga0075464_102531082 | 3300006805 | Aqueous | MRELSKRGNLVLGVVIGLLIAGLIWVSANLWYTGDGYCIGTLVSCFH* |
| Ga0102861_10129942 | 3300007544 | Estuarine | MRELSKLGNLVAGIALGLAIAALWYISGHLWYVEGEGYCIGTLAQCFH* |
| Ga0105747_10314695 | 3300007974 | Estuary Water | SKRGNLVLGVAIGLLIAGLIWVSANIWYVEGEGYCIGTLAQCFH* |
| Ga0105747_10599754 | 3300007974 | Estuary Water | MNNLTPRGWLVLGIALGLAIAGLWWVSGHIWYVEGEGYCIGTLAQCF |
| Ga0114340_10167353 | 3300008107 | Freshwater, Plankton | MRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGGICLGSMLKCM* |
| Ga0114340_10378007 | 3300008107 | Freshwater, Plankton | VRELSKRGNLVAGIVIGLIIAGLVWVSGNVWITEEGRICLGSMLECM* |
| Ga0114346_10318521 | 3300008113 | Freshwater, Plankton | GGFRVMRELSKRGNLVAGIAIGLLIAGLIWVSGNLWYTESGYCRGSLLECDKTFTR* |
| Ga0114363_11902953 | 3300008266 | Freshwater, Plankton | MRELSKRGNLVAGIAIGLLVAGLIWFSGNVWYVPGEGYCIGTM |
| Ga0114876_10078085 | 3300008448 | Freshwater Lake | MRELSKRGNLVAGIAIGLIIAGLIWVSGNVWYTGTGYCRGSLIECDKEFTR* |
| Ga0114876_100782115 | 3300008448 | Freshwater Lake | MRELSKRGNLVAGIAIGLLIAGLIWVSGNLWYTESGYCRGSLLECDKTFTR* |
| Ga0114876_101551214 | 3300008448 | Freshwater Lake | MRELSKRGNLVAGIAIGLLVAGLIWVSGHVWYVPGEGYCIGTMLECYGPDFH* |
| Ga0114876_10221638 | 3300008448 | Freshwater Lake | MRELSKRGNLIAGILIGLAIALLWYISGHLWYVEGEGYCLGTLAQCFH* |
| Ga0114880_102759011 | 3300008450 | Freshwater Lake | MRELSKRGNLVAGIAIGLALAGIVWISGNLWYVPETGYCIGSMVECYK* |
| Ga0114880_10419783 | 3300008450 | Freshwater Lake | MRELSKRGNLVAGIAIGLLIAGLFWLSGNVWYVPGEGYCIGTMASCFH* |
| Ga0114880_10624514 | 3300008450 | Freshwater Lake | VRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGRICLGSMLKCM* |
| Ga0114973_100144477 | 3300009068 | Freshwater Lake | MRELSKRGNLVAGIAIGLLVAGLIWLSGNLWYVEGEGYCIGTLAQCFH* |
| Ga0114973_101893793 | 3300009068 | Freshwater Lake | MRELSKRGNLVLGVVIGLLIAGLIWLSGSLWYVEGEGYCIGTLAQCFH* |
| Ga0114980_104112973 | 3300009152 | Freshwater Lake | MRELSKRGNLVAGIAIGLLVAGLIWLSGHLWYVEGEGYCIGTLAQCFH* |
| Ga0114968_100665683 | 3300009155 | Freshwater Lake | MNNLTPRGWLVLGIALGLALAGLWYVSGHLWYVEGEGYCLGTMAQCFH* |
| Ga0105104_109388031 | 3300009168 | Freshwater Sediment | MRELSKRGNLVAGIAIGLIVAGLVWVSGNVWITEEGRICLGSMLKCM* |
| Ga0105097_101862924 | 3300009169 | Freshwater Sediment | VKELSKRGNLVAGVAIGLIVAGLVWVSGNVWVTEEGRICRGSMVECM* |
| Ga0114974_1003036213 | 3300009183 | Freshwater Lake | MRELSKRGNLVAGIVIGLLIAGLIWVSGHVWYTGDGYCIGTLVSCFH* |
| Ga0133913_105381214 | 3300010885 | Freshwater Lake | MSNLTPRGYLVAGIALGLALAGLIWLSSSLWWTGEGYCIGSLVKCFH* |
| Ga0138308_1425355 | 3300010965 | Lake Chemocline | MRELSKRGNLVAGIAIGLLIAGLIWVSGHVWYVPGEGYCIGTMLECYGPDFH* |
| Ga0119955_101356111 | 3300012006 | Freshwater | MKDLSKRGNLVLGVVIGLIIAGIWYISGHLWYVEGEGYCLGTMAQCFH* |
| Ga0153799_10895752 | 3300012012 | Freshwater | NEGDMKDLSKRGNLVLGVVIGLIIAGIWYISGHLWYVEGEGYCLGTLAQCFH* |
| Ga0164293_100099095 | 3300013004 | Freshwater | VRELSKRGNLVAGIAIGLLIAGLVWISGNVWITEEGRICLGSMLKCM* |
| Ga0164293_101153173 | 3300013004 | Freshwater | MRELSKRGNLVAGIAIGLLIAGLLWLSGHVWYVPGEGYCPGSMVECYGEEFTR* |
| Ga0164293_103245313 | 3300013004 | Freshwater | MRELSKRGNLVVGIAIGLLAAGLIWVSGHVWYVPGEGYCIGTILECYGPDFH* |
| Ga0164292_109801071 | 3300013005 | Freshwater | MNNLTPRGWLVLGIAIGLAIAGLWWLSGHIWYIEGEGYCIGTLLECDPAAFTR* |
| Ga0181350_10721403 | 3300017716 | Freshwater Lake | MRELSKRGNLVLGVVIGLLIAGLIWLSGNLWYVEGEGYCIGT |
| Ga0181365_10390656 | 3300017736 | Freshwater Lake | MRELSKRGNLVLGVVIGLLIAGLIWLSGNLWYVEGEGYCIGTLAQCFH |
| Ga0181365_10784821 | 3300017736 | Freshwater Lake | MRELSKLGNLVAGIALGLAIAALWYISGHLWYVEGEGYCIGTLVSCF |
| Ga0181358_10565103 | 3300017774 | Freshwater Lake | MRELSKRGNLVAGIVIGLLVAGLIWLSGSLWYVEGEGYCIGTLAHCFH |
| Ga0181357_10505988 | 3300017777 | Freshwater Lake | GVSVRELSKRGNLVAGILIGLVIAGLWYISGHLWYVEGEGYCLGTLAQCFH |
| Ga0181348_10369823 | 3300017784 | Freshwater Lake | MRELSKRGNLVAGIAIGLLVAGLIWLSGSLWYVEGEGYCIGTLAHCFH |
| Ga0181355_10236422 | 3300017785 | Freshwater Lake | MMRELSKRRNLVLGVMIGLALAGIVWLSGNLWYVPETGYCIGSMVECYK |
| Ga0181359_10185394 | 3300019784 | Freshwater Lake | MRELSKRGNLVAGIAIGLVIAGLIWVSGNVWWTGTGYCIGTLASCFH |
| Ga0207193_18029781 | 3300020048 | Freshwater Lake Sediment | GNLVLGVVIGLLIAGLIWVSANLWYVEGEGYCIGTLAQCFH |
| Ga0211735_114050561 | 3300020162 | Freshwater | MRELSKRGNLVAGIAIGLLVAGLIWVSGHVWYVPGEGYCIGTMLECYGPDFH |
| Ga0194048_100382524 | 3300021519 | Anoxic Zone Freshwater | MRELSKLGNLLLGVVIGLALALLWYISGHLWYVEGEGYCLGTLAQCFH |
| Ga0181353_10788682 | 3300022179 | Freshwater Lake | MRELSKRGNLVAGIAIGLLIAGLFWLSGNVWYTGDGYCIGTLASCFH |
| Ga0181354_11083681 | 3300022190 | Freshwater Lake | MRELSKRGNLVLGVVIGLLIAGLIWLSGNLWYVEGEGYC |
| Ga0214917_104224783 | 3300022752 | Freshwater | MRELSKRGNLVAGIAIGLLVAGLIWLSGNLWYVEGEGYCLGTLAQCFH |
| Ga0209296_13592412 | 3300027759 | Freshwater Lake | ELSKIGNLVAGIVIGLLIAGLIWVSGHVWYTGDGYCIGTLVSCFH |
| Ga0209088_100724412 | 3300027763 | Freshwater Lake | MRELSKRGNLVAGIAIGLLVAGLIWLSGHLWYVEGEGYCIGTLAQCFH |
| Ga0209972_100634065 | 3300027793 | Freshwater Lake | MRELSKRGNLVAGIAIGLLIAGIIWLSGNLWYVEGKGYCRGSMVECYK |
| Ga0209972_102036512 | 3300027793 | Freshwater Lake | MRDLNKRGHLVAGILIGLALAGLIWFSGHVWYVPDTGYCIGSMSECYK |
| Ga0209107_102891851 | 3300027797 | Freshwater And Sediment | MRELSKRGNLVAGIAIGLLVAGLIWLSGNLWYVEGEGYCIGTLAQCFH |
| Ga0209353_102330011 | 3300027798 | Freshwater Lake | VRELSKRGNLVAGIAIGLLIAGLFWLSGNVWYTGEGYCIGTMASC |
| Ga0209229_101156832 | 3300027805 | Freshwater And Sediment | MNNLTPRGWLVLGIAIGLAIAGLWWVSAYVWYVPGEGYCIGTILECYGPDFH |
| Ga0209990_100327118 | 3300027816 | Freshwater Lake | MRELSKRGNLIAGILIGLAIALLWYISGHLWYVEGEGYCLGTLAQCFH |
| Ga0209400_10305276 | 3300027963 | Freshwater Lake | MNNLTPRGWLVLGIALGLALAGLWYVSGHLWYVEGEGYCLGTMAQCFH |
| Ga0247723_10084002 | 3300028025 | Deep Subsurface Sediment | MRELSKRGNLVIGIAIGLLIAVIYYLSGHLWWTGEEWCLDTMANCMDKAFTR |
| Ga0247723_10097863 | 3300028025 | Deep Subsurface Sediment | MRELSKRGNLVAGIVIGLLIAGLFWLSGHVWYTGDGYCIGTLVSCFH |
| Ga0247723_10100172 | 3300028025 | Deep Subsurface Sediment | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGTGYCIGTMASCFH |
| Ga0247723_10117743 | 3300028025 | Deep Subsurface Sediment | MRSLSKRGNLVAGIAIGLALAGIVWLSGNLWYVPETGYCIGSMVECYK |
| Ga0247723_10215254 | 3300028025 | Deep Subsurface Sediment | VRELSKRGNLVAGIVIGLIIAGLVWVSGNVWITEEGRICLGSMLECM |
| Ga0304730_11797111 | 3300028394 | Freshwater Lake | LVLGIALGLALAGLWYVSGHLWYVEGEGYCLGTMAQCFH |
| (restricted) Ga0247843_11669692 | 3300028569 | Freshwater | MRDLSKRGNLVAGIAIGLLIAGLIWVSGNLWYVPGEGYCIGTMLECYGKEFTR |
| Ga0315899_115189262 | 3300031784 | Freshwater | MRELSKRGNLVAGIAIGLIIAGLIWVSGNVWYTGTGYCRGSLIECDKEFTR |
| Ga0315900_106720491 | 3300031787 | Freshwater | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGTG |
| Ga0315909_1000909724 | 3300031857 | Freshwater | VRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGRICLGSMLKCM |
| Ga0315909_104808332 | 3300031857 | Freshwater | MKELSKRGNLVAGIAIGLLIAGLIWLSGNLWYVPGEGYCPGSMSECYGKEFTR |
| Ga0315904_100620174 | 3300031951 | Freshwater | MRELSKRGNLVAGIAIGLALAGIVWISGNLWYVPETGYCIGSMVECYK |
| Ga0315904_105370882 | 3300031951 | Freshwater | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGTGYCIGTMLECLGKEFTR |
| Ga0315901_103727812 | 3300031963 | Freshwater | MRELSKRGNLVAGIAIGLLVAGLIWFSGNVWYVPGEGYCIGTMASCFH |
| Ga0315901_111880522 | 3300031963 | Freshwater | MRELSKRGNLVLGVAIGLALAGIFWLSGNLWWVDSGWCIG |
| Ga0315903_103222613 | 3300032116 | Freshwater | MRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGGICLGSMLKCM |
| Ga0315903_107592442 | 3300032116 | Freshwater | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGTGYCIGTML |
| Ga0334978_0552377_73_234 | 3300033979 | Freshwater | MSGLSKRGNLVAGIAIGLLIAGLFWLSGHVWYVPGEGYCIGTMLECYGEEFVR |
| Ga0334982_0469821_3_170 | 3300033981 | Freshwater | VALMRELSKRGNLVAGIAIGLLIAGLFWLSGNLWWTGEGYCPGSMSECLGEEFTR |
| Ga0334994_0232440_714_872 | 3300033993 | Freshwater | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGEGYCPGSMSECLGKEFTR |
| Ga0334979_0010173_2322_2465 | 3300033996 | Freshwater | VRELSKRGNLVAGIAIGLLIAGLVWISGNVWITEEGRICLGSMLKCM |
| Ga0334979_0033717_1245_1403 | 3300033996 | Freshwater | MRELSKRGNLVVGIAIGLLAAGLIWVSGHVWYVPGEGYCIGTILECYGPDFH |
| Ga0334979_0047025_1059_1220 | 3300033996 | Freshwater | MRELSKRGNLVAGIAIGLLIAGLLWLSGHVWYVPGEGYCPGSMVECYGEEFTR |
| Ga0334979_0206166_120_278 | 3300033996 | Freshwater | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGEGYCPGSMSECLGEEFTR |
| Ga0334979_0421490_579_734 | 3300033996 | Freshwater | EGDMKDLSKRGNLVLGVVIGLIIAGIWYISGHLWYVEGEGYCLGTLAQCFH |
| Ga0334986_0275535_649_807 | 3300034012 | Freshwater | MRELSKRGNLVAGIAIGLLIAVIYYLSGHLWWTGEEWCLDTMANCMDKSFTR |
| Ga0335002_0126570_1292_1435 | 3300034020 | Freshwater | VRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGRICLGSMLECM |
| Ga0335005_0001540_1948_2112 | 3300034022 | Freshwater | MMNNLTPRGWLVLGIAIGLAIAGLWWVSGHIWYIEGEGYCIGTLLECDPAAFTR |
| Ga0334995_0046353_2059_2202 | 3300034062 | Freshwater | VRELSKRGNLVAGIAIGLLIAGLVWISGNVWITEEGRICLGSMLECM |
| Ga0335010_0178526_935_1093 | 3300034092 | Freshwater | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGTGYCPGSMSECLGKEFTR |
| Ga0335010_0535550_301_447 | 3300034092 | Freshwater | MRELNKRGHLVAGILIGLALAGLVWISGHVWYVPETGYCIGSMSECYK |
| Ga0335012_0074934_1038_1184 | 3300034093 | Freshwater | MKDLSKRGNLVLGVVIGLGLALLWYISGHLWYVEGEGYCLGTLAQCFH |
| Ga0335027_0128748_1217_1360 | 3300034101 | Freshwater | MRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGGVCLGSMLKCM |
| Ga0335027_0675573_16_162 | 3300034101 | Freshwater | MRELSKRGNLVAGIVIGLALAGIVWISGHVWYVPETGYCIGSMSECYK |
| Ga0335031_0038203_1520_1666 | 3300034104 | Freshwater | MRELSKRGNLVAGIVIGLALAGIVWISGHVWYVEGTGYCIGSMVECYK |
| Ga0335036_0423886_626_769 | 3300034106 | Freshwater | MRELSKRGNLVAGIAIGLLIAGLVWVSGNVWITEEGRICLGSMLECM |
| Ga0335060_0096177_894_1052 | 3300034122 | Freshwater | MRELTKRGNLVAGIAIGLLIAGLIWLSGNLWWTGTGYCPGSMSECLGEEFTR |
| Ga0335013_0225579_187_345 | 3300034284 | Freshwater | MRELSKRGNLVAGIAIGLLVAGLIWVSGHVWYVPGEGYCIGTILECYGPDFH |
| Ga0335013_0483982_234_395 | 3300034284 | Freshwater | MNNLTPRGWLVLGIAIGLAIAGLWWLSGHIWYIEGEGYCIGTLLECDPAAFTR |
| Ga0335048_0330188_633_779 | 3300034356 | Freshwater | MKELSKRGNLVAGIAIGLLIAGLIWVSGHVWYVPGEGYCIGTLTSCFHE |
| ⦗Top⦘ |