| Basic Information | |
|---|---|
| Family ID | F086792 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 38 residues |
| Representative Sequence | AQAIVDAEVAAAQAAWDALPEEQKTNLNSQRPTAITLP |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 78.18 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (82.727 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (44.545 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.182 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.182 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.85% β-sheet: 0.00% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13759 | 2OG-FeII_Oxy_5 | 0.91 |
| PF02195 | ParBc | 0.91 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 82.73 % |
| All Organisms | root | All Organisms | 17.27 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 44.55% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 16.36% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.73% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.27% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.73% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.73% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.82% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.82% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.91% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.91% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.91% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.91% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.91% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.91% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012766 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
| 3300031669 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-1 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0074648_10298821 | 3300005512 | Saline Water And Sediment | QAIVDAEVLKAQQAYDALPEEQKQNRQRPTNITLK* |
| Ga0049080_100495373 | 3300005582 | Freshwater Lentic | FKTKSEAQAIVDAEVAKAQAAYDALPEDQKNNSLSRRPENIVLE* |
| Ga0075464_109785471 | 3300006805 | Aqueous | EKTKAEAQAIVDGEVAKAQAAYDALPEEQKTNLSRQRPTAINLP* |
| Ga0070750_102262562 | 3300006916 | Aqueous | VDAEVAAAQAAWDALPEEQKNNGINQRPTAITLP* |
| Ga0070745_10867681 | 3300007344 | Aqueous | AIVDAEVAAAQAAWDALPEEQKNGINNQRPTAITLP* |
| Ga0070745_13593352 | 3300007344 | Aqueous | TLVDAEVTAAQAAWDALSEEQQNLNPRPTDITLP* |
| Ga0099851_11173251 | 3300007538 | Aqueous | DEAQANVDAEVLKAQQAFDALPEEQKLNRLRPTNITLK* |
| Ga0099846_11081501 | 3300007542 | Aqueous | IVDAEVAAAQAAWDALPEEQKNGINNQRPTAITLP* |
| Ga0070751_10949931 | 3300007640 | Aqueous | AIVDAEVAAAQAAWDALPEEQKNNGINQRPTAITLP* |
| Ga0099850_10920401 | 3300007960 | Aqueous | KDEAQAIVDAEVLKAQQAFDALPEAEKQINQRPTNITLK* |
| Ga0114973_100637261 | 3300009068 | Freshwater Lake | QAIVDGEVSKAQTAYDALPEDQKTNLNRQRPTAINLP* |
| Ga0114980_100630721 | 3300009152 | Freshwater Lake | AIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP* |
| Ga0114980_107902322 | 3300009152 | Freshwater Lake | EEAQAIVDAIITQAQADWDALPENQKQEPFRNRRPTAIVLE* |
| Ga0114981_101675621 | 3300009160 | Freshwater Lake | KTKAEAQAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP* |
| Ga0114966_101748901 | 3300009161 | Freshwater Lake | QAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP* |
| Ga0114966_104881301 | 3300009161 | Freshwater Lake | IVDVEVTAAQAAWDALPDEQKQSPFNRQRPTAIVLE* |
| Ga0105096_101593081 | 3300009170 | Freshwater Sediment | KTKAEAQAIVDAEVAKAQAAYDALPAEQKTNLDRQRPTAINLP* |
| Ga0114979_100638203 | 3300009180 | Freshwater Lake | GVEKTKAEAQAIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLP* |
| Ga0114974_101789981 | 3300009183 | Freshwater Lake | KTKAEAQAIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLP* |
| Ga0129333_105014562 | 3300010354 | Freshwater To Marine Saline Gradient | VDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP* |
| Ga0129324_100039481 | 3300010368 | Freshwater To Marine Saline Gradient | AESQAIVDEQVALAQAAWDALPEEQKQEPFNRPRPTAIVLE* |
| Ga0138282_10907372 | 3300012766 | Freshwater Lake | QAIVDAEVAKAQAVWDALPDEQKQSPFNRQRPTAIVLE* |
| (restricted) Ga0172367_101116012 | 3300013126 | Freshwater | DAEVATAQAAWDALPEEQRNRPGFNQRPTAITLP* |
| (restricted) Ga0172367_107660401 | 3300013126 | Freshwater | KAEAQAIVDEQVAIAQAAWDALPEEQKQQPFNRQRPTAIVLE* |
| Ga0177922_102473571 | 3300013372 | Freshwater | AQAIVTAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP* |
| Ga0181364_10690321 | 3300017701 | Freshwater Lake | AQAIVTAEVTAAQAAYDALPEDQKNRPGFNQRPTAITLP |
| Ga0181363_10286612 | 3300017707 | Freshwater Lake | VEKTKAEAQAIVDGEVSKAQAAYDALPAEQKTNLNRQRPTAINLP |
| Ga0181350_10133681 | 3300017716 | Freshwater Lake | KAEAQAIVDGEVAKAQAAYDALPAEQKTNLNRQRPTAINLP |
| Ga0181350_10394103 | 3300017716 | Freshwater Lake | IVDVEVTAAQAAWDALPDAQKQAPIGRQRPTAIVLE |
| Ga0181347_10194341 | 3300017722 | Freshwater Lake | AIVDGEVSKAQALWDALPAEQKTNLNRQRPTAINLP |
| Ga0181347_10465233 | 3300017722 | Freshwater Lake | KAEAQAIVDAEVAKAQAAYDALPEDQKNNSLSSRPENIVLE |
| Ga0181347_10540911 | 3300017722 | Freshwater Lake | AIVTAEVTAAQAAWDALPEDQKNRPGFNQRPTAITLP |
| Ga0181362_10878771 | 3300017723 | Freshwater Lake | AQAIVDAEVAKAQAAWDALPDSEKNNPVRTQRPTAIVLE |
| Ga0181365_10199351 | 3300017736 | Freshwater Lake | EAQAIVTAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP |
| Ga0181365_10372381 | 3300017736 | Freshwater Lake | IVDVEVTAAQAAWDALPDEQKQKPFNRQRPTAIVLE |
| Ga0181365_10742401 | 3300017736 | Freshwater Lake | AEAQAIVDVEVTAAQAAWDALPDEQKQQPFSRQRPTAIVLE |
| Ga0181365_10848021 | 3300017736 | Freshwater Lake | IVDVEVTAAQAAWDALPDEQKQNPINRQRPTAIVLE |
| Ga0181352_10225102 | 3300017747 | Freshwater Lake | VDAEVTAAQAAYDALPEDQKNRPGFNQRPTAITLP |
| Ga0181352_10400231 | 3300017747 | Freshwater Lake | AIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLP |
| Ga0181356_10204774 | 3300017761 | Freshwater Lake | AEAQAIVDAEVAKAQAAYDALPDEQKQQPFNRQRPTAIVLE |
| Ga0181356_10278891 | 3300017761 | Freshwater Lake | AIVDGEVSKAQAAYDALPAEQKTNLNRQRPTAINLP |
| Ga0181356_10633441 | 3300017761 | Freshwater Lake | KAEAQAIVDGEVSKAQAAYDALPEDQKTNLNRQRPTAINLQ |
| Ga0181356_10652013 | 3300017761 | Freshwater Lake | AEAQAIVDAEVATAQAAWDALPDEQKQLPFRQRPAAIVLE |
| Ga0181356_10672373 | 3300017761 | Freshwater Lake | VDAEVAKAQAAWDALPDAQKQAPTNKQRPTAIVLE |
| Ga0181356_10689121 | 3300017761 | Freshwater Lake | AQAIVDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLE |
| Ga0181358_10563551 | 3300017774 | Freshwater Lake | QAIVDAEVAKTQAAYDALPEDQKNNSLNRRPENIVLE |
| Ga0181358_10676481 | 3300017774 | Freshwater Lake | AQAIVDVEVTAAQAAWDALPDAQKQEPIIRQRPTAIVLE |
| Ga0181358_10825363 | 3300017774 | Freshwater Lake | IVDVEVTTAQAAWDALPDAQKQAPIGRQRPTAIVLE |
| Ga0181357_10903331 | 3300017777 | Freshwater Lake | VDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLK |
| Ga0181349_10825391 | 3300017778 | Freshwater Lake | AIVDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLK |
| Ga0181349_10851213 | 3300017778 | Freshwater Lake | QAIVDAEVAKAQAAYDALPEDQKNNSLNRRPENIVLE |
| Ga0181349_10863871 | 3300017778 | Freshwater Lake | IVDAEVAKAQAAWDALSDEQKQQPFNRQRPTAIVLE |
| Ga0181349_10879372 | 3300017778 | Freshwater Lake | QAIVTAEVTAAQAAWDAIPEEQRSKRPETQRPAAITLP |
| Ga0181349_12607371 | 3300017778 | Freshwater Lake | AQAIVDVEVTAAQAAWDALPDEQKQQTFNRQRPTAIVLE |
| Ga0181346_10248794 | 3300017780 | Freshwater Lake | VTAEVTAAQAVYDALPEEQKNRPGFNQRPTAITLP |
| Ga0181346_12324051 | 3300017780 | Freshwater Lake | TQAIVTAEVTSAQAAYDALPDEQKNRPGFNQRPTAITLP |
| Ga0181346_13189331 | 3300017780 | Freshwater Lake | IDAEVTAAQAAWDALPDEQKQQPLGRLRPTTIVLE |
| Ga0181348_11748891 | 3300017784 | Freshwater Lake | VDVEVTATQAACDALPDAQKQAPMNRQRPTAIVLE |
| Ga0181348_11824151 | 3300017784 | Freshwater Lake | IVDAEVATAQAAWDALTDEQKTNLNRTRPTAIVLE |
| Ga0181348_12603212 | 3300017784 | Freshwater Lake | VDAEVTAAQAAYDALPEEQKNRPEFNQRPTAITLP |
| Ga0181355_11034331 | 3300017785 | Freshwater Lake | AIVTAEVTAAQAAWDAIPEEQRSKRPETQRPAAITLP |
| Ga0181355_11319492 | 3300017785 | Freshwater Lake | AEAQAIVDVEVTAAQAAWDALPEELKNNPVKRQRPTAIVLE |
| Ga0181355_12015531 | 3300017785 | Freshwater Lake | IVDAEVAKAQAAWDALPDAQKQAPIGRQRPTAIVLE |
| Ga0181584_107391281 | 3300017949 | Salt Marsh | IVDAEVAAAQAAWDALPEEQKNNEINQRPTAITLP |
| Ga0181359_10724461 | 3300019784 | Freshwater Lake | ESFKTKSEAQAIVDAEVAKAQAAYDALPEDQKNNSLNRRPENIVLE |
| Ga0181359_10823993 | 3300019784 | Freshwater Lake | VDVEVTAAQAAWDALPDAQKQAPMNRQRPTAIVLE |
| Ga0181359_10841603 | 3300019784 | Freshwater Lake | AEAQAIVDAEVATAQAAWDALPDEQKQKPFRQRPTAIVLE |
| Ga0181359_11493661 | 3300019784 | Freshwater Lake | IVTAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP |
| Ga0194119_109374712 | 3300020220 | Freshwater Lake | KTKAEAQAIVDEQVAIAQAAWDTLPEEQKQNPVNRQRPTAIVLE |
| Ga0222715_102171171 | 3300021960 | Estuarine Water | AQAIVDAEVLKAQQAFDALPEEQKQIDRRPTNITLK |
| Ga0222715_102291581 | 3300021960 | Estuarine Water | KDEAQAIVDAEVLKAQQAFDALPEEQKQIDRRPTNITLK |
| Ga0222713_105392472 | 3300021962 | Estuarine Water | EAQAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP |
| Ga0212020_10456742 | 3300022167 | Aqueous | AQAIVDAEVAAAQAAWDALPEEQKTNLNSQRPTAITLP |
| Ga0181354_10176061 | 3300022190 | Freshwater Lake | IVDVEVTAAKAAWDALPDEQKQQPFNRQRPTAIVLE |
| Ga0181354_12021171 | 3300022190 | Freshwater Lake | AIVDAEVAKAQAAYDALPDEQKQQPFNRQRPTAIVLE |
| Ga0196901_10259041 | 3300022200 | Aqueous | IVDAEVAAAQAAWDALPEEQKNNGINQRPTAITLP |
| Ga0196901_10829081 | 3300022200 | Aqueous | TKDEAQAIVDAQVLKAQQAYDALPEAQKQINQRPTNITLK |
| Ga0181351_10066547 | 3300022407 | Freshwater Lake | TEAQAIVDAEVAKAQAAYDALPEDQKNNSLNRRPENIVLE |
| Ga0181351_10178411 | 3300022407 | Freshwater Lake | VDAEVATAQAAWDALPDAQKQAPMNRQRPTAIVLE |
| Ga0181351_11082832 | 3300022407 | Freshwater Lake | AQAIVDVEVTAAQAAWDALPDAQKQAPIGRQRPTAIVLE |
| Ga0214923_102503202 | 3300023179 | Freshwater | TKAEAQAIFDAEVAKAQAAYDALPEDQKTNLNRQRPTAINLP |
| Ga0208767_12109732 | 3300025769 | Aqueous | IVDAEVAAAQAAWDALPEEQKQNTTIATQRPIAIILE |
| Ga0208542_10183301 | 3300025818 | Aqueous | DEAQAIVDAEVLKAQQAFDALPEEQKQDRQRPTNITLK |
| Ga0208542_10269541 | 3300025818 | Aqueous | DEAQAIVDAEVLKAQQAFDALPEERKQFNQRPTNITLK |
| Ga0208542_11041921 | 3300025818 | Aqueous | EAQAIVDAEITAAQQAYDALPEAEKQINQRPTNITLK |
| Ga0208644_10613231 | 3300025889 | Aqueous | DEAQAIVDAEVLKAQQAFDALPEEQKQNRQRPTNIILK |
| Ga0208916_100330933 | 3300025896 | Aqueous | QAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP |
| Ga0208009_10459982 | 3300027114 | Deep Subsurface | AIVDAEVAKAQAAWDALPDAQKQDPIIRQRPTAIVLE |
| Ga0208974_11467291 | 3300027608 | Freshwater Lentic | QAIVDAEVAKAQAAWDALPDEQKQQPLGRQRPTAIVLE |
| Ga0208942_11913522 | 3300027627 | Freshwater Lentic | QAIVDGEVSKAQALWDALPAEQKTNLNRQRPTAINLP |
| Ga0209188_11012472 | 3300027708 | Freshwater Lake | KTKAEAQAIVDGEVATAQAAYDALPEEQKTNLNRQRPTAINLP |
| Ga0209617_103128062 | 3300027720 | Freshwater And Sediment | KAEAQAIVDGEVSKAQALWDALPAEQKTNLNRQRPTAINLP |
| Ga0209596_10395841 | 3300027754 | Freshwater Lake | IVDAEVTSAQAVYDALPEDQKNRPGFNQRPTAITLP |
| Ga0209086_101098582 | 3300027770 | Freshwater Lake | ERGVEKTKAEAQAIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP |
| Ga0209500_101441051 | 3300027782 | Freshwater Lake | KAEAQAIVDAEVTAAQAVYDALPEDQKNRPGFNQRPTAITLP |
| Ga0209353_104596371 | 3300027798 | Freshwater Lake | AQAIVDAEVAKAQATWDSLPAEQKTGVSPYGPRPSAITLE |
| Ga0209358_101616312 | 3300027804 | Freshwater Lake | EAQAIVDAEVTAAQAAYDALPEDQKNRPGFNQRPTAITLP |
| Ga0209536_1006987143 | 3300027917 | Marine Sediment | QAIVDAEVLKAQQAYDALPEEQKQFKQRPTNITLK |
| Ga0209298_100441031 | 3300027973 | Freshwater Lake | AIVDGEVAKAQAAYDALPEDQKTNLNRQRPTAINLP |
| (restricted) Ga0247834_10502221 | 3300027977 | Freshwater | IVDAEVTAAQAAWDALPDEQKNRPGFNQRPTAITLP |
| Ga0247723_10127351 | 3300028025 | Deep Subsurface Sediment | IVDAEVAKAQAAYDALPEEQKNRPGFNQRPTAITLP |
| (restricted) Ga0247832_11242711 | 3300028557 | Freshwater | VDAEVTAAQAAYDALPEEQKNRPGFNQRPTAITLP |
| (restricted) Ga0247840_100748541 | 3300028581 | Freshwater | QAIVDAEVAKAQAAYDALPAEQKTNLDRQRPTAINLP |
| Ga0307375_103324481 | 3300031669 | Soil | VDAEVTKAQAAWDALPDEQKNNGINNQRPTAITLP |
| Ga0315909_104056031 | 3300031857 | Freshwater | AQAIVDAEVTKAQAAYDALPEEQKNRPGSNQRPTAITLP |
| Ga0315294_104333691 | 3300031952 | Sediment | AQAIVDAEVTAAQAAYDALPDEQKNRPGFNQRPTAITLP |
| Ga0334722_100089041 | 3300033233 | Sediment | IVDVEVTAAQAAWDALPDEQKQQPFNRQRPTAIVLE |
| Ga0334992_0534164_387_503 | 3300033992 | Freshwater | QAIVDVEVTAAQAAWDALPDEQKQQPFNRQRPTAIVLE |
| Ga0335036_0871373_392_514 | 3300034106 | Freshwater | EAQAIVDAEIATAQAAWDALPDEQKQPPIGRQRPTAIVLE |
| Ga0348335_046640_3_119 | 3300034374 | Aqueous | DEAQAIVDAEVLKAQQAYDALPEEQKQIDRRPTNITLK |
| ⦗Top⦘ |