| Basic Information | |
|---|---|
| Family ID | F086766 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 110 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MYIDPTAGSLVLQVLAAGALSAVAVFGRLREGLKHFFRSLSPRRWAQKR |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 67.27 % |
| % of genes near scaffold ends (potentially truncated) | 27.27 % |
| % of genes from short scaffolds (< 2000 bps) | 88.18 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.364 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.091 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.95% β-sheet: 0.00% Coil/Unstructured: 48.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF00171 | Aldedh | 33.64 |
| PF01663 | Phosphodiest | 2.73 |
| PF05635 | 23S_rRNA_IVP | 1.82 |
| PF00248 | Aldo_ket_red | 0.91 |
| PF03631 | Virul_fac_BrkB | 0.91 |
| PF11118 | DUF2627 | 0.91 |
| PF13540 | RCC1_2 | 0.91 |
| PF00515 | TPR_1 | 0.91 |
| PF06144 | DNA_pol3_delta | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 33.64 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 33.64 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 33.64 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 0.91 |
| COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 0.91 |
| COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.36 % |
| Unclassified | root | N/A | 43.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8686318 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13857866 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300000890|JGI11643J12802_10160488 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300000956|JGI10216J12902_113578347 | Not Available | 929 | Open in IMG/M |
| 3300003267|soilL1_10100122 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300003267|soilL1_10110948 | All Organisms → cellular organisms → Bacteria | 3313 | Open in IMG/M |
| 3300003323|rootH1_10294672 | All Organisms → cellular organisms → Bacteria | 2217 | Open in IMG/M |
| 3300003990|Ga0055455_10026327 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 1471 | Open in IMG/M |
| 3300003993|Ga0055468_10046096 | Not Available | 1091 | Open in IMG/M |
| 3300004114|Ga0062593_101567079 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300004282|Ga0066599_100659648 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 712 | Open in IMG/M |
| 3300004780|Ga0062378_10174454 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005332|Ga0066388_106733129 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 579 | Open in IMG/M |
| 3300005436|Ga0070713_101817518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 591 | Open in IMG/M |
| 3300005439|Ga0070711_100185224 | All Organisms → cellular organisms → Bacteria | 1596 | Open in IMG/M |
| 3300005440|Ga0070705_100176353 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
| 3300005444|Ga0070694_100399136 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1076 | Open in IMG/M |
| 3300005445|Ga0070708_100691520 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 960 | Open in IMG/M |
| 3300005471|Ga0070698_101080694 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 750 | Open in IMG/M |
| 3300005618|Ga0068864_100010439 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7673 | Open in IMG/M |
| 3300005873|Ga0075287_1000779 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4031 | Open in IMG/M |
| 3300005873|Ga0075287_1040677 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 623 | Open in IMG/M |
| 3300006049|Ga0075417_10351489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 722 | Open in IMG/M |
| 3300006844|Ga0075428_101326077 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300006845|Ga0075421_100551608 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300006847|Ga0075431_101250248 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300006876|Ga0079217_10893936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 632 | Open in IMG/M |
| 3300006876|Ga0079217_11266340 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300006918|Ga0079216_10811789 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009012|Ga0066710_100796223 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300009100|Ga0075418_11112470 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300009147|Ga0114129_11802757 | Not Available | 744 | Open in IMG/M |
| 3300009156|Ga0111538_10368907 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300010038|Ga0126315_10335761 | Not Available | 939 | Open in IMG/M |
| 3300010039|Ga0126309_10540196 | Not Available | 724 | Open in IMG/M |
| 3300010039|Ga0126309_11187583 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 523 | Open in IMG/M |
| 3300010040|Ga0126308_10771107 | Not Available | 665 | Open in IMG/M |
| 3300010045|Ga0126311_10853298 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300011444|Ga0137463_1009582 | All Organisms → cellular organisms → Bacteria | 3295 | Open in IMG/M |
| 3300012045|Ga0136623_10397506 | Not Available | 583 | Open in IMG/M |
| 3300012212|Ga0150985_111251757 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300012350|Ga0137372_10612002 | Not Available | 798 | Open in IMG/M |
| 3300012469|Ga0150984_102934548 | Not Available | 533 | Open in IMG/M |
| 3300012530|Ga0136635_10087992 | Not Available | 976 | Open in IMG/M |
| 3300012681|Ga0136613_10048842 | All Organisms → cellular organisms → Bacteria | 2430 | Open in IMG/M |
| 3300012684|Ga0136614_10620080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 769 | Open in IMG/M |
| 3300012957|Ga0164303_11226226 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012958|Ga0164299_11076468 | Not Available | 599 | Open in IMG/M |
| 3300014263|Ga0075324_1005624 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300014271|Ga0075326_1276059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300014314|Ga0075316_1067862 | Not Available | 804 | Open in IMG/M |
| 3300014877|Ga0180074_1117423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 597 | Open in IMG/M |
| 3300017695|Ga0180121_10055437 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300017789|Ga0136617_10123468 | All Organisms → cellular organisms → Bacteria | 2225 | Open in IMG/M |
| 3300018028|Ga0184608_10159155 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300018076|Ga0184609_10290376 | Not Available | 765 | Open in IMG/M |
| 3300018076|Ga0184609_10443420 | Not Available | 598 | Open in IMG/M |
| 3300018422|Ga0190265_10666117 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300018429|Ga0190272_10357369 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
| 3300018429|Ga0190272_12444376 | Not Available | 567 | Open in IMG/M |
| 3300018466|Ga0190268_10208357 | Not Available | 1076 | Open in IMG/M |
| 3300018466|Ga0190268_11775450 | Not Available | 554 | Open in IMG/M |
| 3300018920|Ga0190273_11247824 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 637 | Open in IMG/M |
| 3300018920|Ga0190273_11543536 | Not Available | 589 | Open in IMG/M |
| 3300019254|Ga0184641_1202480 | Not Available | 555 | Open in IMG/M |
| 3300019259|Ga0184646_1110369 | Not Available | 537 | Open in IMG/M |
| 3300019259|Ga0184646_1353896 | Not Available | 573 | Open in IMG/M |
| 3300021073|Ga0210378_10089503 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300021080|Ga0210382_10069125 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1426 | Open in IMG/M |
| 3300021080|Ga0210382_10262749 | Not Available | 756 | Open in IMG/M |
| 3300021090|Ga0210377_10351833 | Not Available | 888 | Open in IMG/M |
| 3300021184|Ga0196959_10032371 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300021184|Ga0196959_10043754 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300022694|Ga0222623_10229676 | Not Available | 718 | Open in IMG/M |
| 3300022694|Ga0222623_10340100 | Not Available | 574 | Open in IMG/M |
| 3300025537|Ga0210061_1059522 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025559|Ga0210087_1013849 | Not Available | 1677 | Open in IMG/M |
| 3300025791|Ga0210115_1011811 | Not Available | 2058 | Open in IMG/M |
| 3300025792|Ga0210143_1024439 | Not Available | 1052 | Open in IMG/M |
| 3300025922|Ga0207646_10256535 | Not Available | 1580 | Open in IMG/M |
| 3300025996|Ga0208777_1001438 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300026029|Ga0208002_1018355 | Not Available | 676 | Open in IMG/M |
| 3300026045|Ga0208535_1021559 | Not Available | 608 | Open in IMG/M |
| 3300026062|Ga0208654_1020226 | Not Available | 835 | Open in IMG/M |
| 3300026075|Ga0207708_10228344 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300026095|Ga0207676_10013252 | All Organisms → cellular organisms → Bacteria | 5922 | Open in IMG/M |
| 3300027735|Ga0209261_10098468 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300027909|Ga0209382_10520270 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300028589|Ga0247818_10410002 | Not Available | 914 | Open in IMG/M |
| 3300028771|Ga0307320_10089655 | Not Available | 1162 | Open in IMG/M |
| 3300028791|Ga0307290_10164127 | Not Available | 814 | Open in IMG/M |
| 3300028803|Ga0307281_10422165 | Not Available | 513 | Open in IMG/M |
| 3300028814|Ga0307302_10139518 | Not Available | 1171 | Open in IMG/M |
| 3300028824|Ga0307310_10029670 | All Organisms → cellular organisms → Bacteria | 2192 | Open in IMG/M |
| 3300028872|Ga0307314_10201472 | Not Available | 599 | Open in IMG/M |
| 3300028881|Ga0307277_10423974 | Not Available | 596 | Open in IMG/M |
| 3300028885|Ga0307304_10084594 | Not Available | 1242 | Open in IMG/M |
| 3300030006|Ga0299907_10475719 | Not Available | 992 | Open in IMG/M |
| 3300030006|Ga0299907_11321229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 511 | Open in IMG/M |
| 3300030619|Ga0268386_10654181 | Not Available | 693 | Open in IMG/M |
| 3300030619|Ga0268386_10669726 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300030620|Ga0302046_10506714 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031229|Ga0299913_11360912 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300031455|Ga0307505_10641789 | Not Available | 518 | Open in IMG/M |
| 3300031824|Ga0307413_10793203 | Not Available | 795 | Open in IMG/M |
| 3300031824|Ga0307413_11785657 | Not Available | 550 | Open in IMG/M |
| 3300031965|Ga0326597_10011291 | All Organisms → cellular organisms → Bacteria | 11850 | Open in IMG/M |
| 3300032002|Ga0307416_102954867 | Not Available | 569 | Open in IMG/M |
| 3300032004|Ga0307414_10922541 | Not Available | 801 | Open in IMG/M |
| 3300034818|Ga0373950_0010704 | Not Available | 1488 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.27% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 6.36% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 5.45% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.45% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 5.45% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.64% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.64% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.73% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.73% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.73% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.82% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.82% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.91% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003323 | Sugarcane root Sample H1 | Host-Associated | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014314 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021184 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1+v_20 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025537 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025792 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025996 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes) | Environmental | Open in IMG/M |
| 3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026045 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_01249650 | 2088090015 | Soil | MYIDPTTGSLVLQVLAAGVLSAVAVFGRLREGIKHFFRSLSPRRWAQKR |
| ICChiseqgaiiFebDRAFT_138578662 | 3300000363 | Soil | MYIDPSAGSLVIQVLAAAAISAVAMWTRAREATKSFFRSLVSRGRRWTGVR* |
| JGI11643J12802_101604882 | 3300000890 | Soil | MYIDPTTGSLVLQVLAAGVLSAVAVFGRLREGIKHFFRSLSPRRWAQKR* |
| JGI10216J12902_1135783472 | 3300000956 | Soil | MYIDPTSGSIVLQVVAAAALSAVAMVGRVREAGKSFVRTLVSRVRRWTGVR* |
| soilL1_101001222 | 3300003267 | Sugarcane Root And Bulk Soil | MYIDPTAGSLVLQVLAAGVLSAVAVFARLREGVKHVFRSLLPRRWAQKR* |
| soilL1_101109482 | 3300003267 | Sugarcane Root And Bulk Soil | MYIDPTSGSLALQVLAAAALSAVAMFSRAREATKSFFRSLVSRGRRWTGSR* |
| rootH1_102946723 | 3300003323 | Sugarcane Root And Bulk Soil | MYIDPTSGSLALQVLAAAALSAVAMFSRAREATKTFLRSLVSRGRRWTGSR* |
| Ga0055455_100263271 | 3300003990 | Natural And Restored Wetlands | MYIDPTSGSLMLQVLAAGALSAVAMTSRIREAVKHTFRSLVSRGRRWTGSR* |
| Ga0055468_100460961 | 3300003993 | Natural And Restored Wetlands | AGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR* |
| Ga0062593_1015670792 | 3300004114 | Soil | MYIDPTAGSLMLQVLAAAALSAVAMFSRLREVLKHFFRSLLPRRWAQKR* |
| Ga0066599_1006596482 | 3300004282 | Freshwater | MYIDPTAGSLALQVLAAGALSAVAFFGRIREAVKAFFRSHAPRRWAHKR* |
| Ga0062378_101744541 | 3300004780 | Wetland Sediment | MYIDPTAGSLVLQALAAGVLSALAMFSRFREGAKSFFKSLVLRRGRWTDSR* |
| Ga0066388_1067331291 | 3300005332 | Tropical Forest Soil | MYIDPTAGSLMLQALAAGALSALAMFSRVRDGAKSFFKSLLPGRPRWIGKR* |
| Ga0070713_1018175182 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTSGSILLQVIAAAALSAVAMFGRVREAGKAFIRTLVSRVRRWMGVR* |
| Ga0070711_1001852242 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTSGSILLQVIAAAALSAVAMFGRVREAGKSFIRTLVSRVRRWMGVR* |
| Ga0070705_1001763531 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTAGSLVLQFLAAAALSAVAMFSRLRQAAKSFFKSLIPRRGRWAVK |
| Ga0070694_1003991362 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTAGSLVLQFLAAAALSAVAMFSRLRQAAKSFFKSLIPRRGRWAVKR* |
| Ga0070708_1006915202 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTAGSLVLQFIAAGVLSLLAMFSRVREAAKSFFKSLLPGNHRWTGKQ* |
| Ga0070698_1010806941 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTSGSLVLQVLAAGALSAVAMTSRIRDAVKHTFRSLLTRGRRWTGNR* |
| Ga0068864_1000104393 | 3300005618 | Switchgrass Rhizosphere | MYIDPTSGSLVLQIVAAAALSAVAMMTRAREAAKSLGRSLVSRIRRWTGAR* |
| Ga0075287_10007792 | 3300005873 | Rice Paddy Soil | MYIDPTAGSLVLQFVAAGVLSLLAMFSRVREGAKSFFKSLLPGHHRWTGKP* |
| Ga0075287_10406772 | 3300005873 | Rice Paddy Soil | MYIDPTSGSLALQVLAAAALSAVAMFGRAREATKSFFQSLVSRGRRWTSNH* |
| Ga0075417_103514892 | 3300006049 | Populus Rhizosphere | MYIDPTSGSLALQILAAGALSALAMFSRAREATKSFFRNLVSRGRRWPGRH* |
| Ga0075428_1013260772 | 3300006844 | Populus Rhizosphere | MYIDPTAGSLMLQVLAAAALSAVAMFSRLREGLKQVFRSLSPRRWAQKR* |
| Ga0075421_1005516082 | 3300006845 | Populus Rhizosphere | MYIDPTTGSLVLQVLAAGALSAVALFSRVREGLKAFFRTLSPRRWAHKR* |
| Ga0075431_1012502482 | 3300006847 | Populus Rhizosphere | MYIDPTTGSLVLQVLAAGALSAVALFSRVREGLKAFFRTLSPRRWAH |
| Ga0079217_108939362 | 3300006876 | Agricultural Soil | MYIDPTAGSLVLQVLAAGALSAVAVFGRLRESLKNVFRSLLPRRWAQKR* |
| Ga0079217_112663401 | 3300006876 | Agricultural Soil | MYIDPTAGSLALQVLAAGALSAVAMFARVPEALKHFFRSLMPRRWAHKR* |
| Ga0079216_108117892 | 3300006918 | Agricultural Soil | MYIDPTTGSLVLQVLAAGALSAVAVFGRLREGIKHFFRSLLPRRWAQKR* |
| Ga0066710_1007962232 | 3300009012 | Grasslands Soil | MYIDPTAGSLLLQFIAAGVLSAVAMMSRVREGVKSLFKSILPGRWTGKR |
| Ga0075418_111124702 | 3300009100 | Populus Rhizosphere | MYIDPTAGSLVLQVLAAGVLSAVVMLGRLREGLKQVFRSLSPRRWAQKR* |
| Ga0114129_118027572 | 3300009147 | Populus Rhizosphere | QVLAAGALSAVAVFSRLREGLKHFFRSLSPRRWAQKR* |
| Ga0111538_103689072 | 3300009156 | Populus Rhizosphere | MLQVLAAAALSAVAMFSRLREGLKQVFRSLSPRRWAQKR* |
| Ga0126315_103357612 | 3300010038 | Serpentine Soil | MYIDPTSGSLALQVLAAGALSAVAMVSRVRETAKAWFRALVSRGRRWTGSR* |
| Ga0126309_105401962 | 3300010039 | Serpentine Soil | MYIDPTSGSLVLQVLAAGALSAVAMMSRVREGAKMWFRSLLARGRRWTGSR* |
| Ga0126309_111875831 | 3300010039 | Serpentine Soil | MYIDPTSGSLALQVLAAGALSAVAMFSRAREATKSFFRNLVSRGHRWTGDR* |
| Ga0126308_107711071 | 3300010040 | Serpentine Soil | MYIDPTSGSLALQVLAAGALSALAMFSRAREVTKTFFRNLLSRGRRWSGHH* |
| Ga0126311_108532982 | 3300010045 | Serpentine Soil | MYIDPTSGSLVLQVLAAGALSAVAMMSRVRETTKNWFRSLVSRGRRWTGSR* |
| Ga0137463_10095824 | 3300011444 | Soil | MYIDPTSGSLMLQVLAAGVLSAVAMVSRVRETAKGWFRSLVSLGRRWTGSR* |
| Ga0136623_103975062 | 3300012045 | Polar Desert Sand | MYIDPTTGSLVLQVLAASALSAVALFGRVRETLKTFFRSITPRRWAPKR* |
| Ga0150985_1112517572 | 3300012212 | Avena Fatua Rhizosphere | MYIDPTSGSLALQVLAAGVLSAVAMFSRAREATKSFFRNLVSHGRRWSRNR* |
| Ga0137372_106120022 | 3300012350 | Vadose Zone Soil | MYIDPTAGSLLLQFIAAGVLSAVAMISRVREGVKSLFKSLLPGHRRWTGKQ* |
| Ga0150984_1029345481 | 3300012469 | Avena Fatua Rhizosphere | SSGHADVTPTPEGSMYIDPTSGSLVLQVLAAGALSAVAMMSRVREGAKMWFRSLLSRGRRWTGNR* |
| Ga0136635_100879921 | 3300012530 | Polar Desert Sand | MYIDPTTGSLALQVVAAGALSALAMFSRAREAAKMLFRNLVSRGRRWPGGR* |
| Ga0136613_100488422 | 3300012681 | Polar Desert Sand | MYIDPTAGSLVLQILAAAALSAVAMGVRVREGVKSFFRSIVPRRGP* |
| Ga0136614_106200801 | 3300012684 | Polar Desert Sand | SEAFMYIDPTAGSLVLQILAAAALSGVVMAGRVRDGVKSFFRSIIPRRGP* |
| Ga0164303_112262261 | 3300012957 | Soil | MYIDPTSGSLVFQVIAAAALSAVAMMACAREATTPFFNSLISRP |
| Ga0164299_110764681 | 3300012958 | Soil | SGSLILQVLAAGALSAVAMMSRAREATKAFFRSLIARGRRWTGAR* |
| Ga0075324_10056242 | 3300014263 | Natural And Restored Wetlands | MYIDPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR* |
| Ga0075326_12760592 | 3300014271 | Natural And Restored Wetlands | WNPRGHMYIDPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR* |
| Ga0075316_10678621 | 3300014314 | Natural And Restored Wetlands | TSGSLALQVLAAAALSAVAMFGRAREATKSFFQSLVSRGRRWTSNH* |
| Ga0180074_11174232 | 3300014877 | Soil | GSLVLQVLAAGALSAVAIFSRVREGLKAFFRSLSPRRWAHKR* |
| Ga0180121_100554372 | 3300017695 | Polar Desert Sand | MYIDPTTGSLALQVLAAGALSAVAMFSRAREVTKSFFQNLVSRGRRWSGGR |
| Ga0136617_101234682 | 3300017789 | Polar Desert Sand | MYIDPTAGSLVLQILAAAALSAVAMGVRVREGVKSFFRSIVPRRGP |
| Ga0184608_101591552 | 3300018028 | Groundwater Sediment | MYIDPTTGSLVIQVLAAGALSAVVLFGRVRDALKAFFRSLSPRRWAHKR |
| Ga0184609_102903762 | 3300018076 | Groundwater Sediment | MYIDPTTGSLALQVLAAGALSAVALFGRVREFLKVFFRSLVPRRRAQKR |
| Ga0184609_104434201 | 3300018076 | Groundwater Sediment | MYIDPTSGSLVLQVLAAGALSAVAMMSRVREAMKHAFRSLVSRGRRWTGSR |
| Ga0190265_106661172 | 3300018422 | Soil | MYIDPTTGSLVLQVLAAGALSAVAIFGRLREGLKTFFRSLAPRRWAHKR |
| Ga0190272_103573692 | 3300018429 | Soil | MYIDPTTGSLVLQVLAAGALSAVALFGRVREFLKAFFRSILPRRWAHKR |
| Ga0190272_124443761 | 3300018429 | Soil | PPGHPIVTPDPEGPMYIDPTSGSLMLQVLAAGALSAVAMMSRVREAMKHTFRSLLTRGRRWTGNR |
| Ga0190268_102083572 | 3300018466 | Soil | MYIDPTAGSLVLQVLAAGVLSAVVMLGRLREGIKQVFRSLWPRRWAQKR |
| Ga0190268_117754502 | 3300018466 | Soil | MYIDPTAGSLVLQALAAGALSALAMFSRVREGAKSFFKSLVPRRWTGS |
| Ga0190273_112478241 | 3300018920 | Soil | MYIDPTSGSLMLQVLAAGALSAVAMMSRVREATKMWFRTLVERGRRWTGNR |
| Ga0190273_115435361 | 3300018920 | Soil | MYIDPTSGSLMLQVLAAGALSAVAMMSRVRETAKHWFQSIVSRGRRWTGNR |
| Ga0184641_12024801 | 3300019254 | Groundwater Sediment | PTSGSLVLQVLAAGALSAVAMISRVREGAKTWFRSLLSRGRRWTGSR |
| Ga0184646_11103691 | 3300019259 | Groundwater Sediment | MYIDPTSGSLMLQVLAAGALSAVAMMSRVREGAKTWFRSLVSLGRRWTGSR |
| Ga0184646_13538962 | 3300019259 | Groundwater Sediment | MYIDPTAGSLLIQIVAAGALSVLAMFSRVREGAKTFFKSLLPGRNRWTGKR |
| Ga0210378_100895032 | 3300021073 | Groundwater Sediment | MYIDPTTGSLALQVLAAGALSAVALFGRVREFLKVFFRSLVPRRWAQKR |
| Ga0210382_100691252 | 3300021080 | Groundwater Sediment | MYIDPTAGSLLLQFIAAGVLSAMAMMSRVREGVKSLFKSILPGRWTGKR |
| Ga0210382_102627492 | 3300021080 | Groundwater Sediment | MYIDPTSGSLMLQVLAAGALSAVAMMSRVRETAKHWFQSIVSRGRRWTGSR |
| Ga0210377_103518332 | 3300021090 | Groundwater Sediment | MYIDPTSGSLMLQVLAAGVLSAVAMVSRVRETAKGWFRSLVSLGRRWTGSR |
| Ga0196959_100323712 | 3300021184 | Soil | MYIDPTAGSLVLQVLAAGALSAVAVFGRLREGLKHMFRSLVPRRWAQKR |
| Ga0196959_100437542 | 3300021184 | Soil | MYIDPTAGSLVLQVLAAGALSAVAVFGRLREGLKHFFRSLSPRRWAQKR |
| Ga0222623_102296761 | 3300022694 | Groundwater Sediment | MYIDPTSGSLVLQVLAAGALSAVAMVSLVREGAKTWFRSLVSLGRRWTGSR |
| Ga0222623_103401002 | 3300022694 | Groundwater Sediment | MYIDPTTGSLALQVLAAGALSAVALFGRVREFLKVFFRSLLPRRWAQKR |
| Ga0210061_10595222 | 3300025537 | Natural And Restored Wetlands | MYIDPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR |
| Ga0210087_10138493 | 3300025559 | Natural And Restored Wetlands | AESWNPRGHMYIDPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR |
| Ga0210115_10118113 | 3300025791 | Natural And Restored Wetlands | DPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR |
| Ga0210143_10244392 | 3300025792 | Natural And Restored Wetlands | PRGHMYIDPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR |
| Ga0207646_102565352 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTSGSLMLQVLAAGVLSAVAMVSRVRETAKNWFRSLVSLGRRWTGSR |
| Ga0208777_10014382 | 3300025996 | Rice Paddy Soil | MYIDPTAGSLVLQFVAAGVLSLLAMFSRVREGAKSFFKSLLPGHHRWTGKP |
| Ga0208002_10183552 | 3300026029 | Natural And Restored Wetlands | RGHMYIDPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR |
| Ga0208535_10215592 | 3300026045 | Natural And Restored Wetlands | ESWNPRGHMYIDPTAGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR |
| Ga0208654_10202262 | 3300026062 | Natural And Restored Wetlands | AGSLALQVLAAAALSAVAVFGRLREGLKQFFRSLLPRRWAQKR |
| Ga0207708_102283442 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MYIDPTAGSLMLQVLAAAALSAVAMFSRLREVLKHFFRSLLPRRWAQKR |
| Ga0207676_100132522 | 3300026095 | Switchgrass Rhizosphere | MYIDPTSGSLVLQIVAAAALSAVAMMTRAREAAKSLGRSLVSRIRRWTGAR |
| Ga0209261_100984682 | 3300027735 | Wetland Sediment | MYIDPTAGSLVLQALAAGVLSALAMFSRFREGAKSFFKSLVLRRGRWTDSR |
| Ga0209382_105202702 | 3300027909 | Populus Rhizosphere | MYIDPTTGSLVLQVLAAGALSAVALFSRVREGLKAFFRTLSPRRWAHKR |
| Ga0247818_104100021 | 3300028589 | Soil | AESWNPRGHMYIDPTAGSLMLQVLAAAALSAVAMFSRLREVLKHFFRSLLPRRWAQKR |
| Ga0307320_100896551 | 3300028771 | Soil | MYIDPTSGSLMLQVLAAGALSAVAMMSRVRETAKMWFRSLLTRGRRWTGNR |
| Ga0307290_101641272 | 3300028791 | Soil | MYIDPTSGSLVLQVLAAGALSAVAMMSRVREGAKMWFRSLLARGRRWTGSR |
| Ga0307281_104221651 | 3300028803 | Soil | VAPELPGGPMYIDPTSGSLMLQVLAAGVLSAVAMVSRVRETAKGWFRSLVSLGRRWTGSR |
| Ga0307302_101395181 | 3300028814 | Soil | MYIDPTSGSLMLQVLAAGALSAVAMVSRVRETAKGWFRTLVSRGRRWTGSR |
| Ga0307310_100296704 | 3300028824 | Soil | MYIDPTAGSLLLQFIAAGVLSAMAMISRVREGVKSLFKSLLPGHRWWTGKR |
| Ga0307314_102014722 | 3300028872 | Soil | PTSGSLALQVLAAGVLSAAAMFSRVREATMSFFRSLLSRGRRWSGHP |
| Ga0307277_104239741 | 3300028881 | Soil | APRPRMYIDPTAGSLLLQFIAAGVLSAMAMMSRVREGVKSLFKSILPGRWTGKR |
| Ga0307304_100845941 | 3300028885 | Soil | MYIDPTSGSLVLQVLAAGALSAVAMMSRVRETIKHTFRSLVSRGRRWTGNR |
| Ga0299907_104757192 | 3300030006 | Soil | LQVLAAGALSAVALFARVREGLKGFFRALMPRRWAHKR |
| Ga0299907_113212292 | 3300030006 | Soil | TGSLVLQVLAAGALSAVALFSRVRETLKAFFRSLLPRRWAHKR |
| Ga0268386_106541811 | 3300030619 | Soil | YIDPTAGSLVLQVLAAGVLSALAMFSRVREGVKSFFRSLLPRRGRWTDDR |
| Ga0268386_106697262 | 3300030619 | Soil | MYIDPTTGSLVLQVLAAGALSAVALFSRVRESLKALFRSLLPRRWAHKR |
| Ga0302046_105067142 | 3300030620 | Soil | MYIDPTTGSLVLQVLAAGALSAVALFGRVREGLKAFFRALSPRRWAHKR |
| Ga0299913_113609122 | 3300031229 | Soil | MYIDPTTGSLVLQVLAAGALSAVALFGRVREGLKRLLRSLTPRRWAHKR |
| Ga0307505_106417892 | 3300031455 | Soil | MYIDPTSGSLALQVLAAGALSALAMFSRAREATKSFFRSLVSRGRRWSGHS |
| Ga0307413_107932032 | 3300031824 | Rhizosphere | MYIDPASGSLALQVVAAAALSAVAMFSRARESAKSFFRSLASRGRRWTGGR |
| Ga0307413_117856572 | 3300031824 | Rhizosphere | MYIDPTSGSLVLQVLAAGALSAVAMMSRVRESTKNWFRSLVSRGRRWTGSR |
| Ga0326597_100112912 | 3300031965 | Soil | MYIDPATGSLVLQILAAGVLSVVAMLSRVREGVKSLFRSILRYRWAGKQ |
| Ga0307416_1029548671 | 3300032002 | Rhizosphere | VCRPVTLTKWGNAMYIDPTSGSLVLQVLAAGALSAVAMMSRVRESTKNWFRSLVSRGRRWTGSR |
| Ga0307414_109225412 | 3300032004 | Rhizosphere | MYIDPASGSLALQVIAAAALSAVAMFSRARESTKSFFRSLASRGRRWTGGR |
| Ga0373950_0010704_94_249 | 3300034818 | Rhizosphere Soil | MYIDPTSGSLMLQVLAAGALSAVAMMSRVREAVKHTFRSLVSRGRRWTGSR |
| ⦗Top⦘ |