| Basic Information | |
|---|---|
| Family ID | F086770 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 40.91 % |
| % of genes near scaffold ends (potentially truncated) | 67.27 % |
| % of genes from short scaffolds (< 2000 bps) | 77.27 % |
| Associated GOLD sequencing projects | 80 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (29.091 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.636 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.14% β-sheet: 0.00% Coil/Unstructured: 72.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 2.73 |
| PF01609 | DDE_Tnp_1 | 2.73 |
| PF13751 | DDE_Tnp_1_6 | 2.73 |
| PF07883 | Cupin_2 | 2.73 |
| PF00496 | SBP_bac_5 | 2.73 |
| PF13683 | rve_3 | 1.82 |
| PF13340 | DUF4096 | 1.82 |
| PF03972 | MmgE_PrpD | 1.82 |
| PF10258 | PHAX_RNA-bd | 1.82 |
| PF02371 | Transposase_20 | 1.82 |
| PF13586 | DDE_Tnp_1_2 | 1.82 |
| PF13610 | DDE_Tnp_IS240 | 1.82 |
| PF02775 | TPP_enzyme_C | 1.82 |
| PF02585 | PIG-L | 1.82 |
| PF04909 | Amidohydro_2 | 0.91 |
| PF00226 | DnaJ | 0.91 |
| PF00296 | Bac_luciferase | 0.91 |
| PF13560 | HTH_31 | 0.91 |
| PF08592 | Anthrone_oxy | 0.91 |
| PF13738 | Pyr_redox_3 | 0.91 |
| PF12762 | DDE_Tnp_IS1595 | 0.91 |
| PF01872 | RibD_C | 0.91 |
| PF05534 | HicB | 0.91 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF07690 | MFS_1 | 0.91 |
| PF01327 | Pep_deformylase | 0.91 |
| PF02899 | Phage_int_SAM_1 | 0.91 |
| PF02894 | GFO_IDH_MocA_C | 0.91 |
| PF01797 | Y1_Tnp | 0.91 |
| PF01370 | Epimerase | 0.91 |
| PF00561 | Abhydrolase_1 | 0.91 |
| PF13701 | DDE_Tnp_1_4 | 0.91 |
| PF00582 | Usp | 0.91 |
| PF13592 | HTH_33 | 0.91 |
| PF01116 | F_bP_aldolase | 0.91 |
| PF13482 | RNase_H_2 | 0.91 |
| PF09423 | PhoD | 0.91 |
| PF07992 | Pyr_redox_2 | 0.91 |
| PF00011 | HSP20 | 0.91 |
| PF01339 | CheB_methylest | 0.91 |
| PF13384 | HTH_23 | 0.91 |
| PF00588 | SpoU_methylase | 0.91 |
| PF00589 | Phage_integrase | 0.91 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.91 |
| PF11941 | DUF3459 | 0.91 |
| PF00239 | Resolvase | 0.91 |
| PF00076 | RRM_1 | 0.91 |
| PF13546 | DDE_5 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.73 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.73 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.73 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.73 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.73 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.73 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.82 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.82 |
| COG2201 | Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domains | Signal transduction mechanisms [T] | 1.82 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 1.82 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.91 |
| COG0219 | tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG0242 | Peptide deformylase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.91 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.91 |
| COG4226 | Predicted nuclease of the RNAse H fold, HicB family | General function prediction only [R] | 0.91 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.91 |
| COG0565 | tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.91 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.91 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.91 |
| COG1598 | Antitoxin component HicB of the HicAB toxin-antitoxin system | Defense mechanisms [V] | 0.91 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.91 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.91 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.00 % |
| Unclassified | root | N/A | 30.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502000|ACOD_FV90NF402F6C8F | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 2088090014|GPIPI_17091283 | Not Available | 1099 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100499150 | Not Available | 707 | Open in IMG/M |
| 3300000550|F24TB_10577737 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300004633|Ga0066395_10069709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1615 | Open in IMG/M |
| 3300004798|Ga0058859_11351791 | Not Available | 650 | Open in IMG/M |
| 3300005187|Ga0066675_10029368 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
| 3300005294|Ga0065705_10019206 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300005294|Ga0065705_10480317 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005332|Ga0066388_100444622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1938 | Open in IMG/M |
| 3300005440|Ga0070705_101079780 | Not Available | 656 | Open in IMG/M |
| 3300005718|Ga0068866_11296519 | Not Available | 529 | Open in IMG/M |
| 3300005764|Ga0066903_101421376 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300005764|Ga0066903_105229184 | Not Available | 686 | Open in IMG/M |
| 3300005937|Ga0081455_10030045 | All Organisms → cellular organisms → Bacteria | 4944 | Open in IMG/M |
| 3300006049|Ga0075417_10019317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 2694 | Open in IMG/M |
| 3300006049|Ga0075417_10032885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2159 | Open in IMG/M |
| 3300006844|Ga0075428_100823115 | Not Available | 986 | Open in IMG/M |
| 3300006844|Ga0075428_101888977 | Not Available | 620 | Open in IMG/M |
| 3300006845|Ga0075421_100048385 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5385 | Open in IMG/M |
| 3300006845|Ga0075421_101592650 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 711 | Open in IMG/M |
| 3300006846|Ga0075430_100125689 | All Organisms → cellular organisms → Bacteria | 2137 | Open in IMG/M |
| 3300006846|Ga0075430_100499912 | Not Available | 1003 | Open in IMG/M |
| 3300006846|Ga0075430_100538846 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 963 | Open in IMG/M |
| 3300006847|Ga0075431_100476885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1241 | Open in IMG/M |
| 3300006852|Ga0075433_10485984 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1088 | Open in IMG/M |
| 3300006852|Ga0075433_11942509 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300006853|Ga0075420_100434181 | Not Available | 1135 | Open in IMG/M |
| 3300006853|Ga0075420_101363320 | Not Available | 609 | Open in IMG/M |
| 3300006871|Ga0075434_100868108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300006880|Ga0075429_100203632 | Not Available | 1734 | Open in IMG/M |
| 3300006881|Ga0068865_101749352 | Not Available | 561 | Open in IMG/M |
| 3300006904|Ga0075424_100128004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2685 | Open in IMG/M |
| 3300006904|Ga0075424_100579251 | Not Available | 1198 | Open in IMG/M |
| 3300006904|Ga0075424_100795630 | Not Available | 1009 | Open in IMG/M |
| 3300007076|Ga0075435_100082691 | All Organisms → cellular organisms → Bacteria | 2640 | Open in IMG/M |
| 3300007265|Ga0099794_10070386 | All Organisms → cellular organisms → Bacteria | 1713 | Open in IMG/M |
| 3300009012|Ga0066710_100812893 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300009090|Ga0099827_10159365 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
| 3300009090|Ga0099827_10884814 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
| 3300009094|Ga0111539_11536746 | Not Available | 772 | Open in IMG/M |
| 3300009098|Ga0105245_10114615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2510 | Open in IMG/M |
| 3300009100|Ga0075418_10191693 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300009100|Ga0075418_10191796 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300009100|Ga0075418_10249553 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
| 3300009100|Ga0075418_10481058 | Not Available | 1331 | Open in IMG/M |
| 3300009100|Ga0075418_11710205 | Not Available | 684 | Open in IMG/M |
| 3300009137|Ga0066709_101736009 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella factor | 882 | Open in IMG/M |
| 3300009147|Ga0114129_10348413 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300009147|Ga0114129_12972617 | Not Available | 558 | Open in IMG/M |
| 3300009553|Ga0105249_11649006 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300009792|Ga0126374_10272034 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300010038|Ga0126315_10424722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 839 | Open in IMG/M |
| 3300010046|Ga0126384_10060630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → environmental samples → uncultured Chloroflexia bacterium | 2650 | Open in IMG/M |
| 3300010046|Ga0126384_10566680 | Not Available | 989 | Open in IMG/M |
| 3300010145|Ga0126321_1497440 | Not Available | 908 | Open in IMG/M |
| 3300010359|Ga0126376_10921425 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300010359|Ga0126376_11958691 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 627 | Open in IMG/M |
| 3300010360|Ga0126372_10059750 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 2643 | Open in IMG/M |
| 3300010360|Ga0126372_10244335 | Not Available | 1535 | Open in IMG/M |
| 3300010360|Ga0126372_12392291 | Not Available | 579 | Open in IMG/M |
| 3300010361|Ga0126378_10424262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Stigmatella → Stigmatella aurantiaca | 1443 | Open in IMG/M |
| 3300010362|Ga0126377_10420551 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300010362|Ga0126377_11526675 | Not Available | 742 | Open in IMG/M |
| 3300010366|Ga0126379_11634205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 749 | Open in IMG/M |
| 3300010366|Ga0126379_12688242 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 595 | Open in IMG/M |
| 3300012199|Ga0137383_10742435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 717 | Open in IMG/M |
| 3300012209|Ga0137379_10085335 | All Organisms → cellular organisms → Bacteria | 3037 | Open in IMG/M |
| 3300012209|Ga0137379_10548677 | Not Available | 1063 | Open in IMG/M |
| 3300012211|Ga0137377_10083088 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
| 3300012362|Ga0137361_11695739 | Not Available | 551 | Open in IMG/M |
| 3300012918|Ga0137396_10964099 | Not Available | 620 | Open in IMG/M |
| 3300012930|Ga0137407_10927077 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012944|Ga0137410_11271299 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012971|Ga0126369_10051441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter | 3523 | Open in IMG/M |
| 3300012971|Ga0126369_11300506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 817 | Open in IMG/M |
| 3300012971|Ga0126369_12689640 | Not Available | 582 | Open in IMG/M |
| 3300013306|Ga0163162_10036262 | All Organisms → cellular organisms → Bacteria | 4913 | Open in IMG/M |
| 3300015241|Ga0137418_10028215 | All Organisms → cellular organisms → Bacteria | 5193 | Open in IMG/M |
| 3300015373|Ga0132257_100923489 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300015374|Ga0132255_101427360 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300016371|Ga0182034_11545569 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300016422|Ga0182039_11000650 | Not Available | 750 | Open in IMG/M |
| 3300017792|Ga0163161_10872440 | Not Available | 761 | Open in IMG/M |
| 3300021344|Ga0193719_10435052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 536 | Open in IMG/M |
| 3300026067|Ga0207678_10078607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Herpetosiphonales → Herpetosiphonaceae → Herpetosiphon → Herpetosiphon aurantiacus → Herpetosiphon aurantiacus DSM 785 | 2825 | Open in IMG/M |
| 3300026118|Ga0207675_101532822 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300026295|Ga0209234_1212065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans flavus | 648 | Open in IMG/M |
| 3300026528|Ga0209378_1032576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_20CM_4_61_6 | 2724 | Open in IMG/M |
| 3300027846|Ga0209180_10123535 | All Organisms → cellular organisms → Bacteria | 1485 | Open in IMG/M |
| 3300027875|Ga0209283_10212719 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300027880|Ga0209481_10718626 | Not Available | 519 | Open in IMG/M |
| 3300027903|Ga0209488_11217577 | Not Available | 506 | Open in IMG/M |
| 3300027907|Ga0207428_10044252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium Io17-Chloro-G7 | 3592 | Open in IMG/M |
| 3300027909|Ga0209382_10008311 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13092 | Open in IMG/M |
| 3300027909|Ga0209382_10039924 | All Organisms → cellular organisms → Bacteria | 5623 | Open in IMG/M |
| 3300028592|Ga0247822_10163017 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300028608|Ga0247819_10109378 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 1396 | Open in IMG/M |
| 3300030563|Ga0247653_1000646 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300031058|Ga0308189_10016277 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1668 | Open in IMG/M |
| 3300031092|Ga0308204_10019111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1388 | Open in IMG/M |
| 3300031114|Ga0308187_10476057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium CG23_combo_of_CG06-09_8_20_14_all_49_15 | 509 | Open in IMG/M |
| 3300031573|Ga0310915_10059853 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300031719|Ga0306917_10096091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. | 2116 | Open in IMG/M |
| 3300031833|Ga0310917_10675660 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 700 | Open in IMG/M |
| 3300031910|Ga0306923_10471678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosomonas → unclassified Nitrosomonas → Nitrosomonas sp. | 1422 | Open in IMG/M |
| 3300031954|Ga0306926_11398668 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300032174|Ga0307470_11459734 | Not Available | 567 | Open in IMG/M |
| 3300032211|Ga0310896_10628188 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300032261|Ga0306920_101260979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1065 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 29.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.55% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.91% |
| Fungus Garden | Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502000 | Fungus garden microbial communities from Atta colombica in Panama - dump bottom | Host-Associated | Open in IMG/M |
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300030563 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb6 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031092 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACODB_12960280 | 2040502000 | Fungus Garden | DVPMAYNPTFVMLPSLKSLFFNSFKNELRLLDNVGA |
| GPIPI_02288900 | 2088090014 | Soil | VDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGAQAPGVVF |
| INPhiseqgaiiFebDRAFT_1004991501 | 3300000364 | Soil | LVSRVVDLPMAHNLTFVILSSLKPLFFNXLKNEFRFSDNV |
| F24TB_105777371 | 3300000550 | Soil | MSVLHQQLPPRLLLDSRGVDEPMAYNSTLVILSSLKPLFFNSLNNELRFSDN |
| Ga0066395_100697092 | 3300004633 | Tropical Forest Soil | LDSRVVDVSIAYTPTLVMLSSLKPLFFNSLSNELHFSDNAGA* |
| Ga0058859_113517912 | 3300004798 | Host-Associated | MRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFSDNTGA* |
| Ga0066675_100293684 | 3300005187 | Soil | VGNLLRLLLDSRVVDVPMESNPTFVILTPWKPLFINSLKNELCFSDNAGV* |
| Ga0065705_100192062 | 3300005294 | Switchgrass Rhizosphere | MAHYEYXLLLDSRVVDLSTAYHPTLVXLSSLKPLFFNXLKDELRFLDNGGA* |
| Ga0065705_104803172 | 3300005294 | Switchgrass Rhizosphere | LVSRVVDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGA* |
| Ga0066388_1004446223 | 3300005332 | Tropical Forest Soil | MLLKLVKPELLDSRVVDVSMAYSPTLVILSSLKPLFFNGLKNELRFLDNAGA* |
| Ga0070705_1010797801 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLDARVVDVTMAYNPPFVMRSSLKPFFFNGLKHKLRFSDNTGA* |
| Ga0068866_112965191 | 3300005718 | Miscanthus Rhizosphere | LQRGRKHSRSRTMRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFSDNTGA* |
| Ga0066903_1014213761 | 3300005764 | Tropical Forest Soil | LLLDSRVVDVPMAYNPTFVMLSSLKPFFFHSLKNELPFSDNAGA* |
| Ga0066903_1052291841 | 3300005764 | Tropical Forest Soil | LLLDSRVVDVPIAYNPTFVVLFSLKPFFFNSLKNERRFSDNAGA* |
| Ga0081455_100300452 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDVPMAYNPAFVMLSYVKPLFFSNLKNEFCFSDNARA* |
| Ga0075417_100193173 | 3300006049 | Populus Rhizosphere | LDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA* |
| Ga0075417_100328851 | 3300006049 | Populus Rhizosphere | PMACNPTLIILSSLKSLFFNNLTNELYFSDNVGAQDPGIQ* |
| Ga0075428_1008231151 | 3300006844 | Populus Rhizosphere | LLDSRVVDVPMAYNPTFVMLSSFKPLYLNSLKKEVCFADHAGA* |
| Ga0075428_1018889772 | 3300006844 | Populus Rhizosphere | LDSRVVAVPMASNPTFVMLSSLKPLFFNSLKNEWCFLDNE |
| Ga0075421_1000483856 | 3300006845 | Populus Rhizosphere | MPYRSRLLLDSRVLDAPMAYNLIFVTLSSLKPLFFNSHKKELCFSDNMGT* |
| Ga0075421_1015926502 | 3300006845 | Populus Rhizosphere | RLLLDSRVVDEPMAYNPTFVILSSLKPLFFNSLKNELRFSDNAGA* |
| Ga0075430_1001256892 | 3300006846 | Populus Rhizosphere | PTFVMLSSLKSLFFNSRKNAFRFLDNVGAKAPGIQ* |
| Ga0075430_1004999122 | 3300006846 | Populus Rhizosphere | LDSRVVDMPMASTPNFVMLSSLKPLFINGLKNAVCFSDNAGA* |
| Ga0075430_1005388463 | 3300006846 | Populus Rhizosphere | WLLLDSRVVDLLMAYNPTFVMLSFLKPLFFNSLKNEFRFSDNAGA* |
| Ga0075431_1004768852 | 3300006847 | Populus Rhizosphere | EWLLLDSRVVDVPMACNPTFVMLSSLQPFFFNGLQNALCFSDNAGA* |
| Ga0075433_104859843 | 3300006852 | Populus Rhizosphere | DLSMASNPTFVFLSSLKPLFFNSPEKALHFSDNTGA* |
| Ga0075433_119425091 | 3300006852 | Populus Rhizosphere | VDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA* |
| Ga0075420_1004341812 | 3300006853 | Populus Rhizosphere | MGIYRVWLLLDSRVVDVPMAYDPPFVMPSSLKPLFFNSLKHKLHFSDNTGT* |
| Ga0075420_1013633202 | 3300006853 | Populus Rhizosphere | LDSRVVDLLMAYNPTFVILSFLKPLFLNSLKNELRFSDNAGA* |
| Ga0075434_1008681081 | 3300006871 | Populus Rhizosphere | DVPRAYNRTFVMLSSLKPFFFNSLQKELRFSNNAGA* |
| Ga0075429_1002036322 | 3300006880 | Populus Rhizosphere | LDARGVDVPMASNPTFVMLSSVKPLLFMSLTKALCFSDNAGA* |
| Ga0068865_1017493521 | 3300006881 | Miscanthus Rhizosphere | MRWLLLDSRVVDVAMAYGPPFVMLSSLKPFFFNSLKHTLRFS |
| Ga0075424_1001280043 | 3300006904 | Populus Rhizosphere | MASTPTFVMLSSLKPLFVNSLKNELRFSDNVGAEDPGIQ* |
| Ga0075424_1005792513 | 3300006904 | Populus Rhizosphere | PMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA* |
| Ga0075424_1007956301 | 3300006904 | Populus Rhizosphere | VDLSMASNPTLVFLSSLEPLFFNSPANEFRFSDNTGA* |
| Ga0075435_1000826916 | 3300007076 | Populus Rhizosphere | LLLDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA* |
| Ga0099794_100703862 | 3300007265 | Vadose Zone Soil | VDVPMADNPTFVILSSLKPLFFNGLKNELCFSVNAGA* |
| Ga0066710_1008128931 | 3300009012 | Grasslands Soil | LDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSD |
| Ga0099827_101593653 | 3300009090 | Vadose Zone Soil | VDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSNNAGA* |
| Ga0099827_108848142 | 3300009090 | Vadose Zone Soil | VTALEQHIQAWLLLDARVVDVPMAYNPTFVMLSSLKPLFFHGLKNDLCCSDNAG |
| Ga0111539_115367461 | 3300009094 | Populus Rhizosphere | VDVLMAYNPTFVLLSFLKPFFFKSLNNELSFSDNAGA* |
| Ga0105245_101146154 | 3300009098 | Miscanthus Rhizosphere | LLDARVVDVTMAYNPPFVMRSSLKPFFFNGLKHKLRFSDNTGA* |
| Ga0075418_101916935 | 3300009100 | Populus Rhizosphere | MRLLLDSRVVEVLMAYNATFVILSSLEPLFFHSHRHELRFSDNAGA* |
| Ga0075418_101917963 | 3300009100 | Populus Rhizosphere | LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAG |
| Ga0075418_102495534 | 3300009100 | Populus Rhizosphere | DSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA* |
| Ga0075418_104810582 | 3300009100 | Populus Rhizosphere | GVEVPMAYTPPFVMLSSLQPLFFNSLKNEVRFLDNVGA* |
| Ga0075418_117102051 | 3300009100 | Populus Rhizosphere | QRRLLLDSRGVDVPMAYNPTFVMLSSLKPLFLYSLKKEWCFSDRAGA* |
| Ga0066709_1017360091 | 3300009137 | Grasslands Soil | TLLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSDNAGA* |
| Ga0114129_103484134 | 3300009147 | Populus Rhizosphere | MRLLLDSRVVEVLMAYNATFVILSSLEPLFFHSHRHELRFSYNAGA* |
| Ga0114129_129726172 | 3300009147 | Populus Rhizosphere | LLLDSRVVDEPMAYNPTFVILSSSKPLFFNSLKNDLRFSDNAGA* |
| Ga0105249_116490062 | 3300009553 | Switchgrass Rhizosphere | EGLLLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA* |
| Ga0126374_102720342 | 3300009792 | Tropical Forest Soil | VDVLMAYNPTFVMLAFLKPLFFNSLKNEIRFSDNAGA* |
| Ga0126315_104247223 | 3300010038 | Serpentine Soil | LDSRVVDVSRAYTPTLVMLSSLKPLFFNSLSNELHFSDN |
| Ga0126384_100606304 | 3300010046 | Tropical Forest Soil | LLLDSRVVDVLMAYNPTFVMLAFLKPSFFNSLKNEIRFSDNAGA* |
| Ga0126384_105666801 | 3300010046 | Tropical Forest Soil | VDVLMAYNPTFVMLAFLKPLFFNSLKNEIRFSENAGA* |
| Ga0126321_14974403 | 3300010145 | Soil | SGTDSPLSVYARLLLDSRVVDMPMASNPNFVLLSSLKPLFCNGLKNALCFSDNAGA* |
| Ga0126376_109214251 | 3300010359 | Tropical Forest Soil | MLSYDKWLLLDSRGVDVPMVYAPTFAMLSSLKPLFFNSLTNTLRFSDKAGA* |
| Ga0126376_119586911 | 3300010359 | Tropical Forest Soil | QRETIPTFVMLFSLKPLFFNSLKNALGFSDNPGA* |
| Ga0126372_100597503 | 3300010360 | Tropical Forest Soil | MFQSRLLLDSRVVDVSTAYHPTLVILSSLKPLFFNRFKNELRFLDNGGA* |
| Ga0126372_102443351 | 3300010360 | Tropical Forest Soil | VDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNA |
| Ga0126372_123922912 | 3300010360 | Tropical Forest Soil | LDSRVVYVPMAYNPTCVLLSSLKPFFCHRLKNESPFSDNARA* |
| Ga0126378_104242621 | 3300010361 | Tropical Forest Soil | LSMAYNPTFVVLSSVKPLFFNNLKNELRFLGNVGA* |
| Ga0126377_104205512 | 3300010362 | Tropical Forest Soil | LVDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNAGA* |
| Ga0126377_115266751 | 3300010362 | Tropical Forest Soil | VDVPMVYNLGFAMLSSLKLLFFKSLKNALRFSDNAAA* |
| Ga0126379_116342051 | 3300010366 | Tropical Forest Soil | MPSRLLLDSRVVDVPMASNPIVVTLSSLKPFFFNSLNTEVRFSDHVGA |
| Ga0126379_126882421 | 3300010366 | Tropical Forest Soil | LLLDSRVVDVAMVYNPNFVILSSLKPLFFNSDKNELRFSDNAGA* |
| Ga0137383_107424353 | 3300012199 | Vadose Zone Soil | VVDVPMASNPTFVMLSSLKPLFFNSLKNELCFSDNAGA* |
| Ga0137379_100853354 | 3300012209 | Vadose Zone Soil | SRVVDLLMAYNPTFVMLSFLKPLFFNSLKNEFRFSDNAGA* |
| Ga0137379_105486772 | 3300012209 | Vadose Zone Soil | LLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLQKELCFSDNAGA* |
| Ga0137377_100830883 | 3300012211 | Vadose Zone Soil | QGSSGRYNARLLLDSRVVDVPMASNPTFVMLSALKPLFFNSLKNELCFSDNAGA* |
| Ga0137361_116957391 | 3300012362 | Vadose Zone Soil | DVPMAYNLTFVMLSSLKPLFFNNLKNELPFLDHAGA* |
| Ga0137396_109640991 | 3300012918 | Vadose Zone Soil | DLLMAYNPTFVMLSFLKPLFCNRLKNEFRFSDNVGA* |
| Ga0137407_109270771 | 3300012930 | Vadose Zone Soil | DLPMAYNPILVLLSSLKPLFFNSLKNELRFSDNAGA* |
| Ga0137410_112712992 | 3300012944 | Vadose Zone Soil | LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA* |
| Ga0126369_100514411 | 3300012971 | Tropical Forest Soil | MPCQMGLLLESRVVDVSMVSNPTVVFLSSLRPLFFNSPENEFRFSDNTGA* |
| Ga0126369_113005063 | 3300012971 | Tropical Forest Soil | VVAVPMASHPTCVMFSSWKPLFFNSLKHEFHFSDNAGA* |
| Ga0126369_126896402 | 3300012971 | Tropical Forest Soil | VLRLLVDSRGVDVPRAYNPTFVMLFSLKPLFFNSLKNALGFSDNA |
| Ga0163162_100362622 | 3300013306 | Switchgrass Rhizosphere | MAHNLTFVILSSLKSLFFNNLKNEFRFSDNVGAQAPGVVF* |
| Ga0137418_100282153 | 3300015241 | Vadose Zone Soil | MWKISRLLLDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSDNAGA* |
| Ga0132257_1009234891 | 3300015373 | Arabidopsis Rhizosphere | LDSRVVDVPMMSNPTFVMLSSLQPFFFNSLQMGVCCTDNAG |
| Ga0132255_1014273602 | 3300015374 | Arabidopsis Rhizosphere | MKIATNPVDLLMAYNPTFVMLSFLKPLFFNSLKNELRFSGNAGA* |
| Ga0182034_115455692 | 3300016371 | Soil | VVYVTMAKTPTFVMRSFLKSFFLNSLKNELPFSDNAGA |
| Ga0182039_110006501 | 3300016422 | Soil | MPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAYDPGIQEERPRFSP |
| Ga0163161_108724402 | 3300017792 | Switchgrass Rhizosphere | VDLPMAQNLTFVILSSLKPLFFNNLKNEFRFSDNVGA |
| Ga0193719_104350522 | 3300021344 | Soil | LDSRVVDVPMAYNPTFVMLSSLKPLFFNSLKNELPFSD |
| Ga0207678_100786073 | 3300026067 | Corn Rhizosphere | FFNLRWLLLDSRVVDMPMASNPNFVLLFSLKPFFFNGLKNALGFEANAGA |
| Ga0207675_1015328222 | 3300026118 | Switchgrass Rhizosphere | FRFGLLLDSRVVDLPMTYGLTFDVLLSLKPLFFNSLKNKSRFSDNVEA |
| Ga0209234_12120652 | 3300026295 | Grasslands Soil | QTLLLDSRVVDVPRAYNRTFVMLSSLKPFFFNSLKNELRFSGNAGA |
| Ga0209378_10325761 | 3300026528 | Soil | IWLLLDSRVVDLSMASNPTFVFLSSLKPLFFNSPENELRFSDNPGA |
| Ga0209180_101235355 | 3300027846 | Vadose Zone Soil | VDLPMAYNPIFVIFSSLKPLFFNSLKNELRFSDNAGV |
| Ga0209283_102127191 | 3300027875 | Vadose Zone Soil | RVVDVPRAYNRTFVMLSSLKPFFFNSLQKELRFSDNAGA |
| Ga0209481_107186261 | 3300027880 | Populus Rhizosphere | RLLLDSRVVDVPMAYNPTFVMLSSLKPLFLNGLKKELCFSDYAGA |
| Ga0209488_112175771 | 3300027903 | Vadose Zone Soil | VDVPMADNPTFVILSSLKPLFFNGLKNELCFSVNAGA |
| Ga0207428_100442521 | 3300027907 | Populus Rhizosphere | HNDSQGERLLLDSRVLDAPRAYNLIFVTPPSLKPLFFNSHKKELGFSDHMGT |
| Ga0209382_100083119 | 3300027909 | Populus Rhizosphere | MPYRSRLLLDSRVLDAPMAYNLIFVTLSSLKPLFFNSHKKELCFSDNMGT |
| Ga0209382_100399241 | 3300027909 | Populus Rhizosphere | MPMAYNPTFVMLSSLKSLFFNSRKNAFRFLDNVGAKAPGIQ |
| Ga0247822_101630172 | 3300028592 | Soil | VDLPMAHNLTFVILSSLKPLFFNNLKNEFRFSDNVGA |
| Ga0247819_101093782 | 3300028608 | Soil | VDLPMAHNLTFVILSSLNPLFFNNLKNEFRFSDNVGA |
| Ga0247653_10006462 | 3300030563 | Soil | DSRVVDVSMASNPTFVFLSSLEPLFFNNPENELRFSDNTGA |
| Ga0308189_100162771 | 3300031058 | Soil | VELPMGDNPTFVILSSLKPFFFNRLKSEWRFVDNVGA |
| Ga0308204_100191111 | 3300031092 | Soil | SRVVDLTMPCDPIVVTLSSLKPLFFKGLQNELRFSDNLEA |
| Ga0308187_104760572 | 3300031114 | Soil | LLDSRVVDVPMAYNSIFVTPYSMKLFFFNGLKNELRFSDNVG |
| Ga0310915_100598532 | 3300031573 | Soil | MLSYDKWLLLDSRGVDVPMVYGPTFVMLSSLKPLFFNSLTNKLRFSDKAGA |
| Ga0306917_100960914 | 3300031719 | Soil | MPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAY |
| Ga0310917_106756602 | 3300031833 | Soil | DSRVVDLLMAYNLTFVRFSFLKSLFFNSLKNEFRFSDNAGV |
| Ga0306923_104716781 | 3300031910 | Soil | MPSFLHWLLLDSRVVDVPMAYNPTFVMLSSLQPFFLKSLQKELCFSAHAGAYDPGIQEERPRFSS |
| Ga0306926_113986681 | 3300031954 | Soil | LDSRVVEVPMAYNPTFVMLSSLKPLFLHSLKNALCFSDN |
| Ga0307470_114597341 | 3300032174 | Hardwood Forest Soil | MECRKYEWLLLDFRVMELARPYPQTFVMLSSWKPLFFNSLKHEFRFSDHIGA |
| Ga0310896_106281882 | 3300032211 | Soil | MASNPTFIVLSFLKPLFFTGLKNESPFSDNVEAEDP |
| Ga0306920_1012609792 | 3300032261 | Soil | PKRLLLDSRVVDVPMASNLTFVMLSSWKALFFNSLKNDLCFSANAGA |
| ⦗Top⦘ |