NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086775

Metagenome Family F086775

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086775
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 64 residues
Representative Sequence PVTGQAAISFYTMDGVKVGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNAKGIVLSPN
Number of Associated Samples 88
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.82 %
% of genes near scaffold ends (potentially truncated) 97.27 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.73

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(22.727 % of family members)
Environment Ontology (ENVO) Unclassified
(35.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.727 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 3.26%    β-sheet: 34.78%    Coil/Unstructured: 61.96%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.73
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.1.29.6: Complement C3 MG5-liked2a73a52a730.73856
b.1.29.6: Complement C3 MG5-liked3cu7a53cu70.72846
b.1.4.1: beta-Galactosidase/glucuronidase domaind1jz8a21jz80.72688
b.1.4.1: beta-Galactosidase/glucuronidase domaind4cu7a24cu70.71996
b.1.4.1: beta-Galactosidase/glucuronidase domaind2vzsa32vzs0.71888


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13231PMT_2 18.18
PF13432TPR_16 1.82
PF09650PHA_gran_rgn 1.82
PF13518HTH_28 0.91
PF13181TPR_8 0.91



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459015|G14TP7Y01D8UOHAll Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
2199352024|deeps__Contig_165626All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium557Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13286213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium560Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101908295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes726Open in IMG/M
3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1018418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium757Open in IMG/M
3300000956|JGI10216J12902_101919529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1508Open in IMG/M
3300000956|JGI10216J12902_107780710All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium743Open in IMG/M
3300003319|soilL2_10149226All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1663Open in IMG/M
3300004024|Ga0055436_10163839All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium683Open in IMG/M
3300004114|Ga0062593_100604002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1047Open in IMG/M
3300004114|Ga0062593_103250182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300004156|Ga0062589_102028680All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium584Open in IMG/M
3300005093|Ga0062594_102433609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium573Open in IMG/M
3300005289|Ga0065704_10403741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium749Open in IMG/M
3300005337|Ga0070682_101047141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium680Open in IMG/M
3300005354|Ga0070675_101286412All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium674Open in IMG/M
3300005441|Ga0070700_101426851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium586Open in IMG/M
3300005543|Ga0070672_100354795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1251Open in IMG/M
3300005577|Ga0068857_100895307All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium851Open in IMG/M
3300005578|Ga0068854_101521593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium608Open in IMG/M
3300005616|Ga0068852_102722359All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300005617|Ga0068859_102538966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300005617|Ga0068859_103136180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300005719|Ga0068861_101548206All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium652Open in IMG/M
3300005844|Ga0068862_101552922All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium668Open in IMG/M
3300005943|Ga0073926_10045465All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium843Open in IMG/M
3300006844|Ga0075428_100174235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2331Open in IMG/M
3300006844|Ga0075428_101463172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium716Open in IMG/M
3300006880|Ga0075429_101158931All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium675Open in IMG/M
3300007004|Ga0079218_11959214All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium666Open in IMG/M
3300007004|Ga0079218_13354086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium542Open in IMG/M
3300009094|Ga0111539_11778086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes715Open in IMG/M
3300009094|Ga0111539_12008623All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium671Open in IMG/M
3300009100|Ga0075418_10175093All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2284Open in IMG/M
3300009100|Ga0075418_12199042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium601Open in IMG/M
3300009147|Ga0114129_10456865All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1674Open in IMG/M
3300009148|Ga0105243_12840503All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium525Open in IMG/M
3300009156|Ga0111538_10295308All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2051Open in IMG/M
3300009156|Ga0111538_13047121All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300009176|Ga0105242_10225515All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1677Open in IMG/M
3300009553|Ga0105249_10395172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1412Open in IMG/M
3300009553|Ga0105249_11223778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium822Open in IMG/M
3300010364|Ga0134066_10423000All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300010397|Ga0134124_12407116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium568Open in IMG/M
3300012891|Ga0157305_10131083All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium654Open in IMG/M
3300012892|Ga0157294_10065573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium861Open in IMG/M
3300012892|Ga0157294_10069337All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium844Open in IMG/M
3300012892|Ga0157294_10112456All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium714Open in IMG/M
3300012892|Ga0157294_10193182All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium594Open in IMG/M
3300012893|Ga0157284_10152622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium657Open in IMG/M
3300012899|Ga0157299_10004396All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2127Open in IMG/M
3300012900|Ga0157292_10013300All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1863Open in IMG/M
3300012903|Ga0157289_10030501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1255Open in IMG/M
3300012905|Ga0157296_10047540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium995Open in IMG/M
3300012906|Ga0157295_10141424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium711Open in IMG/M
3300012910|Ga0157308_10357399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium554Open in IMG/M
3300012916|Ga0157310_10036235All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1366Open in IMG/M
3300013308|Ga0157375_10520584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1353Open in IMG/M
3300014326|Ga0157380_10828238All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium945Open in IMG/M
3300014968|Ga0157379_12555158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300015077|Ga0173483_10535745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300015200|Ga0173480_10506834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium724Open in IMG/M
3300015200|Ga0173480_10755460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium616Open in IMG/M
3300015201|Ga0173478_10162740All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium900Open in IMG/M
3300015374|Ga0132255_101037302All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1231Open in IMG/M
3300018053|Ga0184626_10415029All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300018476|Ga0190274_10096487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2334Open in IMG/M
3300018476|Ga0190274_10256911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1589Open in IMG/M
3300018476|Ga0190274_13491419All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300018482|Ga0066669_10510033All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1042Open in IMG/M
3300019361|Ga0173482_10005041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3073Open in IMG/M
3300019361|Ga0173482_10176051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium856Open in IMG/M
3300019362|Ga0173479_10010434All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2392Open in IMG/M
3300020020|Ga0193738_1014821All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2499Open in IMG/M
3300022737|Ga0247747_1022980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium695Open in IMG/M
3300022886|Ga0247746_1034545All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1134Open in IMG/M
3300022886|Ga0247746_1107476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium686Open in IMG/M
3300023057|Ga0247797_1072127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium518Open in IMG/M
3300023077|Ga0247802_1045732All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium682Open in IMG/M
3300023264|Ga0247772_1088786All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium662Open in IMG/M
3300023269|Ga0247773_1264051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium508Open in IMG/M
3300025930|Ga0207701_10653352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium893Open in IMG/M
3300025930|Ga0207701_10807653All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium790Open in IMG/M
3300025931|Ga0207644_11596553All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium547Open in IMG/M
3300025937|Ga0207669_11686296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium541Open in IMG/M
3300025940|Ga0207691_10365802All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1232Open in IMG/M
3300025942|Ga0207689_10044056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3688Open in IMG/M
3300025972|Ga0207668_10645517All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium926Open in IMG/M
3300025972|Ga0207668_11947292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300026023|Ga0207677_11287090All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium671Open in IMG/M
3300027639|Ga0209387_1197626All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium551Open in IMG/M
3300027735|Ga0209261_10038066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1196Open in IMG/M
3300027840|Ga0209683_10133864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium1130Open in IMG/M
3300027886|Ga0209486_10046441All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2158Open in IMG/M
3300027907|Ga0207428_10727091All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium709Open in IMG/M
3300027993|Ga0247749_1018917All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium726Open in IMG/M
3300028380|Ga0268265_11548092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium667Open in IMG/M
3300031847|Ga0310907_10355233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium753Open in IMG/M
3300031858|Ga0310892_10205316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1188Open in IMG/M
3300031908|Ga0310900_10978858All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium694Open in IMG/M
3300031908|Ga0310900_11783597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300031943|Ga0310885_10314986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium812Open in IMG/M
3300032012|Ga0310902_11318319All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300032013|Ga0310906_10769293All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium678Open in IMG/M
3300032075|Ga0310890_10154720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1521Open in IMG/M
3300032075|Ga0310890_10206928All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1350Open in IMG/M
3300032211|Ga0310896_10420925All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium718Open in IMG/M
3300032211|Ga0310896_10920765All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300033412|Ga0310810_10028801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6752Open in IMG/M
3300034115|Ga0364945_0286822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil22.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil10.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.64%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.73%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.82%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.91%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.91%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.91%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.91%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459015Litter degradation PV4EngineeredOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000596Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TCEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005943Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300023057Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6EnvironmentalOpen in IMG/M
3300023077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300023269Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L092-311B-6EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4PV_044127002170459015Switchgrass, Maize And Mischanthus LitterVNSPVSGQATISFYTIDGTKISEMKRDVVAKRDVWVPFNVPAVYRTRIVYTVNVGTHNAKGVVLSPN
deeps_030547102199352024SoilSLRVNSPVTGQAVIGFYTIDGVKIGEMKRDVVALKDVWVPYNVPATYRTRIVYTVTVGTYNAKGVVLSPN
ICChiseqgaiiFebDRAFT_1328621313300000363SoilSLKINSPVSGQAMISFYTMNGIKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNAKGVVLSPN*
INPhiseqgaiiFebDRAFT_10190829513300000364SoilFSLKINSPVTGQAMISFFTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVSVSGYNAKGIVLSPN*
KanNP_Total_noBrdU_T14TCDRAFT_101841823300000596SoilYTMDGVKIGEMKRDVVSLKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
JGI10216J12902_10191952913300000956SoilPNPYEENFSLKINSPVTGLAMISFYTMDGVKIGEMKRDVVASRDVWVPYNVPPVYRTRIVYTVTVGSYNAKGIVLSPN*
JGI10216J12902_10778071023300000956SoilYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGTYNAKGVVLSPN*
soilL2_1014922653300003319Sugarcane Root And Bulk SoilQALIGFYTIDGVKIGEMKRDVVANKDVWVPYNVPAAYRTRIVYTVNVGSYNAKGIVLSPNEPKP*
Ga0055436_1016383923300004024Natural And Restored WetlandsQAMISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVAVGSYNAKGIVLSPN
Ga0062593_10060400233300004114SoilISFYTMDGVKIGEMKRDVVAMKDVWVPYNVPAVYRTRIIYSVSVASYHAKGLVLSPN*
Ga0062593_10325018213300004114SoilPVTGQAMISFYTLNGVKIAEMKRDVVAFKDVSVPYSVPAAYRTRILYTVTVSGYNAKGIVLSPN*
Ga0062589_10202868013300004156SoilYPNPYQENFSLKVNSPVTGEASISFFTIDGVKISEMKRDVVANRDVWVPYNVPAVYRTRIVYHVSISGYNAKGVVLNPN*
Ga0062594_10243360913300005093SoilGQAMISFYTMNGVKVGEMKRDVVAMKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0065704_1040374113300005289Switchgrass RhizospherePNPYQENFSLKVNSPVTGQASISFYTIDGVKIGEMKRDVVANRDVWVPYNVPAVYRTRIVYHVSISGYNAKGVVLSPN*
Ga0070682_10104714123300005337Corn RhizospherePVTGQATVSFYTIDGVKVSEMKRDVVAKKDVWIPFNVPAVYRTRIVYTVNVGKHNAKGVVLSPN*
Ga0070675_10128641213300005354Miscanthus RhizosphereFYTMDGVKIGEMKRDVVALKDVWVPYNVPAAYRTRIVYTVNVGSYNAKGIVLSPN*
Ga0070700_10142685123300005441Corn, Switchgrass And Miscanthus RhizosphereVKIGEMKRDVVALRDVWVPYNVPAVYRTRIVYTVNVAGYNAKGVVLSPN*
Ga0070672_10035479523300005543Miscanthus RhizospherePNPYQENFSLKINSPITGQAAISFYTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0068857_10089530723300005577Corn RhizosphereFYTMDGVKIGEMKRDVVAMKDVSVPYNVPAVYRTRIVYTVNIAGYNAKGVVLSPN*
Ga0068854_10152159323300005578Corn RhizosphereTGQAAISFYTMDGVKIGEMKRDVVEKKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0068852_10272235923300005616Corn RhizospherePNPYQENFSLKINSPITGQAAISFYTMDGVKIGEMKRDVVEKKDVWVPYNVPAVYRTRIVYTVTVGSYNARGIVLSPN*
Ga0068859_10253896623300005617Switchgrass RhizosphereDGVKIGEMKRDVVANKDVMVPYNVPAAYRTRIVYTVSVGSYNAKGIVLSPNEP*
Ga0068859_10313618013300005617Switchgrass RhizosphereSFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNARGIVLSPN*
Ga0068861_10154820623300005719Switchgrass RhizosphereGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVTVGSHNAKGIVLSPN*
Ga0068862_10155292213300005844Switchgrass RhizosphereIDGVKIGEMKRDVTANKDVSVPFNVPSVYRTRIVYTVSVGSYNAKGIVLSPNEP*
Ga0073926_1004546523300005943SandLKVNSPVSGQALIGFYTIDGVKIGELKRDVVAKRDVMIPYTVPAAYRTRIVYTVTVGTYNAKGIVLSPN*
Ga0075428_10017423523300006844Populus RhizosphereASISFYTIDGVKIGEMKRDVVANRDVWVPYNVPAAYRTRIVYHVSVSGYNAKGVVLSPN*
Ga0075428_10146317213300006844Populus RhizosphereGQAMISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVSGYNAKGVVLSPN*
Ga0075429_10115893133300006880Populus RhizosphereSFYTMDGVKIGEMKRDVVAKRNVSVRYTVPAAYRTRVVYTVNIGGYNAKGIVLSPN*
Ga0079218_1195921423300007004Agricultural SoilNSPVTGQASISFYTIDGVKISEMKRDVVANRDVWVPYNVPAVYRTRIVYHVSVSGYNAKGVVLSPN*
Ga0079218_1335408623300007004Agricultural SoilYPNPYQENFSLKINSPLTGEASISFFTMDGVKIGEMKRDVVANRDVTVPYNVPPVYRTRIVYHVSISGYNAKGIVLSPN*
Ga0111539_1177808613300009094Populus RhizosphereSLKINSPVSGQVSISYYTIDGIKVAEMKRDVVAFTELTVPYNVPPAYRTRIVYTVSIGGYHAKGIVVSPN*
Ga0111539_1200862313300009094Populus RhizosphereINSPVSGQAMISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVSGYNAKGIVLSPN*
Ga0075418_1017509323300009100Populus RhizosphereISFYTIDGVKIGEMKRDVVANRDVWVPYNVPAAYRTRIVYHVSVSGYNAKGVVLSPN*
Ga0075418_1219904213300009100Populus RhizosphereRINSPVSGQAQIGFYTMDGVKVGEMKRDVVAFTDLSVPYTVPAVYRTRIVYTVSVGSYHAKGIVLSPN*
Ga0114129_1045686523300009147Populus RhizosphereYTIDGVKIGELKRDVVANRNVSVPFNVPAAYRTRIVYAVSISGSNYTAKGIVLSPNEP*
Ga0105243_1284050313300009148Miscanthus RhizospherePNPYQENFSLKVNSPVTGQALIGFYTIDGVKIGEMKRDVTANKDVSVPFNVPSVYRTRIVYTVSVGSYNAKGIVLSPNEP*
Ga0111538_1029530823300009156Populus RhizosphereRINSPVTGQASISFYTMDGVKIGEMKRDVVGKKDSWVPYNVPAAYRTRIVYTVNVGSYNAKGIVLSPN*
Ga0111538_1304712113300009156Populus RhizosphereTENFSLKVNSPVTGQATIGFYTIDGVKIGELKRDVVSFRDVWVPFNVPAVYRTRIVYTVAVGAYNKKGVVLSPNEP*
Ga0105242_1022551523300009176Miscanthus RhizosphereSPVTGLAMIGFYTMDGVKVGEMKRDVVAFKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0105249_1039517223300009553Switchgrass RhizosphereNFSLKINSPITGQAAISFYTMDGVKIGEMKRDVVEKKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0105249_1122377823300009553Switchgrass RhizosphereSLRVNSPVTGEAQIGFYTIDGVKIGEMKRDVVANRDQWVPFNVPAVYRTRIVYTVTVGTYNAKGVVLSPNEPSPN*
Ga0134066_1042300023300010364Grasslands SoilSPVTGQAMISFYTMTGVKIGEMKRDVVAMKDVWVPYNVPAVYRTRIVYTVTVGSYNSQGIVLSPN*
Ga0134124_1240711623300010397Terrestrial SoilTGQAIISFYTMAGVKISEMKRDVVALQDVWVPYNVPAVYRSRIVYTVNIGSYNARGIVLSPN*
Ga0157305_1013108323300012891SoilGQAMISFYTMNGVKVGEMKRDVVEKKDVWVPYNVPAAYRTRIVYTVTVGSYTAKGIVLSPN*
Ga0157294_1006557323300012892SoilKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSFNAKGIVLSPN*
Ga0157294_1006933713300012892SoilTMDGVKIGEMKRDVVAFTDVSVPYNVPAVYRTRIVYTVTVASYNAKGIVLSPN*
Ga0157294_1011245613300012892SoilISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNAKGVVLSPN*
Ga0157294_1019318213300012892SoilKVNSPLTGQATVSFYTIDGIKIAEMKKDVIGNTDVIINYTVTAAYRTRIVYTVSIGGYNARGIVLSPN*
Ga0157284_1015262213300012893SoilFPNPYEENFSLKINSPVTGQAAISFYTMDGVKVGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVTIAGYNAKGIVLSPN*
Ga0157299_1000439623300012899SoilFSLKVNSPVTGQATVSFYTIDGVKVSEMKRDVVAKRDVWIPFNVPAVYRTRIVYTVNVGKHNAKGVVLSPN*
Ga0157292_1001330013300012900SoilFPNPYEENFSLKINSPVTGLAAISFYTMDGVKISEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNAKGIVLSPN*
Ga0157289_1003050113300012903SoilLEVTAYPNPYQENFSLKVNSPVTGQATVSFYTIDGVKVSEMKRDVVAKKDVWIPFNVPAVYRTRIVYTVNVGKHNAKGVVLSPN*
Ga0157296_1004754023300012905SoilAAISFYTMDGVKVGEMKRDVVAMKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0157295_1014142423300012906SoilFYTMDGVKIGEMKRDVVEKTDVWVPYNVPAVYRTRIVYTVSVGSYNARGIVLSPN*
Ga0157308_1035739913300012910SoilSPVTGQATVSFYTIDGVKVSEMKRDVVAKRDVWIPFNVPAVYRTRIVYTVNVGSHNAKGVVLSPN*
Ga0157310_1003623523300012916SoilVTGQASISFYTMDGVKIGEMKRDVVEKTDVWVPYNVPAVYRTRIVYTVTVGSYNARGIVLSPN*
Ga0157375_1052058433300013308Miscanthus RhizosphereDGVKIGEMKIDVVEKKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0157380_1082823813300014326Switchgrass RhizosphereAAISFYTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0157379_1255515823300014968Switchgrass RhizosphereTGQAMISFYTMSGVKIGEMKRDVMAMKDVWVPYNVPAAYRTRIVYTVSVGGSYNARGIVLSPN*
Ga0173483_1053574513300015077SoilFPNPYVENFSLKINSPVTGTAMISFYTMDGVKIGEMKRDVVAMKDVWVPYNVPAVYRTRIIYSVSVASYHAKGLVLSPN*
Ga0173480_1050683413300015200SoilMNGVKVGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0173480_1075546013300015200SoilVNSPVTGQATVSFYTIDGVKVSEMKRDVVAKKDVWIPFNVPAVYRTRIVYTVNVGSHNAKGVVLSPN*
Ga0173478_1016274013300015201SoilISFYTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN*
Ga0132255_10103730223300015374Arabidopsis RhizosphereFSLKINSPVTGQAVISYYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNAKGIVLSPN*
Ga0184626_1041502913300018053Groundwater SedimentNMDGVKISEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNIAGYNAKGIVLSPN
Ga0190274_1009648713300018476SoilMDGVKVGEMKRDVVEKKDVWVPYNVPSKYRTRIVYTVTVGAYNAKGIVLSPN
Ga0190274_1025691123300018476SoilEENFSLKINSPVTGLAAISFYTMDGVKISEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNIAGYNAKGIVLSPN
Ga0190274_1349141923300018476SoilFYNMSGVKISEMKRDVVAFQDLSVPYAVPEGHRTRIVYTVNVGSYNARGIVLSPN
Ga0066669_1051003323300018482Grasslands SoilKIAEMKRDVVAFKDVWVPYSVPAAYRTRILYTVNVAGYNAKGIVLSPN
Ga0173482_1000504113300019361SoilEVTAYPNPYQENFSLKVNSPVTGQATVSFYTIDGVKVSEMKRDVVAKKDVWIPFNVPAVYRTRIVYTVNVGSHNAKGVVLSPN
Ga0173482_1017605113300019361SoilMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYTAKGIVLSPN
Ga0173479_1001043423300019362SoilFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGTYNAKGVVLSPN
Ga0193738_101482133300020020SoilKVNSPVSGQAAIGFYTIDGVKIGELKRDVVANKDVWVPFNVPAVYRTRIVYTVAVGSYNAKGVVLSPN
Ga0247747_102298013300022737SoilQAMISFYTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN
Ga0247746_103454513300022886SoilTAFPNPYVENFSLKINSPVTGTAMISFYTMDGVKIGEMKRDVVAMKDVWVPYNVPAVYRTRIIYSVSVASYHAKGLVLSPN
Ga0247746_110747623300022886SoilYTIDGVKVSEMKRDVVAKRDVWIPFNVPAVYRTRIVYTVNVGSHNAKGVVLSPN
Ga0247797_107212723300023057SoilAFPNPYEENFSLKINSPVTGLAAISFYTMDGVKISEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNAKGIVLSPN
Ga0247802_104573213300023077SoilTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN
Ga0247772_108878613300023264Plant LitterKVNSPVTGQATVSFYTIDGVKVSEMKRDVVAKKDVWIPFNVPAVYRTRIVYTVNVGKHNAKGVVLSPN
Ga0247773_126405123300023269Plant LitterAISFYTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN
Ga0207701_1065335213300025930Corn, Switchgrass And Miscanthus RhizosphereKINSPVTGQAMISFYTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN
Ga0207701_1080765313300025930Corn, Switchgrass And Miscanthus RhizospherePVTGQASISFYTMDGVKIGEMKRDVVEKTDVWVPYNVPAVYRTRIVYTVSVGSYNARGIVLSPN
Ga0207644_1159655313300025931Switchgrass RhizosphereSPVTGQAMISFYTMNGVKIAEMKRDVVAFKDLSVPYSVPAAYRTRILYTVTVSGYNAKGIVLSPN
Ga0207669_1168629623300025937Miscanthus RhizosphereSLKINSPVTGQAMISFYTMNGVKVGEMKRDVVAMKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN
Ga0207691_1036580223300025940Miscanthus RhizosphereKINSPITGQAAISFYTMDGVKVGEMKRDVVAKTDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN
Ga0207689_1004405633300025942Miscanthus RhizosphereTGQAMISFYTMDGVKIGEMKRDVVALRDVWVPYNVPAVYRTRIVYTVNVAGYNAKGVVLSPN
Ga0207668_1064551723300025972Switchgrass RhizosphereGVKIGEMKRDVVANKDVWVPFNVPSVYRTRIVYTVAVGSYNAKGVVLSPNEPKP
Ga0207668_1194729223300025972Switchgrass RhizospherePVTGQAAISFYTMDGVKVGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVGSYNAKGIVLSPN
Ga0207677_1128709013300026023Miscanthus RhizospherePYQENFSLKINSPVTGQAMISFYTMNGVKVGEMKRDVVAMKDVWVPYNVPAVYRTRIVYTVTVGSYNAKGIVLSPN
Ga0209387_119762623300027639Agricultural SoilSFFTMDGVKIGEMKRDVVANRDVTVPYNVPAVYRTRIVYHVSVSGYNAKGVVLSPN
Ga0209261_1003806613300027735Wetland SedimentAYPNPYQENFSLKVNSPVSGQAAIGFYTIDGVKIGELKRDVVANRDVWVPFNVPAVYRTRIVYTVAVGTYNAKGVVLSPN
Ga0209683_1013386433300027840Wetland SedimentQENFSLKVNSPVSGQAAIGFYTIDGVKIGELKRDVVANRDVWVPFNVPAIYRTRIVYTVAVGSYNAKGVVLSPN
Ga0209486_1004644123300027886Agricultural SoilVKISEMKRDVVAKREVWVPFNVPAVYRTRIVYTVNVGSHNAIGVVLSPN
Ga0207428_1072709123300027907Populus RhizosphereSPVTGQAAISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAAYRTRLVYTVNVGSYNAKGVVLSPN
Ga0247749_101891723300027993SoilENFSLRINSPVTGQAMISFYTLNGVKIAEMKRDVVAFKDVSVPYSVPAAYRTRILYTVTVSGYNAKGIVLSPN
Ga0268265_1154809223300028380Switchgrass RhizosphereGVKIGEMKRDVVAMKDVSVPYNVPAVYRTRIVYTVNIAGYNAKGVVLSPN
Ga0310907_1035523313300031847SoilYEENFSLKINSPVSGQAMISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVSGYNAKGVVLSPN
Ga0310892_1020531623300031858SoilGQASISFYTMSGVKIGELKRDVVAKKDVWVPYRVPAVYRTRIVYTVNVGSHNAKGIVLSP
Ga0310900_1097885813300031908SoilINSPVSGQASIGFYTMDGVKIGEMKRDVVALTDIWVPYNVPAAYKTRIVYTVAVSGYHARGIVLSPN
Ga0310900_1178359723300031908SoilVAEMKRDVVAFTELTVPYNVPPAYRTRIVYTVSIGGYHAKGIVVSPN
Ga0310885_1031498623300031943SoilINSPVAGQAMISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVSGYNAKGVVLSPN
Ga0310902_1131831923300032012SoilISFYTMDGVKIGEMKRDVVEKTDVWVPYNVPAVYRTRIVYTVSVGSYNARGIVLSPN
Ga0310906_1076929323300032013SoilEENFSLKINSPVSGQAMISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVSGYNAKGVVLSPN
Ga0310890_1015472023300032075SoilFYNMNGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNIAGYNARGIVLSPN
Ga0310890_1020692813300032075SoilEENFSLKINSPVTGQAMISFYTMDGVKIGEMKRDVVALKDVWVPYNVPAVYRTRIVYTVNVSGYNAKGVVLSPN
Ga0310896_1042092513300032211SoilYTMDGVKIGEMKRDVVGKRDVWVPYNVPAKYRTRIVYTVTVGSYNAKGIVLSPN
Ga0310896_1092076513300032211SoilPVTGQASISFYTMSGVKIGELKRDVVAKKDVWVPYRVPAVYRTRIVYTVNVGSHNAKGIVLSPN
Ga0310810_1002880153300033412SoilINSPVTGQAMISFYTMSGVKIGEMKRDVVAMKDVWVPYNVPVAYRTRIVYTVSVGGSYNARGIVLSPN
Ga0364945_0286822_262_4383300034115SedimentMISFYTMNGVKIGEMKRDVVANKNVWVPYNVPAAYRTRVVYTVSVGGYNAKGIVLSPN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.