Metagenome / Metatranscriptome Family F086792

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F086792
Family Type	Metagenome / Metatranscriptome
Number of Sequences	110
Average Sequence Length	38 residues
Representative Sequence	AQAIVDAEVAAAQAAWDALPEEQKTNLNSQRPTAITLP
Number of Associated Samples	72
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	78.18 %
Associated GOLD sequencing projects	66
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (82.727 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (44.545 % of family members)
Environment Ontology (ENVO)	Unclassified (68.182 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (68.182 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF13759	2OG-FeII_Oxy_5	0.91
PF02195	ParBc	0.91
PF13640	2OG-FeII_Oxy_3	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
All Organisms	root	All Organisms	17.27 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
cellular organisms	root	All Organisms → cellular organisms	11.82 %
Viruses	superkingdom	All Organisms → Viruses	5.45 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	4.55 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
DPANN group	clade	All Organisms → cellular organisms → Archaea → DPANN group	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.82 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
Candidatus Aenigmarchaeota	phylum	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.91 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
unclassified Aenigmarchaeota	no rank	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Pelagibacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales	0.91 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
Candidatus Aenigmarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Pelagibacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae	0.91 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
Candidatus Aenigmarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.91 %
Candidatus Pelagibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
Candidatus Aenigmarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
unclassified Candidatus Pelagibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter	0.91 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
Candidatus Aenigmarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Candidatus Pelagibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.	0.91 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	82.73 %
Candidatus Aenigmarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	7.27 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	5.45 %
Flavobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	0.91 %
Candidatus Pelagibacter sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005512\|Ga0074648_1029882	Not Available	2773	Open in IMG/M
3300005582\|Ga0049080_10049537	Not Available	1452	Open in IMG/M
3300006805\|Ga0075464_10978547	Not Available	530	Open in IMG/M
3300006916\|Ga0070750_10226256	Not Available	819	Open in IMG/M
3300007344\|Ga0070745_1086768	Not Available	1238	Open in IMG/M
3300007538\|Ga0099851_1117325	Not Available	1007	Open in IMG/M
3300007542\|Ga0099846_1108150	Not Available	1021	Open in IMG/M
3300007640\|Ga0070751_1094993	Not Available	1238	Open in IMG/M
3300007960\|Ga0099850_1092040	Not Available	1258	Open in IMG/M
3300009068\|Ga0114973_10063726	Not Available	2147	Open in IMG/M
3300009152\|Ga0114980_10063072	Not Available	2236	Open in IMG/M
3300009152\|Ga0114980_10790232	Not Available	528	Open in IMG/M
3300009160\|Ga0114981_10167562	Not Available	1209	Open in IMG/M
3300009161\|Ga0114966_10174890	Not Available	1379	Open in IMG/M
3300009161\|Ga0114966_10488130	Not Available	704	Open in IMG/M
3300009170\|Ga0105096_10159308	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1136	Open in IMG/M
3300009180\|Ga0114979_10063820	All Organisms → Viruses → Predicted Viral	2299	Open in IMG/M
3300009183\|Ga0114974_10178998	Not Available	1308	Open in IMG/M
3300010354\|Ga0129333_10501456	Not Available	1064	Open in IMG/M
3300010368\|Ga0129324_10003948	Not Available	8709	Open in IMG/M
3300012766\|Ga0138282_1090737	Not Available	660	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10111601	Not Available	1896	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10766040	Not Available	503	Open in IMG/M
3300013372\|Ga0177922_10247357	Not Available	1094	Open in IMG/M
3300017701\|Ga0181364_1069032	Not Available	541	Open in IMG/M
3300017707\|Ga0181363_1028661	Not Available	1059	Open in IMG/M
3300017716\|Ga0181350_1013368	All Organisms → Viruses → Predicted Viral	2326	Open in IMG/M
3300017716\|Ga0181350_1039410	All Organisms → cellular organisms → Bacteria	1281	Open in IMG/M
3300017722\|Ga0181347_1019434	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	2152	Open in IMG/M
3300017722\|Ga0181347_1046523	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1317	Open in IMG/M
3300017722\|Ga0181347_1054091	Not Available	1208	Open in IMG/M
3300017723\|Ga0181362_1087877	Not Available	624	Open in IMG/M
3300017736\|Ga0181365_1019935	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1690	Open in IMG/M
3300017736\|Ga0181365_1037238	Not Available	1225	Open in IMG/M
3300017736\|Ga0181365_1074240	Not Available	836	Open in IMG/M
3300017736\|Ga0181365_1084802	Not Available	774	Open in IMG/M
3300017747\|Ga0181352_1022510	All Organisms → Viruses → Predicted Viral	1946	Open in IMG/M
3300017747\|Ga0181352_1040023	Not Available	1389	Open in IMG/M
3300017761\|Ga0181356_1020477	Not Available	2434	Open in IMG/M
3300017761\|Ga0181356_1027889	All Organisms → Viruses → Predicted Viral	2035	Open in IMG/M
3300017761\|Ga0181356_1063344	Not Available	1254	Open in IMG/M
3300017761\|Ga0181356_1065201	Not Available	1231	Open in IMG/M
3300017761\|Ga0181356_1067237	Not Available	1208	Open in IMG/M
3300017761\|Ga0181356_1068912	Not Available	1191	Open in IMG/M
3300017774\|Ga0181358_1056355	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1475	Open in IMG/M
3300017774\|Ga0181358_1067648	Not Available	1323	Open in IMG/M
3300017774\|Ga0181358_1082536	Not Available	1172	Open in IMG/M
3300017777\|Ga0181357_1090333	Not Available	1167	Open in IMG/M
3300017778\|Ga0181349_1082539	Not Available	1221	Open in IMG/M
3300017778\|Ga0181349_1085121	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1199	Open in IMG/M
3300017778\|Ga0181349_1086387	Not Available	1188	Open in IMG/M
3300017778\|Ga0181349_1087937	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1176	Open in IMG/M
3300017778\|Ga0181349_1260737	Not Available	575	Open in IMG/M
3300017780\|Ga0181346_1024879	Not Available	2501	Open in IMG/M
3300017780\|Ga0181346_1232405	Not Available	652	Open in IMG/M
3300017780\|Ga0181346_1318933	Not Available	523	Open in IMG/M
3300017784\|Ga0181348_1174889	Not Available	787	Open in IMG/M
3300017784\|Ga0181348_1182415	Not Available	764	Open in IMG/M
3300017784\|Ga0181348_1260321	Not Available	596	Open in IMG/M
3300017785\|Ga0181355_1103433	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	1176	Open in IMG/M
3300017785\|Ga0181355_1131949	Not Available	1017	Open in IMG/M
3300017785\|Ga0181355_1201553	Not Available	782	Open in IMG/M
3300017949\|Ga0181584_10739128	Not Available	586	Open in IMG/M
3300019784\|Ga0181359_1072446	Not Available	1303	Open in IMG/M
3300019784\|Ga0181359_1082399	All Organisms → cellular organisms → Bacteria	1204	Open in IMG/M
3300019784\|Ga0181359_1084160	Not Available	1187	Open in IMG/M
3300019784\|Ga0181359_1149366	Not Available	803	Open in IMG/M
3300020220\|Ga0194119_10937471	Not Available	501	Open in IMG/M
3300021960\|Ga0222715_10217117	Not Available	1133	Open in IMG/M
3300021960\|Ga0222715_10229158	Not Available	1093	Open in IMG/M
3300021962\|Ga0222713_10539247	Not Available	691	Open in IMG/M
3300022167\|Ga0212020_1045674	Not Available	744	Open in IMG/M
3300022190\|Ga0181354_1017606	Not Available	2226	Open in IMG/M
3300022190\|Ga0181354_1202117	Not Available	591	Open in IMG/M
3300022200\|Ga0196901_1025904	All Organisms → Viruses → Predicted Viral	2320	Open in IMG/M
3300022200\|Ga0196901_1082908	Not Available	1141	Open in IMG/M
3300022407\|Ga0181351_1006654	All Organisms → cellular organisms → Bacteria → Proteobacteria	4503	Open in IMG/M
3300022407\|Ga0181351_1017841	Not Available	2982	Open in IMG/M
3300022407\|Ga0181351_1108283	Not Available	1062	Open in IMG/M
3300023179\|Ga0214923_10250320	Not Available	999	Open in IMG/M
3300025769\|Ga0208767_1210973	Not Available	643	Open in IMG/M
3300025818\|Ga0208542_1018330	Not Available	2375	Open in IMG/M
3300025818\|Ga0208542_1026954	Not Available	1898	Open in IMG/M
3300025818\|Ga0208542_1104192	Not Available	812	Open in IMG/M
3300025889\|Ga0208644_1061323	Not Available	2021	Open in IMG/M
3300025896\|Ga0208916_10033093	All Organisms → Viruses → Predicted Viral	2084	Open in IMG/M
3300027114\|Ga0208009_1045998	Not Available	837	Open in IMG/M
3300027608\|Ga0208974_1146729	Not Available	601	Open in IMG/M
3300027627\|Ga0208942_1191352	Not Available	529	Open in IMG/M
3300027708\|Ga0209188_1101247	Not Available	1156	Open in IMG/M
3300027720\|Ga0209617_10312806	Not Available	586	Open in IMG/M
3300027754\|Ga0209596_1039584	Not Available	2564	Open in IMG/M
3300027770\|Ga0209086_10109858	Not Available	1395	Open in IMG/M
3300027782\|Ga0209500_10144105	Not Available	1128	Open in IMG/M
3300027798\|Ga0209353_10459637	Not Available	513	Open in IMG/M
3300027804\|Ga0209358_10161631	Not Available	1189	Open in IMG/M
3300027917\|Ga0209536_100698714	Not Available	1259	Open in IMG/M
3300027973\|Ga0209298_10044103	Not Available	2097	Open in IMG/M
(restricted) 3300027977\|Ga0247834_1050222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp.	2251	Open in IMG/M
3300028025\|Ga0247723_1012735	Not Available	3149	Open in IMG/M
(restricted) 3300028557\|Ga0247832_1124271	Not Available	1043	Open in IMG/M
(restricted) 3300028581\|Ga0247840_10074854	All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Aenigmarchaeota → unclassified Aenigmarchaeota → Candidatus Aenigmarchaeota archaeon	2396	Open in IMG/M
3300031669\|Ga0307375_10332448	Not Available	964	Open in IMG/M
3300031857\|Ga0315909_10405603	Not Available	975	Open in IMG/M
3300031952\|Ga0315294_10433369	Not Available	1221	Open in IMG/M
3300033233\|Ga0334722_10008904	Not Available	9499	Open in IMG/M
3300033992\|Ga0334992_0534164	Not Available	503	Open in IMG/M
3300034106\|Ga0335036_0871373	Not Available	514	Open in IMG/M
3300034374\|Ga0348335_046640	Not Available	1713	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	97.27%
Terrestrial	Environmental → Terrestrial	2.73%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	73.64%
Marine	Environmental → Aquatic → Marine	22.73%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	1.82%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.91%
Soil	Environmental → Terrestrial → Soil	0.91%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	48.18%
Lake	Environmental → Aquatic → Freshwater → Lake	23.64%
Coastal	Environmental → Aquatic → Marine → Coastal	18.18%
Unclassified	Environmental → Aquatic → Marine → Unclassified	2.73%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	1.82%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.91%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	0.91%
Oceanic	Environmental → Aquatic → Marine → Oceanic	0.91%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.91%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.91%
Clay	Environmental → Terrestrial → Soil → Clay	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	47.27%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	21.82%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	18.18%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	2.73%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	1.82%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.91%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	0.91%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	0.91%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	0.91%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.91%
Epilimnion	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion	0.91%
Unclassified	Environmental → Terrestrial → Soil → Clay → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	44.55%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	16.36%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	12.73%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	7.27%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	2.73%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	2.73%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	1.82%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	1.82%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.91%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment	0.91%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.91%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.91%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	0.91%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	0.91%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.91%
Saline Water And Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment	0.91%
Soil	Environmental → Terrestrial → Soil → Clay → Unclassified → Soil	0.91%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.91%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005512	Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006916	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24	Environmental	Open in IMG/M
3300007344	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4	Environmental	Open in IMG/M
3300007538	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG	Environmental	Open in IMG/M
3300007542	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG	Environmental	Open in IMG/M
3300007640	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28	Environmental	Open in IMG/M
3300007960	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009152	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009170	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010368	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA	Environmental	Open in IMG/M
3300012766	Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017707	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N	Environmental	Open in IMG/M
3300017716	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017761	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017785	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017949	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020220	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m	Environmental	Open in IMG/M
3300021960	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300022167	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022200	Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300023179	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510	Environmental	Open in IMG/M
3300025769	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)	Environmental	Open in IMG/M
3300025818	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025889	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)	Environmental	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027627	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)	Environmental	Open in IMG/M
3300027708	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027720	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027798	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027804	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300027973	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027977 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300028557 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m	Environmental	Open in IMG/M
3300028581 (restricted)	Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m	Environmental	Open in IMG/M
3300031669	Soil microbial communities from Risofladan, Vaasa, Finland - TR-1	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031952	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40	Environmental	Open in IMG/M
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental	Open in IMG/M
3300033992	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034374	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0074648_10298821	3300005512	Saline Water And Sediment	QAIVDAEVLKAQQAYDALPEEQKQNRQRPTNITLK*
Ga0049080_100495373	3300005582	Freshwater Lentic	FKTKSEAQAIVDAEVAKAQAAYDALPEDQKNNSLSRRPENIVLE*
Ga0075464_109785471	3300006805	Aqueous	EKTKAEAQAIVDGEVAKAQAAYDALPEEQKTNLSRQRPTAINLP*
Ga0070750_102262562	3300006916	Aqueous	VDAEVAAAQAAWDALPEEQKNNGINQRPTAITLP*
Ga0070745_10867681	3300007344	Aqueous	AIVDAEVAAAQAAWDALPEEQKNGINNQRPTAITLP*
Ga0070745_13593352	3300007344	Aqueous	TLVDAEVTAAQAAWDALSEEQQNLNPRPTDITLP*
Ga0099851_11173251	3300007538	Aqueous	DEAQANVDAEVLKAQQAFDALPEEQKLNRLRPTNITLK*
Ga0099846_11081501	3300007542	Aqueous	IVDAEVAAAQAAWDALPEEQKNGINNQRPTAITLP*
Ga0070751_10949931	3300007640	Aqueous	AIVDAEVAAAQAAWDALPEEQKNNGINQRPTAITLP*
Ga0099850_10920401	3300007960	Aqueous	KDEAQAIVDAEVLKAQQAFDALPEAEKQINQRPTNITLK*
Ga0114973_100637261	3300009068	Freshwater Lake	QAIVDGEVSKAQTAYDALPEDQKTNLNRQRPTAINLP*
Ga0114980_100630721	3300009152	Freshwater Lake	AIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP*
Ga0114980_107902322	3300009152	Freshwater Lake	EEAQAIVDAIITQAQADWDALPENQKQEPFRNRRPTAIVLE*
Ga0114981_101675621	3300009160	Freshwater Lake	KTKAEAQAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP*
Ga0114966_101748901	3300009161	Freshwater Lake	QAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP*
Ga0114966_104881301	3300009161	Freshwater Lake	IVDVEVTAAQAAWDALPDEQKQSPFNRQRPTAIVLE*
Ga0105096_101593081	3300009170	Freshwater Sediment	KTKAEAQAIVDAEVAKAQAAYDALPAEQKTNLDRQRPTAINLP*
Ga0114979_100638203	3300009180	Freshwater Lake	GVEKTKAEAQAIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLP*
Ga0114974_101789981	3300009183	Freshwater Lake	KTKAEAQAIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLP*
Ga0129333_105014562	3300010354	Freshwater To Marine Saline Gradient	VDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP*
Ga0129324_100039481	3300010368	Freshwater To Marine Saline Gradient	AESQAIVDEQVALAQAAWDALPEEQKQEPFNRPRPTAIVLE*
Ga0138282_10907372	3300012766	Freshwater Lake	QAIVDAEVAKAQAVWDALPDEQKQSPFNRQRPTAIVLE*
(restricted) Ga0172367_101116012	3300013126	Freshwater	DAEVATAQAAWDALPEEQRNRPGFNQRPTAITLP*
(restricted) Ga0172367_107660401	3300013126	Freshwater	KAEAQAIVDEQVAIAQAAWDALPEEQKQQPFNRQRPTAIVLE*
Ga0177922_102473571	3300013372	Freshwater	AQAIVTAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP*
Ga0181364_10690321	3300017701	Freshwater Lake	AQAIVTAEVTAAQAAYDALPEDQKNRPGFNQRPTAITLP
Ga0181363_10286612	3300017707	Freshwater Lake	VEKTKAEAQAIVDGEVSKAQAAYDALPAEQKTNLNRQRPTAINLP
Ga0181350_10133681	3300017716	Freshwater Lake	KAEAQAIVDGEVAKAQAAYDALPAEQKTNLNRQRPTAINLP
Ga0181350_10394103	3300017716	Freshwater Lake	IVDVEVTAAQAAWDALPDAQKQAPIGRQRPTAIVLE
Ga0181347_10194341	3300017722	Freshwater Lake	AIVDGEVSKAQALWDALPAEQKTNLNRQRPTAINLP
Ga0181347_10465233	3300017722	Freshwater Lake	KAEAQAIVDAEVAKAQAAYDALPEDQKNNSLSSRPENIVLE
Ga0181347_10540911	3300017722	Freshwater Lake	AIVTAEVTAAQAAWDALPEDQKNRPGFNQRPTAITLP
Ga0181362_10878771	3300017723	Freshwater Lake	AQAIVDAEVAKAQAAWDALPDSEKNNPVRTQRPTAIVLE
Ga0181365_10199351	3300017736	Freshwater Lake	EAQAIVTAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP
Ga0181365_10372381	3300017736	Freshwater Lake	IVDVEVTAAQAAWDALPDEQKQKPFNRQRPTAIVLE
Ga0181365_10742401	3300017736	Freshwater Lake	AEAQAIVDVEVTAAQAAWDALPDEQKQQPFSRQRPTAIVLE
Ga0181365_10848021	3300017736	Freshwater Lake	IVDVEVTAAQAAWDALPDEQKQNPINRQRPTAIVLE
Ga0181352_10225102	3300017747	Freshwater Lake	VDAEVTAAQAAYDALPEDQKNRPGFNQRPTAITLP
Ga0181352_10400231	3300017747	Freshwater Lake	AIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLP
Ga0181356_10204774	3300017761	Freshwater Lake	AEAQAIVDAEVAKAQAAYDALPDEQKQQPFNRQRPTAIVLE
Ga0181356_10278891	3300017761	Freshwater Lake	AIVDGEVSKAQAAYDALPAEQKTNLNRQRPTAINLP
Ga0181356_10633441	3300017761	Freshwater Lake	KAEAQAIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLQ
Ga0181356_10652013	3300017761	Freshwater Lake	AEAQAIVDAEVATAQAAWDALPDEQKQLPFRQRPAAIVLE
Ga0181356_10672373	3300017761	Freshwater Lake	VDAEVAKAQAAWDALPDAQKQAPTNKQRPTAIVLE
Ga0181356_10689121	3300017761	Freshwater Lake	AQAIVDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLE
Ga0181358_10563551	3300017774	Freshwater Lake	QAIVDAEVAKTQAAYDALPEDQKNNSLNRRPENIVLE
Ga0181358_10676481	3300017774	Freshwater Lake	AQAIVDVEVTAAQAAWDALPDAQKQEPIIRQRPTAIVLE
Ga0181358_10825363	3300017774	Freshwater Lake	IVDVEVTTAQAAWDALPDAQKQAPIGRQRPTAIVLE
Ga0181357_10903331	3300017777	Freshwater Lake	VDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLK
Ga0181349_10825391	3300017778	Freshwater Lake	AIVDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLK
Ga0181349_10851213	3300017778	Freshwater Lake	QAIVDAEVAKAQAAYDALPEDQKNNSLNRRPENIVLE
Ga0181349_10863871	3300017778	Freshwater Lake	IVDAEVAKAQAAWDALSDEQKQQPFNRQRPTAIVLE
Ga0181349_10879372	3300017778	Freshwater Lake	QAIVTAEVTAAQAAWDAIPEEQRSKRPETQRPAAITLP
Ga0181349_12607371	3300017778	Freshwater Lake	AQAIVDVEVTAAQAAWDALPDEQKQQTFNRQRPTAIVLE
Ga0181346_10248794	3300017780	Freshwater Lake	VTAEVTAAQAVYDALPEEQKNRPGFNQRPTAITLP
Ga0181346_12324051	3300017780	Freshwater Lake	TQAIVTAEVTSAQAAYDALPDEQKNRPGFNQRPTAITLP
Ga0181346_13189331	3300017780	Freshwater Lake	IDAEVTAAQAAWDALPDEQKQQPLGRLRPTTIVLE
Ga0181348_11748891	3300017784	Freshwater Lake	VDVEVTATQAACDALPDAQKQAPMNRQRPTAIVLE
Ga0181348_11824151	3300017784	Freshwater Lake	IVDAEVATAQAAWDALTDEQKTNLNRTRPTAIVLE
Ga0181348_12603212	3300017784	Freshwater Lake	VDAEVTAAQAAYDALPEEQKNRPEFNQRPTAITLP
Ga0181355_11034331	3300017785	Freshwater Lake	AIVTAEVTAAQAAWDAIPEEQRSKRPETQRPAAITLP
Ga0181355_11319492	3300017785	Freshwater Lake	AEAQAIVDVEVTAAQAAWDALPEELKNNPVKRQRPTAIVLE
Ga0181355_12015531	3300017785	Freshwater Lake	IVDAEVAKAQAAWDALPDAQKQAPIGRQRPTAIVLE
Ga0181584_107391281	3300017949	Salt Marsh	IVDAEVAAAQAAWDALPEEQKNNEINQRPTAITLP
Ga0181359_10724461	3300019784	Freshwater Lake	ESFKTKSEAQAIVDAEVAKAQAAYDALPEDQKNNSLNRRPENIVLE
Ga0181359_10823993	3300019784	Freshwater Lake	VDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLE
Ga0181359_10841603	3300019784	Freshwater Lake	AEAQAIVDAEVATAQAAWDALPDEQKQKPFRQRPTAIVLE
Ga0181359_11493661	3300019784	Freshwater Lake	IVTAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP
Ga0194119_109374712	3300020220	Freshwater Lake	KTKAEAQAIVDEQVAIAQAAWDTLPEEQKQNPVNRQRPTAIVLE
Ga0222715_102171171	3300021960	Estuarine Water	AQAIVDAEVLKAQQAFDALPEEQKQIDRRPTNITLK
Ga0222715_102291581	3300021960	Estuarine Water	KDEAQAIVDAEVLKAQQAFDALPEEQKQIDRRPTNITLK
Ga0222713_105392472	3300021962	Estuarine Water	EAQAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP
Ga0212020_10456742	3300022167	Aqueous	AQAIVDAEVAAAQAAWDALPEEQKTNLNSQRPTAITLP
Ga0181354_10176061	3300022190	Freshwater Lake	IVDVEVTAAKAAWDALPDEQKQQPFNRQRPTAIVLE
Ga0181354_12021171	3300022190	Freshwater Lake	AIVDAEVAKAQAAYDALPDEQKQQPFNRQRPTAIVLE
Ga0196901_10259041	3300022200	Aqueous	IVDAEVAAAQAAWDALPEEQKNNGINQRPTAITLP
Ga0196901_10829081	3300022200	Aqueous	TKDEAQAIVDAQVLKAQQAYDALPEAQKQINQRPTNITLK
Ga0181351_10066547	3300022407	Freshwater Lake	TEAQAIVDAEVAKAQAAYDALPEDQKNNSLNRRPENIVLE
Ga0181351_10178411	3300022407	Freshwater Lake	VDAEVATAQAAWDALPDAQKQAPMNRQRPTAIVLE
Ga0181351_11082832	3300022407	Freshwater Lake	AQAIVDVEVTAAQAAWDALPDAQKQAPIGRQRPTAIVLE
Ga0214923_102503202	3300023179	Freshwater	TKAEAQAIFDAEVAKAQAAYDALPEDQKTNLNRQRPTAINLP
Ga0208767_12109732	3300025769	Aqueous	IVDAEVAAAQAAWDALPEEQKQNTTIATQRPIAIILE
Ga0208542_10183301	3300025818	Aqueous	DEAQAIVDAEVLKAQQAFDALPEEQKQDRQRPTNITLK
Ga0208542_10269541	3300025818	Aqueous	DEAQAIVDAEVLKAQQAFDALPEERKQFNQRPTNITLK
Ga0208542_11041921	3300025818	Aqueous	EAQAIVDAEITAAQQAYDALPEAEKQINQRPTNITLK
Ga0208644_10613231	3300025889	Aqueous	DEAQAIVDAEVLKAQQAFDALPEEQKQNRQRPTNIILK
Ga0208916_100330933	3300025896	Aqueous	QAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP
Ga0208009_10459982	3300027114	Deep Subsurface	AIVDAEVAKAQAAWDALPDAQKQDPIIRQRPTAIVLE
Ga0208974_11467291	3300027608	Freshwater Lentic	QAIVDAEVAKAQAAWDALPDEQKQQPLGRQRPTAIVLE
Ga0208942_11913522	3300027627	Freshwater Lentic	QAIVDGEVSKAQALWDALPAEQKTNLNRQRPTAINLP
Ga0209188_11012472	3300027708	Freshwater Lake	KTKAEAQAIVDGEVATAQAAYDALPEEQKTNLNRQRPTAINLP
Ga0209617_103128062	3300027720	Freshwater And Sediment	KAEAQAIVDGEVSKAQALWDALPAEQKTNLNRQRPTAINLP
Ga0209596_10395841	3300027754	Freshwater Lake	IVDAEVTSAQAVYDALPEDQKNRPGFNQRPTAITLP
Ga0209086_101098582	3300027770	Freshwater Lake	ERGVEKTKAEAQAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP
Ga0209500_101441051	3300027782	Freshwater Lake	KAEAQAIVDAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP
Ga0209353_104596371	3300027798	Freshwater Lake	AQAIVDAEVAKAQATWDSLPAEQKTGVSPYGPRPSAITLE
Ga0209358_101616312	3300027804	Freshwater Lake	EAQAIVDAEVTAAQAAYDALPEDQKNRPGFNQRPTAITLP
Ga0209536_1006987143	3300027917	Marine Sediment	QAIVDAEVLKAQQAYDALPEEQKQFKQRPTNITLK
Ga0209298_100441031	3300027973	Freshwater Lake	AIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP
(restricted) Ga0247834_10502221	3300027977	Freshwater	IVDAEVTAAQAAWDALPDEQKNRPGFNQRPTAITLP
Ga0247723_10127351	3300028025	Deep Subsurface Sediment	IVDAEVAKAQAAYDALPEEQKNRPGFNQRPTAITLP
(restricted) Ga0247832_11242711	3300028557	Freshwater	VDAEVTAAQAAYDALPEEQKNRPGFNQRPTAITLP
(restricted) Ga0247840_100748541	3300028581	Freshwater	QAIVDAEVAKAQAAYDALPAEQKTNLDRQRPTAINLP
Ga0307375_103324481	3300031669	Soil	VDAEVTKAQAAWDALPDEQKNNGINNQRPTAITLP
Ga0315909_104056031	3300031857	Freshwater	AQAIVDAEVTKAQAAYDALPEEQKNRPGSNQRPTAITLP
Ga0315294_104333691	3300031952	Sediment	AQAIVDAEVTAAQAAYDALPDEQKNRPGFNQRPTAITLP
Ga0334722_100089041	3300033233	Sediment	IVDVEVTAAQAAWDALPDEQKQQPFNRQRPTAIVLE
Ga0334992_0534164_387_503	3300033992	Freshwater	QAIVDVEVTAAQAAWDALPDEQKQQPFNRQRPTAIVLE
Ga0335036_0871373_392_514	3300034106	Freshwater	EAQAIVDAEIATAQAAWDALPDEQKQPPIGRQRPTAIVLE
Ga0348335_046640_3_119	3300034374	Aqueous	DEAQAIVDAEVLKAQQAYDALPEEQKQIDRRPTNITLK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters