NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086770

Metagenome / Metatranscriptome Family F086770

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086770
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 43 residues
Representative Sequence LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA
Number of Associated Samples 83
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 40.91 %
% of genes near scaffold ends (potentially truncated) 67.27 %
% of genes from short scaffolds (< 2000 bps) 77.27 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(29.091 % of family members)
Environment Ontology (ENVO) Unclassified
(23.636 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.364 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.14%    β-sheet: 0.00%    Coil/Unstructured: 72.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF13561adh_short_C2 2.73
PF01609DDE_Tnp_1 2.73
PF13751DDE_Tnp_1_6 2.73
PF07883Cupin_2 2.73
PF00496SBP_bac_5 2.73
PF13683rve_3 1.82
PF13340DUF4096 1.82
PF03972MmgE_PrpD 1.82
PF10258PHAX_RNA-bd 1.82
PF02371Transposase_20 1.82
PF13586DDE_Tnp_1_2 1.82
PF13610DDE_Tnp_IS240 1.82
PF02775TPP_enzyme_C 1.82
PF02585PIG-L 1.82
PF04909Amidohydro_2 0.91
PF00226DnaJ 0.91
PF00296Bac_luciferase 0.91
PF13560HTH_31 0.91
PF08592Anthrone_oxy 0.91
PF13738Pyr_redox_3 0.91
PF12762DDE_Tnp_IS1595 0.91
PF01872RibD_C 0.91
PF05534HicB 0.91
PF08241Methyltransf_11 0.91
PF07690MFS_1 0.91
PF01327Pep_deformylase 0.91
PF02899Phage_int_SAM_1 0.91
PF02894GFO_IDH_MocA_C 0.91
PF01797Y1_Tnp 0.91
PF01370Epimerase 0.91
PF00561Abhydrolase_1 0.91
PF13701DDE_Tnp_1_4 0.91
PF00582Usp 0.91
PF13592HTH_33 0.91
PF01116F_bP_aldolase 0.91
PF13482RNase_H_2 0.91
PF09423PhoD 0.91
PF07992Pyr_redox_2 0.91
PF00011HSP20 0.91
PF01339CheB_methylest 0.91
PF13384HTH_23 0.91
PF00588SpoU_methylase 0.91
PF00589Phage_integrase 0.91
PF07592DDE_Tnp_ISAZ013 0.91
PF11941DUF3459 0.91
PF00239Resolvase 0.91
PF00076RRM_1 0.91
PF13546DDE_5 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 2.73
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 2.73
COG5421TransposaseMobilome: prophages, transposons [X] 2.73
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 2.73
COG3293TransposaseMobilome: prophages, transposons [X] 2.73
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 2.73
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 1.82
COG3547TransposaseMobilome: prophages, transposons [X] 1.82
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 1.82
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 1.82
COG0566tRNA G18 (ribose-2'-O)-methylase SpoUTranslation, ribosomal structure and biogenesis [J] 0.91
COG0191Fructose/tagatose bisphosphate aldolaseCarbohydrate transport and metabolism [G] 0.91
COG0219tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domainTranslation, ribosomal structure and biogenesis [J] 0.91
COG0242Peptide deformylaseTranslation, ribosomal structure and biogenesis [J] 0.91
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.91
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.91
COG4226Predicted nuclease of the RNAse H fold, HicB familyGeneral function prediction only [R] 0.91
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.91
COG0565tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferaseTranslation, ribosomal structure and biogenesis [J] 0.91
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.91
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 0.91
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.91
COG1598Antitoxin component HicB of the HicAB toxin-antitoxin systemDefense mechanisms [V] 0.91
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.91
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 0.91
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.91
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.00 %
UnclassifiedrootN/A30.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502000|ACOD_FV90NF402F6C8FAll Organisms → cellular organisms → Bacteria505Open in IMG/M
2088090014|GPIPI_17091283Not Available1099Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100499150Not Available707Open in IMG/M
3300000550|F24TB_10577737All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300004633|Ga0066395_10069709All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1615Open in IMG/M
3300004798|Ga0058859_11351791Not Available650Open in IMG/M
3300005187|Ga0066675_10029368All Organisms → cellular organisms → Bacteria3209Open in IMG/M
3300005294|Ga0065705_10019206All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300005294|Ga0065705_10480317All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005332|Ga0066388_100444622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1938Open in IMG/M
3300005440|Ga0070705_101079780Not Available656Open in IMG/M
3300005718|Ga0068866_11296519Not Available529Open in IMG/M
3300005764|Ga0066903_101421376All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300005764|Ga0066903_105229184Not Available686Open in IMG/M
3300005937|Ga0081455_10030045All Organisms → cellular organisms → Bacteria4944Open in IMG/M
3300006049|Ga0075417_10019317All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_42694Open in IMG/M
3300006049|Ga0075417_10032885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2159Open in IMG/M
3300006844|Ga0075428_100823115Not Available986Open in IMG/M
3300006844|Ga0075428_101888977Not Available620Open in IMG/M
3300006845|Ga0075421_100048385All Organisms → cellular organisms → Bacteria → Proteobacteria5385Open in IMG/M
3300006845|Ga0075421_101592650All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium711Open in IMG/M
3300006846|Ga0075430_100125689All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300006846|Ga0075430_100499912Not Available1003Open in IMG/M
3300006846|Ga0075430_100538846All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium963Open in IMG/M
3300006847|Ga0075431_100476885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1241Open in IMG/M
3300006852|Ga0075433_10485984All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1088Open in IMG/M
3300006852|Ga0075433_11942509All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006853|Ga0075420_100434181Not Available1135Open in IMG/M
3300006853|Ga0075420_101363320Not Available609Open in IMG/M
3300006871|Ga0075434_100868108All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium917Open in IMG/M
3300006880|Ga0075429_100203632Not Available1734Open in IMG/M
3300006881|Ga0068865_101749352Not Available561Open in IMG/M
3300006904|Ga0075424_100128004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2685Open in IMG/M
3300006904|Ga0075424_100579251Not Available1198Open in IMG/M
3300006904|Ga0075424_100795630Not Available1009Open in IMG/M
3300007076|Ga0075435_100082691All Organisms → cellular organisms → Bacteria2640Open in IMG/M
3300007265|Ga0099794_10070386All Organisms → cellular organisms → Bacteria1713Open in IMG/M
3300009012|Ga0066710_100812893All Organisms → cellular organisms → Bacteria1433Open in IMG/M
3300009090|Ga0099827_10159365All Organisms → cellular organisms → Bacteria1852Open in IMG/M
3300009090|Ga0099827_10884814All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300009094|Ga0111539_11536746Not Available772Open in IMG/M
3300009098|Ga0105245_10114615All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2510Open in IMG/M
3300009100|Ga0075418_10191693All Organisms → cellular organisms → Bacteria2177Open in IMG/M
3300009100|Ga0075418_10191796All Organisms → cellular organisms → Bacteria2176Open in IMG/M
3300009100|Ga0075418_10249553All Organisms → cellular organisms → Bacteria1890Open in IMG/M
3300009100|Ga0075418_10481058Not Available1331Open in IMG/M
3300009100|Ga0075418_11710205Not Available684Open in IMG/M
3300009137|Ga0066709_101736009All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor882Open in IMG/M
3300009147|Ga0114129_10348413All Organisms → cellular organisms → Bacteria1963Open in IMG/M
3300009147|Ga0114129_12972617Not Available558Open in IMG/M
3300009553|Ga0105249_11649006All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300009792|Ga0126374_10272034All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300010038|Ga0126315_10424722All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium839Open in IMG/M
3300010046|Ga0126384_10060630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium2650Open in IMG/M
3300010046|Ga0126384_10566680Not Available989Open in IMG/M
3300010145|Ga0126321_1497440Not Available908Open in IMG/M
3300010359|Ga0126376_10921425All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300010359|Ga0126376_11958691All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium627Open in IMG/M
3300010360|Ga0126372_10059750All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella2643Open in IMG/M
3300010360|Ga0126372_10244335Not Available1535Open in IMG/M
3300010360|Ga0126372_12392291Not Available579Open in IMG/M
3300010361|Ga0126378_10424262All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca1443Open in IMG/M
3300010362|Ga0126377_10420551All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300010362|Ga0126377_11526675Not Available742Open in IMG/M
3300010366|Ga0126379_11634205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi749Open in IMG/M
3300010366|Ga0126379_12688242All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella595Open in IMG/M
3300012199|Ga0137383_10742435All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis717Open in IMG/M
3300012209|Ga0137379_10085335All Organisms → cellular organisms → Bacteria3037Open in IMG/M
3300012209|Ga0137379_10548677Not Available1063Open in IMG/M
3300012211|Ga0137377_10083088All Organisms → cellular organisms → Bacteria3016Open in IMG/M
3300012362|Ga0137361_11695739Not Available551Open in IMG/M
3300012918|Ga0137396_10964099Not Available620Open in IMG/M
3300012930|Ga0137407_10927077All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300012944|Ga0137410_11271299All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300012971|Ga0126369_10051441All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter3523Open in IMG/M
3300012971|Ga0126369_11300506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria817Open in IMG/M
3300012971|Ga0126369_12689640Not Available582Open in IMG/M
3300013306|Ga0163162_10036262All Organisms → cellular organisms → Bacteria4913Open in IMG/M
3300015241|Ga0137418_10028215All Organisms → cellular organisms → Bacteria5193Open in IMG/M
3300015373|Ga0132257_100923489All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300015374|Ga0132255_101427360All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300016371|Ga0182034_11545569All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300016422|Ga0182039_11000650Not Available750Open in IMG/M
3300017792|Ga0163161_10872440Not Available761Open in IMG/M
3300021344|Ga0193719_10435052All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37536Open in IMG/M
3300026067|Ga0207678_10078607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon aurantiacus → Herpetosiphon aurantiacus DSM 7852825Open in IMG/M
3300026118|Ga0207675_101532822All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300026295|Ga0209234_1212065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus648Open in IMG/M
3300026528|Ga0209378_1032576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_62724Open in IMG/M
3300027846|Ga0209180_10123535All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300027875|Ga0209283_10212719All Organisms → cellular organisms → Bacteria1284Open in IMG/M
3300027880|Ga0209481_10718626Not Available519Open in IMG/M
3300027903|Ga0209488_11217577Not Available506Open in IMG/M
3300027907|Ga0207428_10044252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G73592Open in IMG/M
3300027909|Ga0209382_10008311All Organisms → cellular organisms → Bacteria → Proteobacteria13092Open in IMG/M
3300027909|Ga0209382_10039924All Organisms → cellular organisms → Bacteria5623Open in IMG/M
3300028592|Ga0247822_10163017All Organisms → cellular organisms → Bacteria1648Open in IMG/M
3300028608|Ga0247819_10109378All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-91396Open in IMG/M
3300030563|Ga0247653_1000646All Organisms → cellular organisms → Bacteria1239Open in IMG/M
3300031058|Ga0308189_10016277All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1668Open in IMG/M
3300031092|Ga0308204_10019111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1388Open in IMG/M
3300031114|Ga0308187_10476057All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15509Open in IMG/M
3300031573|Ga0310915_10059853All Organisms → cellular organisms → Bacteria2483Open in IMG/M
3300031719|Ga0306917_10096091All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp.2116Open in IMG/M
3300031833|Ga0310917_10675660All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales700Open in IMG/M
3300031910|Ga0306923_10471678All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp.1422Open in IMG/M
3300031954|Ga0306926_11398668All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300032174|Ga0307470_11459734Not Available567Open in IMG/M
3300032211|Ga0310896_10628188All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300032261|Ga0306920_101260979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1065Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere29.09%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil14.55%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.73%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.82%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.91%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.91%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.91%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.91%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.91%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.91%
Fungus GardenHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden0.91%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.91%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.91%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502000Fungus garden microbial communities from Atta colombica in Panama - dump bottomHost-AssociatedOpen in IMG/M
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300030563Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ACODB_129602802040502000Fungus GardenDVPMAYNPTFVMLPSLKSLFFNSFKNELRLLDNVGA
GPIPI_022889002088090014SoilVDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGAQAPGVVF
INPhiseqgaiiFebDRAFT_10049915013300000364SoilLVSRVVDLPMAHNLTFVILSSLKPLFFNXLKNEFRFSDNV
F24TB_1057773713300000550SoilMSVLHQQLPPRLLLDSRGVDEPMAYNSTLVILSSLKPLFFNSLNNELRFSDN
Ga0066395_1006970923300004633Tropical Forest SoilLDSRVVDVSIAYTPTLVMLSSLKPLFFNSLSNELHFSDNAGA*
Ga0058859_1135179123300004798Host-AssociatedMRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFSDNTGA*
Ga0066675_1002936843300005187SoilVGNLLRLLLDSRVVDVPMESNPTFVILTPWKPLFINSLKNELCFSDNAGV*
Ga0065705_1001920623300005294Switchgrass RhizosphereMAHYEYXLLLDSRVVDLSTAYHPTLVXLSSLKPLFFNXLKDELRFLDNGGA*
Ga0065705_1048031723300005294Switchgrass RhizosphereLVSRVVDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGA*
Ga0066388_10044462233300005332Tropical Forest SoilMLLKLVKPELLDSRVVDVSMAYSPTLVILSSLKPLFFNGLKNELRFLDNAGA*
Ga0070705_10107978013300005440Corn, Switchgrass And Miscanthus RhizosphereLLLDARVVDVTMAYNPPFVMRSSLKPFFFNGLKHKLRFSDNTGA*
Ga0068866_1129651913300005718Miscanthus RhizosphereLQRGRKHSRSRTMRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFSDNTGA*
Ga0066903_10142137613300005764Tropical Forest SoilLLLDSRVVDVPMAYNPTFVMLSSLKPFFFHSLKNELPFSDNAGA*
Ga0066903_10522918413300005764Tropical Forest SoilLLLDSRVVDVPIAYNPTFVVLFSLKPFFFNSLKNERRFSDNAGA*
Ga0081455_1003004523300005937Tabebuia Heterophylla RhizosphereMDVPMAYNPAFVMLSYVKPLFFSNLKNEFCFSDNARA*
Ga0075417_1001931733300006049Populus RhizosphereLDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA*
Ga0075417_1003288513300006049Populus RhizospherePMACNPTLIILSSLKSLFFNNLTNELYFSDNVGAQDPGIQ*
Ga0075428_10082311513300006844Populus RhizosphereLLDSRVVDVPMAYNPTFVMLSSFKPLYLNSLKKEVCFADHAGA*
Ga0075428_10188897723300006844Populus RhizosphereLDSRVVAVPMASNPTFVMLSSLKPLFFNSLKNEWCFLDNE
Ga0075421_10004838563300006845Populus RhizosphereMPYRSRLLLDSRVLDAPMAYNLIFVTLSSLKPLFFNSHKKELCFSDNMGT*
Ga0075421_10159265023300006845Populus RhizosphereRLLLDSRVVDEPMAYNPTFVILSSLKPLFFNSLKNELRFSDNAGA*
Ga0075430_10012568923300006846Populus RhizospherePTFVMLSSLKSLFFNSRKNAFRFLDNVGAKAPGIQ*
Ga0075430_10049991223300006846Populus RhizosphereLDSRVVDMPMASTPNFVMLSSLKPLFINGLKNAVCFSDNAGA*
Ga0075430_10053884633300006846Populus RhizosphereWLLLDSRVVDLLMAYNPTFVMLSFLKPLFFNSLKNEFRFSDNAGA*
Ga0075431_10047688523300006847Populus RhizosphereEWLLLDSRVVDVPMACNPTFVMLSSLQPFFFNGLQNALCFSDNAGA*
Ga0075433_1048598433300006852Populus RhizosphereDLSMASNPTFVFLSSLKPLFFNSPEKALHFSDNTGA*
Ga0075433_1194250913300006852Populus RhizosphereVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0075420_10043418123300006853Populus RhizosphereMGIYRVWLLLDSRVVDVPMAYDPPFVMPSSLKPLFFNSLKHKLHFSDNTGT*
Ga0075420_10136332023300006853Populus RhizosphereLDSRVVDLLMAYNPTFVILSFLKPLFLNSLKNELRFSDNAGA*
Ga0075434_10086810813300006871Populus RhizosphereDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSNNAGA*
Ga0075429_10020363223300006880Populus RhizosphereLDARGVDVPMASNPTFVMLSSVKPLLFMSLTKALCFSDNAGA*
Ga0068865_10174935213300006881Miscanthus RhizosphereMRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFS
Ga0075424_10012800433300006904Populus RhizosphereMASTPTFVMLSSLKPLFVNSLKNELRFSDNVGAEDPGIQ*
Ga0075424_10057925133300006904Populus RhizospherePMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0075424_10079563013300006904Populus RhizosphereVDLSMASNPTLVFLSSLEPLFFNSPANEFRFSDNTGA*
Ga0075435_10008269163300007076Populus RhizosphereLLLDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA*
Ga0099794_1007038623300007265Vadose Zone SoilVDVPMADNPTFVILSSLKPLFFNGLKNELCFSVNAGA*
Ga0066710_10081289313300009012Grasslands SoilLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSD
Ga0099827_1015936533300009090Vadose Zone SoilVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSNNAGA*
Ga0099827_1088481423300009090Vadose Zone SoilVTALEQHIQAWLLLDARVVDVPMAYNPTFVMLSSLKPLFFHGLKNDLCCSDNAG
Ga0111539_1153674613300009094Populus RhizosphereVDVLMAYNPTFVLLSFLKPFFFKSLNNELSFSDNAGA*
Ga0105245_1011461543300009098Miscanthus RhizosphereLLDARVVDVTMAYNPPFVMRSSLKPFFFNGLKHKLRFSDNTGA*
Ga0075418_1019169353300009100Populus RhizosphereMRLLLDSRVVEVLMAYNATFVILSSLEPLFFHSHRHELRFSDNAGA*
Ga0075418_1019179633300009100Populus RhizosphereLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAG
Ga0075418_1024955343300009100Populus RhizosphereDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0075418_1048105823300009100Populus RhizosphereGVEVPMAYTPPFVMLSSLQPLFFNSLKNEVRFLDNVGA*
Ga0075418_1171020513300009100Populus RhizosphereQRRLLLDSRGVDVPMAYNPTFVMLSSLKPLFLYSLKKEWCFSDRAGA*
Ga0066709_10173600913300009137Grasslands SoilTLLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSDNAGA*
Ga0114129_1034841343300009147Populus RhizosphereMRLLLDSRVVEVLMAYNATFVILSSLEPLFFHSHRHELRFSYNAGA*
Ga0114129_1297261723300009147Populus RhizosphereLLLDSRVVDEPMAYNPTFVILSSSKPLFFNSLKNDLRFSDNAGA*
Ga0105249_1164900623300009553Switchgrass RhizosphereEGLLLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0126374_1027203423300009792Tropical Forest SoilVDVLMAYNPTFVMLAFLKPLFFNSLKNEIRFSDNAGA*
Ga0126315_1042472233300010038Serpentine SoilLDSRVVDVSRAYTPTLVMLSSLKPLFFNSLSNELHFSDN
Ga0126384_1006063043300010046Tropical Forest SoilLLLDSRVVDVLMAYNPTFVMLAFLKPSFFNSLKNEIRFSDNAGA*
Ga0126384_1056668013300010046Tropical Forest SoilVDVLMAYNPTFVMLAFLKPLFFNSLKNEIRFSENAGA*
Ga0126321_149744033300010145SoilSGTDSPLSVYARLLLDSRVVDMPMASNPNFVLLSSLKPLFCNGLKNALCFSDNAGA*
Ga0126376_1092142513300010359Tropical Forest SoilMLSYDKWLLLDSRGVDVPMVYAPTFAMLSSLKPLFFNSLTNTLRFSDKAGA*
Ga0126376_1195869113300010359Tropical Forest SoilQRETIPTFVMLFSLKPLFFNSLKNALGFSDNPGA*
Ga0126372_1005975033300010360Tropical Forest SoilMFQSRLLLDSRVVDVSTAYHPTLVILSSLKPLFFNRFKNELRFLDNGGA*
Ga0126372_1024433513300010360Tropical Forest SoilVDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNA
Ga0126372_1239229123300010360Tropical Forest SoilLDSRVVYVPMAYNPTCVLLSSLKPFFCHRLKNESPFSDNARA*
Ga0126378_1042426213300010361Tropical Forest SoilLSMAYNPTFVVLSSVKPLFFNNLKNELRFLGNVGA*
Ga0126377_1042055123300010362Tropical Forest SoilLVDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNAGA*
Ga0126377_1152667513300010362Tropical Forest SoilVDVPMVYNLGFAMLSSLKLLFFKSLKNALRFSDNAAA*
Ga0126379_1163420513300010366Tropical Forest SoilMPSRLLLDSRVVDVPMASNPIVVTLSSLKPFFFNSLNTEVRFSDHVGA
Ga0126379_1268824213300010366Tropical Forest SoilLLLDSRVVDVAMVYNPNFVILSSLKPLFFNSDKNELRFSDNAGA*
Ga0137383_1074243533300012199Vadose Zone SoilVVDVPMASNPTFVMLSSLKPLFFNSLKNELCFSDNAGA*
Ga0137379_1008533543300012209Vadose Zone SoilSRVVDLLMAYNPTFVMLSFLKPLFFNSLKNEFRFSDNAGA*
Ga0137379_1054867723300012209Vadose Zone SoilLLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELCFSDNAGA*
Ga0137377_1008308833300012211Vadose Zone SoilQGSSGRYNARLLLDSRVVDVPMASNPTFVMLSALKPLFFNSLKNELCFSDNAGA*
Ga0137361_1169573913300012362Vadose Zone SoilDVPMAYNLTFVMLSSLKPLFFNNLKNELPFLDHAGA*
Ga0137396_1096409913300012918Vadose Zone SoilDLLMAYNPTFVMLSFLKPLFCNRLKNEFRFSDNVGA*
Ga0137407_1092707713300012930Vadose Zone SoilDLPMAYNPILVLLSSLKPLFFNSLKNELRFSDNAGA*
Ga0137410_1127129923300012944Vadose Zone SoilLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0126369_1005144113300012971Tropical Forest SoilMPCQMGLLLESRVVDVSMVSNPTVVFLSSLRPLFFNSPENEFRFSDNTGA*
Ga0126369_1130050633300012971Tropical Forest SoilVVAVPMASHPTCVMFSSWKPLFFNSLKHEFHFSDNAGA*
Ga0126369_1268964023300012971Tropical Forest SoilVLRLLVDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNA
Ga0163162_1003626223300013306Switchgrass RhizosphereMAHNLTFVILSSLKSLFFNNLKNEFRFSDNVGAQAPGVVF*
Ga0137418_1002821533300015241Vadose Zone SoilMWKISRLLLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA*
Ga0132257_10092348913300015373Arabidopsis RhizosphereLDSRVVDVPMMSNPTFVMLSSLQPFFFNSLQMGVCCTDNAG
Ga0132255_10142736023300015374Arabidopsis RhizosphereMKIATNPVDLLMAYNPTFVMLSFLKPLFFNSLKNELRFSGNAGA*
Ga0182034_1154556923300016371SoilVVYVTMAKTPTFVMRSFLKSFFLNSLKNELPFSDNAGA
Ga0182039_1100065013300016422SoilMPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAYDPGIQEERPRFSP
Ga0163161_1087244023300017792Switchgrass RhizosphereVDLPMAQNLTFVILSSLKPLFFNNLKNEFRFSDNVGA
Ga0193719_1043505223300021344SoilLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSD
Ga0207678_1007860733300026067Corn RhizosphereFFNLRWLLLDSRVVDMPMASNPNFVLLFSLKPFFFNGLKNALGFEANAGA
Ga0207675_10153282223300026118Switchgrass RhizosphereFRFGLLLDSRVVDLPMTYGLTFDVLLSLKPLFFNSLKNKSRFSDNVEA
Ga0209234_121206523300026295Grasslands SoilQTLLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLKNELRFSGNAGA
Ga0209378_103257613300026528SoilIWLLLDSRVVDLSMASNPTFVFLSSLKPLFFNSPENELRFSDNPGA
Ga0209180_1012353553300027846Vadose Zone SoilVDLPMAYNPIFVIFSSLKPLFFNSLKNELRFSDNAGV
Ga0209283_1021271913300027875Vadose Zone SoilRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSDNAGA
Ga0209481_1071862613300027880Populus RhizosphereRLLLDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA
Ga0209488_1121757713300027903Vadose Zone SoilVDVPMADNPTFVILSSLKPLFFNGLKNELCFSVNAGA
Ga0207428_1004425213300027907Populus RhizosphereHNDSQGERLLLDSRVLDAPRAYNLIFVTPPSLKPLFFNSHKKELGFSDHMGT
Ga0209382_1000831193300027909Populus RhizosphereMPYRSRLLLDSRVLDAPMAYNLIFVTLSSLKPLFFNSHKKELCFSDNMGT
Ga0209382_1003992413300027909Populus RhizosphereMPMAYNPTFVMLSSLKSLFFNSRKNAFRFLDNVGAKAPGIQ
Ga0247822_1016301723300028592SoilVDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGA
Ga0247819_1010937823300028608SoilVDLPMAHNLTFVILSSLNPLFFNNLKNEFRFSDNVGA
Ga0247653_100064623300030563SoilDSRVVDVSMASNPTFVFLSSLEPLFFNNPENELRFSDNTGA
Ga0308189_1001627713300031058SoilVELPMGDNPTFVILSSLKPFFFNRLKSEWRFVDNVGA
Ga0308204_1001911113300031092SoilSRVVDLTMPCDPIVVTLSSLKPLFFKGLQNELRFSDNLEA
Ga0308187_1047605723300031114SoilLLDSRVVDVPMAYNSIFVTPYSMKLFFFNGLKNELRFSDNVG
Ga0310915_1005985323300031573SoilMLSYDKWLLLDSRGVDVPMVYGPTFVMLSSLKPLFFNSLTNKLRFSDKAGA
Ga0306917_1009609143300031719SoilMPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAY
Ga0310917_1067566023300031833SoilDSRVVDLLMAYNLTFVRFSFLKSLFFNSLKNEFRFSDNAGV
Ga0306923_1047167813300031910SoilMPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAYDPGIQEERPRFSS
Ga0306926_1139866813300031954SoilLDSRVVEVPMAYNPTFVMLSSLKPLFLHSLKNALCFSDN
Ga0307470_1145973413300032174Hardwood Forest SoilMECRKYEWLLLDFRVMELARPYPQTFVMLSSWKPLFFNSLKHEFRFSDHIGA
Ga0310896_1062818823300032211SoilMASNPTFIVLSFLKPLFFTGLKNESPFSDNVEAEDP
Ga0306920_10126097923300032261SoilPKRLLLDSRVVDVPMASNLTFVMLSSWKALFFNSLKNDLCFSANAGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.