| Basic Information | |
|---|---|
| Family ID | F086762 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 45 residues |
| Representative Sequence | EEKRFDEIGWAKDIREALRLAKQHNRPVFLFTHDGRMNIGRC |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 90.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.09 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.909 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.546 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.455 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.273 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.71% β-sheet: 0.00% Coil/Unstructured: 84.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 1.82 |
| PF14060 | DUF4252 | 0.91 |
| PF12697 | Abhydrolase_6 | 0.91 |
| PF07075 | DUF1343 | 0.91 |
| PF00144 | Beta-lactamase | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.91 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.91 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.91 % |
| Unclassified | root | N/A | 9.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100442679 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
| 3300004082|Ga0062384_100707496 | All Organisms → cellular organisms → Bacteria → PVC group | 694 | Open in IMG/M |
| 3300004156|Ga0062589_100454285 | All Organisms → cellular organisms → Bacteria → PVC group | 1062 | Open in IMG/M |
| 3300004463|Ga0063356_101962991 | All Organisms → cellular organisms → Bacteria → PVC group | 884 | Open in IMG/M |
| 3300005175|Ga0066673_10190421 | All Organisms → cellular organisms → Bacteria → PVC group | 1165 | Open in IMG/M |
| 3300005179|Ga0066684_10248751 | All Organisms → cellular organisms → Bacteria → PVC group | 1166 | Open in IMG/M |
| 3300005186|Ga0066676_10724414 | All Organisms → cellular organisms → Bacteria → PVC group | 677 | Open in IMG/M |
| 3300005295|Ga0065707_11008436 | All Organisms → cellular organisms → Bacteria → PVC group | 537 | Open in IMG/M |
| 3300005332|Ga0066388_104340226 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 723 | Open in IMG/M |
| 3300005332|Ga0066388_105310264 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 653 | Open in IMG/M |
| 3300005332|Ga0066388_106772316 | All Organisms → cellular organisms → Bacteria → PVC group | 577 | Open in IMG/M |
| 3300005332|Ga0066388_107849185 | All Organisms → cellular organisms → Bacteria → PVC group | 534 | Open in IMG/M |
| 3300005334|Ga0068869_101099389 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 695 | Open in IMG/M |
| 3300005338|Ga0068868_102298761 | All Organisms → cellular organisms → Bacteria → PVC group | 514 | Open in IMG/M |
| 3300005458|Ga0070681_10712818 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 919 | Open in IMG/M |
| 3300005459|Ga0068867_101871010 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 565 | Open in IMG/M |
| 3300005471|Ga0070698_101035142 | All Organisms → cellular organisms → Bacteria → PVC group | 769 | Open in IMG/M |
| 3300005545|Ga0070695_100713941 | All Organisms → cellular organisms → Bacteria → PVC group | 797 | Open in IMG/M |
| 3300005549|Ga0070704_100234031 | All Organisms → cellular organisms → Bacteria → PVC group | 1500 | Open in IMG/M |
| 3300005558|Ga0066698_10816456 | All Organisms → cellular organisms → Bacteria → PVC group | 603 | Open in IMG/M |
| 3300005558|Ga0066698_11000392 | All Organisms → cellular organisms → Bacteria → PVC group | 531 | Open in IMG/M |
| 3300005560|Ga0066670_10699285 | All Organisms → cellular organisms → Bacteria → PVC group | 614 | Open in IMG/M |
| 3300005618|Ga0068864_101492207 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 679 | Open in IMG/M |
| 3300005764|Ga0066903_103456507 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-F19 | 852 | Open in IMG/M |
| 3300005764|Ga0066903_107259765 | All Organisms → cellular organisms → Bacteria → PVC group | 573 | Open in IMG/M |
| 3300005764|Ga0066903_108709167 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 516 | Open in IMG/M |
| 3300005842|Ga0068858_100748556 | All Organisms → cellular organisms → Bacteria → PVC group | 952 | Open in IMG/M |
| 3300006844|Ga0075428_102064456 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 590 | Open in IMG/M |
| 3300006845|Ga0075421_101737072 | All Organisms → cellular organisms → Bacteria → PVC group | 673 | Open in IMG/M |
| 3300006847|Ga0075431_101942701 | All Organisms → cellular organisms → Bacteria → PVC group | 544 | Open in IMG/M |
| 3300006854|Ga0075425_102128279 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 626 | Open in IMG/M |
| 3300006881|Ga0068865_101132100 | All Organisms → cellular organisms → Bacteria → PVC group | 690 | Open in IMG/M |
| 3300007265|Ga0099794_10751237 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 521 | Open in IMG/M |
| 3300009012|Ga0066710_100994710 | All Organisms → cellular organisms → Bacteria → PVC group | 1294 | Open in IMG/M |
| 3300009012|Ga0066710_101952751 | All Organisms → cellular organisms → Bacteria → PVC group | 874 | Open in IMG/M |
| 3300009088|Ga0099830_11493216 | All Organisms → cellular organisms → Bacteria → PVC group | 563 | Open in IMG/M |
| 3300009089|Ga0099828_12007029 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 506 | Open in IMG/M |
| 3300009090|Ga0099827_10546558 | All Organisms → cellular organisms → Bacteria → PVC group | 997 | Open in IMG/M |
| 3300009100|Ga0075418_10273361 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300009137|Ga0066709_103548145 | All Organisms → cellular organisms → Bacteria → PVC group | 566 | Open in IMG/M |
| 3300009147|Ga0114129_13283117 | All Organisms → cellular organisms → Bacteria → PVC group | 524 | Open in IMG/M |
| 3300009148|Ga0105243_10661014 | All Organisms → cellular organisms → Bacteria → PVC group | 1014 | Open in IMG/M |
| 3300009148|Ga0105243_11711118 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 658 | Open in IMG/M |
| 3300009156|Ga0111538_10575838 | All Organisms → cellular organisms → Bacteria | 1427 | Open in IMG/M |
| 3300010042|Ga0126314_10746425 | All Organisms → cellular organisms → Bacteria → PVC group | 719 | Open in IMG/M |
| 3300010304|Ga0134088_10412481 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 659 | Open in IMG/M |
| 3300010322|Ga0134084_10329141 | All Organisms → cellular organisms → Bacteria → PVC group | 576 | Open in IMG/M |
| 3300010326|Ga0134065_10466485 | All Organisms → cellular organisms → Bacteria → PVC group | 520 | Open in IMG/M |
| 3300010360|Ga0126372_12718788 | All Organisms → cellular organisms → Bacteria → PVC group | 547 | Open in IMG/M |
| 3300010397|Ga0134124_13153878 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 505 | Open in IMG/M |
| 3300011271|Ga0137393_11765694 | All Organisms → cellular organisms → Bacteria → PVC group | 507 | Open in IMG/M |
| 3300011443|Ga0137457_1277411 | All Organisms → cellular organisms → Bacteria → PVC group | 573 | Open in IMG/M |
| 3300012039|Ga0137421_1254819 | All Organisms → cellular organisms → Bacteria → PVC group | 508 | Open in IMG/M |
| 3300012200|Ga0137382_11245442 | All Organisms → cellular organisms → Bacteria → PVC group | 527 | Open in IMG/M |
| 3300012210|Ga0137378_11190116 | All Organisms → cellular organisms → Bacteria → PVC group | 678 | Open in IMG/M |
| 3300012350|Ga0137372_10533495 | All Organisms → cellular organisms → Bacteria → PVC group | 869 | Open in IMG/M |
| 3300012353|Ga0137367_10784516 | All Organisms → cellular organisms → Bacteria → PVC group | 662 | Open in IMG/M |
| 3300012360|Ga0137375_10072623 | All Organisms → cellular organisms → Bacteria | 3625 | Open in IMG/M |
| 3300012360|Ga0137375_11215768 | All Organisms → cellular organisms → Bacteria → PVC group | 576 | Open in IMG/M |
| 3300012363|Ga0137390_10830501 | All Organisms → cellular organisms → Bacteria → PVC group | 881 | Open in IMG/M |
| 3300012532|Ga0137373_10186306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1721 | Open in IMG/M |
| 3300012917|Ga0137395_10138602 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1656 | Open in IMG/M |
| 3300012929|Ga0137404_10974698 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 775 | Open in IMG/M |
| 3300012975|Ga0134110_10014526 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3006 | Open in IMG/M |
| 3300013297|Ga0157378_13294039 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 502 | Open in IMG/M |
| 3300014488|Ga0182001_10437104 | All Organisms → cellular organisms → Bacteria → PVC group | 582 | Open in IMG/M |
| 3300016371|Ga0182034_10291045 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 1305 | Open in IMG/M |
| 3300016422|Ga0182039_10369800 | All Organisms → cellular organisms → Bacteria → PVC group | 1209 | Open in IMG/M |
| 3300016445|Ga0182038_11471547 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 611 | Open in IMG/M |
| 3300017787|Ga0183260_10861149 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 564 | Open in IMG/M |
| 3300018433|Ga0066667_10440411 | All Organisms → cellular organisms → Bacteria → PVC group | 1062 | Open in IMG/M |
| 3300018433|Ga0066667_10789423 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 806 | Open in IMG/M |
| 3300018468|Ga0066662_11515612 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 698 | Open in IMG/M |
| 3300018468|Ga0066662_11586148 | All Organisms → cellular organisms → Bacteria → PVC group | 683 | Open in IMG/M |
| 3300018481|Ga0190271_13038190 | All Organisms → cellular organisms → Bacteria → PVC group | 563 | Open in IMG/M |
| 3300020018|Ga0193721_1136861 | All Organisms → cellular organisms → Bacteria → PVC group | 602 | Open in IMG/M |
| 3300021171|Ga0210405_10505361 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 947 | Open in IMG/M |
| 3300022756|Ga0222622_11277099 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
| 3300024330|Ga0137417_1385654 | All Organisms → cellular organisms → Bacteria → PVC group | 1506 | Open in IMG/M |
| 3300025936|Ga0207670_10391749 | All Organisms → cellular organisms → Bacteria → PVC group | 1109 | Open in IMG/M |
| 3300025960|Ga0207651_11807786 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 550 | Open in IMG/M |
| 3300025961|Ga0207712_11529075 | All Organisms → cellular organisms → Bacteria → PVC group | 598 | Open in IMG/M |
| 3300026089|Ga0207648_11673496 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 598 | Open in IMG/M |
| 3300026095|Ga0207676_10439254 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300026121|Ga0207683_11150836 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 719 | Open in IMG/M |
| 3300026277|Ga0209350_1130018 | All Organisms → cellular organisms → Bacteria → PVC group | 567 | Open in IMG/M |
| 3300026550|Ga0209474_10368587 | All Organisms → cellular organisms → Bacteria → PVC group | 783 | Open in IMG/M |
| 3300027513|Ga0208685_1104613 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Zavarzinella → unclassified Zavarzinella → Zavarzinella sp. | 608 | Open in IMG/M |
| 3300027824|Ga0209040_10537587 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 511 | Open in IMG/M |
| 3300027886|Ga0209486_11315728 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 501 | Open in IMG/M |
| 3300027909|Ga0209382_11845760 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 586 | Open in IMG/M |
| 3300031679|Ga0318561_10818199 | All Organisms → cellular organisms → Bacteria → PVC group | 512 | Open in IMG/M |
| 3300031680|Ga0318574_10895478 | All Organisms → cellular organisms → Bacteria → PVC group | 520 | Open in IMG/M |
| 3300031779|Ga0318566_10561952 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 557 | Open in IMG/M |
| 3300031852|Ga0307410_10749755 | All Organisms → cellular organisms → Bacteria → PVC group | 827 | Open in IMG/M |
| 3300031910|Ga0306923_12344379 | All Organisms → cellular organisms → Bacteria → PVC group | 531 | Open in IMG/M |
| 3300031911|Ga0307412_10589539 | All Organisms → cellular organisms → Bacteria → PVC group | 940 | Open in IMG/M |
| 3300031954|Ga0306926_12951000 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 509 | Open in IMG/M |
| 3300031962|Ga0307479_11404020 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium SCGC AG-212-D15 | 657 | Open in IMG/M |
| 3300034268|Ga0372943_0906504 | All Organisms → cellular organisms → Bacteria → PVC group | 586 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.55% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.55% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.73% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.73% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.73% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.82% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.82% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.82% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.91% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.91% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1004426791 | 3300000956 | Soil | EEKRFDEIGWAKDIREARRLAAQHNRPVFLFTHDGRMNIGRC* |
| Ga0062384_1007074962 | 3300004082 | Bog Forest Soil | RFDEIGWAKDLPAAEKLGKANGRPVFLFTHNGRMETGRC* |
| Ga0062589_1004542851 | 3300004156 | Soil | EKRFDEIGWAKDIRQARQLSADSNRPVFLFTHDGRMNIGRC* |
| Ga0063356_1019629911 | 3300004463 | Arabidopsis Thaliana Rhizosphere | GEKRFDEIGWARDIRSAIKLAGEHQRPVFLFTHDGRMNIGRC* |
| Ga0062592_1003238592 | 3300004480 | Soil | DPSAWVDAKVAACSPKPEERRFDQTGWLTEIRSALALAKAHNRPVFLFTHDGRMGLGRC* |
| Ga0066673_101904213 | 3300005175 | Soil | ASAKERRIDEIGWAKDIREAERLARENNRPVFLFTHDGRINTGRC* |
| Ga0066684_102487511 | 3300005179 | Soil | PTAKERRIDEIGWAGGIREAERLAKQNNRPVFLFTHDGRINTGRC* |
| Ga0066676_107244141 | 3300005186 | Soil | ERRIDEIGWASDIRQAERLAAENKRPVFLFTHDGHINTGRC* |
| Ga0065707_110084361 | 3300005295 | Switchgrass Rhizosphere | VQELQPTAKDRRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC* |
| Ga0066388_1043402262 | 3300005332 | Tropical Forest Soil | RFDEIGWVKSVLEGEQLAKQHNRPLFWFTHDGKMSEGRC* |
| Ga0066388_1053102641 | 3300005332 | Tropical Forest Soil | EERQPPAADKRFDEIGWAHDIRTALPLAKKHDRPLFLFTHDGRINTGRC* |
| Ga0066388_1067723162 | 3300005332 | Tropical Forest Soil | DERRFDDIGWVKDIREALKLAKEHDRPVFLFTHDGRINIGRC* |
| Ga0066388_1078491851 | 3300005332 | Tropical Forest Soil | RFDQIGWAKDIRTAEELAKKHGRPVFLFTHDGRMGVGRC* |
| Ga0068869_1010993891 | 3300005334 | Miscanthus Rhizosphere | TELDPKPEEKRFDEIGWAPNILTAENSAKSSRRPVFLFTHDGRINTGRC* |
| Ga0068868_1022987611 | 3300005338 | Miscanthus Rhizosphere | ARERRIDEIGWASDIRQARRLAGENNRPVFLFTHDGHINTGRC* |
| Ga0070681_107128181 | 3300005458 | Corn Rhizosphere | RDAQPTRAEKRFDEIGWAKSILEAERLAKQFKRPVFLFTHDGKMETGRC* |
| Ga0068867_1018710102 | 3300005459 | Miscanthus Rhizosphere | CSPKPEERRFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC* |
| Ga0070698_1010351422 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AKERRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRMNIGRC* |
| Ga0070695_1007139411 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AVRKRIAEIEPKPEEKRFDEIGWAKDIREARRLAAQHNRPVFLFTHDGRMNIGRC* |
| Ga0070704_1002340313 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | AKERRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC* |
| Ga0066698_108164562 | 3300005558 | Soil | IDEIGWASDIRQAERLAGEHGRPVFLFTHDGHINTGRC* |
| Ga0066698_110003921 | 3300005558 | Soil | GWAEDIRDALRLAQANQRPVFLFTHDGRMNIGRC* |
| Ga0066670_106992851 | 3300005560 | Soil | ERRIDEIGWASDIRHAERLAGENSRPVFLFTHDGHINTGRC* |
| Ga0068856_1020585101 | 3300005614 | Corn Rhizosphere | KRVTEWQPKASERRFDEIGWSKDILSARRLAQSSQRPVFIFTMDGRINLGRC* |
| Ga0068864_1014922072 | 3300005618 | Switchgrass Rhizosphere | RFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC* |
| Ga0066903_1034565072 | 3300005764 | Tropical Forest Soil | EEKRFDEIGWAHNVLDAEKLAAEHKRPIFLFTHDGKMNCGRC* |
| Ga0066903_1072597651 | 3300005764 | Tropical Forest Soil | ADRPFDEIGWAKDIREAERLARDNDRPVFLFTHDGHMAVGRC* |
| Ga0066903_1087091672 | 3300005764 | Tropical Forest Soil | DKRFDEIGWAHDIRTALALAKEHDRPVFLFTHDGQMNLGRC* |
| Ga0068858_1007485562 | 3300005842 | Switchgrass Rhizosphere | ELQPTAKERRIDEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC* |
| Ga0075428_1020644562 | 3300006844 | Populus Rhizosphere | EEKRFDEIGWAKDIREALRLAKQHNRPVFLFTHDGRMNIGRC* |
| Ga0075421_1017370721 | 3300006845 | Populus Rhizosphere | DDIGWAPDLCTALKAGKVHQRPVFLFTHDGRMQFGRC* |
| Ga0075431_1019427011 | 3300006847 | Populus Rhizosphere | VGWAADIRDAERLAKEHQRPVFLFTHDGRMNIGRC* |
| Ga0075425_1021282792 | 3300006854 | Populus Rhizosphere | TREERRLDEIGWARNIREAEQLGREHTRPVFLFTHDGRIATGRC* |
| Ga0079217_116973642 | 3300006876 | Agricultural Soil | DVASWVDQKVAACAPKPEERRFDQTGWLTDIRSALALAKQHNRPVFLFTHDGRMGLGRC* |
| Ga0068865_1011321002 | 3300006881 | Miscanthus Rhizosphere | NERRMDDIGWARDIREALRLAKEHKRPVFLFTHDGRMAAGRC* |
| Ga0099794_107512371 | 3300007265 | Vadose Zone Soil | LQPTAKEKRFDEIGWASDIRSAEKLAKDNNRPVFLFTHDGRMNIGRC* |
| Ga0066710_1009947101 | 3300009012 | Grasslands Soil | AKEKRFDEIGWAEDIRDALRLGKANQRPVFLFTHDGRMNIGRC |
| Ga0066710_1019527512 | 3300009012 | Grasslands Soil | QELEPTAKERRLDEIGWAGSIREAERLAKQNNRPVFLFTHDGRINTGRC |
| Ga0099830_114932161 | 3300009088 | Vadose Zone Soil | RRFDEIGWAKDIRTAEKLAKDNNRPVFLFTHDGHMDVGRC* |
| Ga0099828_120070293 | 3300009089 | Vadose Zone Soil | RFDEIGWAKDIRTALRLARAQRRPVFLSTMDGRINIGRC* |
| Ga0099827_105465581 | 3300009090 | Vadose Zone Soil | IGWASDIRSAEKLAQENNRPVFLFTHDGRMNIGRC* |
| Ga0075418_102733611 | 3300009100 | Populus Rhizosphere | KPEEKRFDEIGWAKDIREARRLAAQHNRPVFLFTHDGRMNIGRC* |
| Ga0066709_1035481452 | 3300009137 | Grasslands Soil | PLRAERRFDVIAWVGGIREARRLAKTHARPVFLFTHDGHMDVGRC* |
| Ga0114129_132831172 | 3300009147 | Populus Rhizosphere | AFDRIGWAPDVRTAERLSRESKRPVFLFTHDGRINTGRC* |
| Ga0105243_106610141 | 3300009148 | Miscanthus Rhizosphere | DEIGWAKDIRTAEKLAKENNRPVFLFTHDGRINIGRC* |
| Ga0105243_117111181 | 3300009148 | Miscanthus Rhizosphere | GWLTEIRSALALAKAHNRPVFLFTHDGRMGLGRC* |
| Ga0111538_105758381 | 3300009156 | Populus Rhizosphere | QRVAELRPRTEEKRFDEIGWAKDIRDALRLAKQHNRPVFLFTHDGRMNIGRC* |
| Ga0126308_108376992 | 3300010040 | Serpentine Soil | VKQWVDQKVADCEPKPEERRFDQTGWAPDIRAALKLAKEHHRPVFLFTHDGHMAVGRC* |
| Ga0126314_107464252 | 3300010042 | Serpentine Soil | AACAPKPEERRFDQTGWLTDIRSALELAKQNNRPVFLFTHDGRMGLGRC* |
| Ga0134088_103730741 | 3300010304 | Grasslands Soil | LTAWVDQRIKECEPKPEERRFDEIGWVQSIREAERLAKQHERPVFLFTHDGRMGIGRC* |
| Ga0134088_104124811 | 3300010304 | Grasslands Soil | ARVRALQPTGAEKRFDEIGWARDIRDAERLAKEHHRPVFLFTHDGRINLGRC* |
| Ga0134084_103291412 | 3300010322 | Grasslands Soil | QALQPTAREKRFDEIGWASDIRSAEKLARENNRPVFLFTHDGRMNIGRC* |
| Ga0134065_104664852 | 3300010326 | Grasslands Soil | VQELEPTAKERRLDEIGWAGSIREAERLAKQNNRPVFLFTHDGRINTGRC* |
| Ga0126372_127187881 | 3300010360 | Tropical Forest Soil | ALQPTAEEKRLDEIGWAKNIVEAEKLARGSNRPVFLFAHDGNIATGRC* |
| Ga0134124_131538781 | 3300010397 | Terrestrial Soil | FDQVGWAKDILDAERLAKLHNRPIFLFTHDGRVNWGRC* |
| Ga0137393_117656941 | 3300011271 | Vadose Zone Soil | KRVRDWQPTADDRRFDEIGWAKDIREAEKLAKENNRPVFLFTHDGRMNIGRC* |
| Ga0137457_12774112 | 3300011443 | Soil | PEEKRFDEIGWAKDIRDAKELAKQHQRPVFLFTHDGRMNIGRC* |
| Ga0137421_12548191 | 3300012039 | Soil | LQPRPEEKRFDEIGWAKDIRDAKELAKQHQRPIFLFTHDGRMNIGRC* |
| Ga0137382_112454421 | 3300012200 | Vadose Zone Soil | PRERRIDEIGWASDIRQAERLAGEHSRPVFLFTHDGHINTGRC* |
| Ga0137378_111901161 | 3300012210 | Vadose Zone Soil | GWASDIRQAERLARENSRPVFLFTHDGHINTGRC* |
| Ga0150985_1084965611 | 3300012212 | Avena Fatua Rhizosphere | VKPWVDQKVADCEPKPEERRFDETGWLTAIGPALKLAKEHHRPVFLFTHDGHMAVGRC* |
| Ga0150985_1105610283 | 3300012212 | Avena Fatua Rhizosphere | GWVDKKVAECSPKPEERRFDQTGWLTDIRSALELAKRHNRPVFLFTHDGRMGLGRC* |
| Ga0137372_105334951 | 3300012350 | Vadose Zone Soil | RFDEIGWASDILEARRLAKEHKRPIFLFTHDGHMAVGRC* |
| Ga0137367_107845161 | 3300012353 | Vadose Zone Soil | AARERRIDEIGWASDIRQAERLAGEHSRPVFLFTHDGHINTGRC* |
| Ga0137375_100726236 | 3300012360 | Vadose Zone Soil | FDEIGWAKDIRTAERLARDNNRPVFLFTHDGRMNIGRC* |
| Ga0137375_112157682 | 3300012360 | Vadose Zone Soil | AARERRIDEIGWASDIRQAERLAGENSRPVFLFTHDGHINTGRC* |
| Ga0137390_108305012 | 3300012363 | Vadose Zone Soil | LQPTANEKRLDEIGWAKDIRSAEKLAQEHNRPVFLFTHDGRMNIGRC* |
| Ga0150984_1064736531 | 3300012469 | Avena Fatua Rhizosphere | ASAPADGEVAGWVDKKVAECSPKPEERRFDQTGWLTDIRSALELAKRHNRPVFLFTHDGRMGLGRC* |
| Ga0137373_101863061 | 3300012532 | Vadose Zone Soil | RERRIDEIGWASDIRQAERLAGEHNRPVFLFTHDGHINTGRC* |
| Ga0137395_101386023 | 3300012917 | Vadose Zone Soil | DEIGWASDIRQAERLARENSRPVFLFTHDGHINTGRC* |
| Ga0137404_109746981 | 3300012929 | Vadose Zone Soil | EKRFDEIGWAKNILDAERLAKQYGRPVFLFTHDGKMETGRC* |
| Ga0134110_100145261 | 3300012975 | Grasslands Soil | LEPTVKERRIDEIGWAGGIREAERLAKQNNRPVFLFTHDGRINTGRC* |
| Ga0157378_132940391 | 3300013297 | Miscanthus Rhizosphere | PKASERRFDEIGWAKDIRTAKQLAQGSQRPVFVFTMDGRINLGRC* |
| Ga0182001_104371042 | 3300014488 | Soil | QPTEREKRWETIGWAKDIRDALKLAKEHNRPAFLFTLDGRMNVGRC* |
| Ga0182008_107040931 | 3300014497 | Rhizosphere | AAWVDQKVADCSPRPEERRFDQTGWLTDIRSALALANQHDRPVFLFTHDGRMGLGRC* |
| Ga0182034_102910451 | 3300016371 | Soil | AADKRFDEIGWAHDLRTALALAKEHDRPVFLFTHDGRINTGRC |
| Ga0182039_103698003 | 3300016422 | Soil | RFDDIGWVDTIGEALQLGKKHQRPVFLFTHDGRIAIGRC |
| Ga0182038_114715471 | 3300016445 | Soil | RFDEIGWAHDIRTALALAKKHDRPVFLFTHDGRINTGRC |
| Ga0183260_108611491 | 3300017787 | Polar Desert Sand | AAERTFDQIAWSTDILTALERAKKNDRPIFLFTHDGRMALGRC |
| Ga0066667_104404112 | 3300018433 | Grasslands Soil | LGWVEKRVADLQASAKEGRIDEIGWAKNIREAERVARENNRPVFLFTHDGRINTGRC |
| Ga0066667_107894232 | 3300018433 | Grasslands Soil | SEKRFDEIGWAKNILDAERLAKQYGRPVFLFTHDGKMETGRC |
| Ga0066662_115156121 | 3300018468 | Grasslands Soil | ASRVNELQPTPQERKIDRIGWARTILGAEKLAREHGRPVFLFTHDGRINTGRC |
| Ga0066662_115861481 | 3300018468 | Grasslands Soil | RRFDEIGWVGDIFEARRLARLHNRPVFLFTHDGHMAVGRC |
| Ga0190271_130381901 | 3300018481 | Soil | EIGWASDIRDALRLAKENRRPVFLFTHDGRMAAGRC |
| Ga0193721_11368611 | 3300020018 | Soil | RRLDEIGWAKDIREAERLAKENRRPVFLFTHDGRLNIGRC |
| Ga0210405_105053612 | 3300021171 | Soil | TAKEKRFDEIGWAKDIREAEKLAKENKRPVFLFTHDGRMNIGRC |
| Ga0222622_112770991 | 3300022756 | Groundwater Sediment | PTDAERRIDQVGWATSLLEAEKLAKQHNRPVFLFTHDGRIGNGRC |
| Ga0137417_13856541 | 3300024330 | Vadose Zone Soil | MKIGWAKDIRSAEKLAQENNRPVFLFTHDGRMNIGRC |
| Ga0207657_114904492 | 3300025919 | Corn Rhizosphere | PPSGDPSSYVDAKVAACSPKPEERRFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC |
| Ga0207670_103917492 | 3300025936 | Switchgrass Rhizosphere | QQLQPQAKEKRLDDIGWAKDIRAAIKLAGEHQRPVFLFTHDGRMNIGRC |
| Ga0207651_118077862 | 3300025960 | Switchgrass Rhizosphere | AQPTRTERKFDEVGWAKDIRDAERLAKLHQRPIFLFTHDGRVNLGRC |
| Ga0207712_115290751 | 3300025961 | Switchgrass Rhizosphere | AAAAKEKRLDEIGWAKDIRAAIKLAGEHQRPVFLFTHDGRMNIGRC |
| Ga0207648_116734961 | 3300026089 | Miscanthus Rhizosphere | EERRFDQTGWVTDIRTALALAKQHNRPVFLFTHDGHMGLGRC |
| Ga0207676_104392541 | 3300026095 | Switchgrass Rhizosphere | WQPNAAEKRWESIGWAKDIRRALRLAQQHQRPVFLFTLDGRMNLGRC |
| Ga0207683_111508361 | 3300026121 | Miscanthus Rhizosphere | LQPRTEEKRFDEIGWAKDIRDALRLAKQHHRPVFLFTHDGRMNIGRC |
| Ga0209350_11300182 | 3300026277 | Grasslands Soil | RIDEIGWAGSIREAERLAKQNKRPVFLFTHDGRINTGRC |
| Ga0209474_103685872 | 3300026550 | Soil | ERRCDEIGWAKDIREAERLAKAHNRPVFLFTHDGRMAVGRC |
| Ga0208685_11046132 | 3300027513 | Soil | RFDEIGWAKDIREALRLAKQHNRPVFLFTHDGRMNIGRC |
| Ga0209040_105375871 | 3300027824 | Bog Forest Soil | DEIGWASDILEARRLAKQHNRPVFLFTHDGHMAVGRC |
| Ga0209486_113157281 | 3300027886 | Agricultural Soil | APTADERRFDEIGWARDIREGRRLSRESGRPLFLFTHDGRMAVGRC |
| Ga0209382_118457602 | 3300027909 | Populus Rhizosphere | RIDEIGWAADIREALRLSRESRRPVFLFTHDGRMGVGRC |
| Ga0318561_108181991 | 3300031679 | Soil | EKRFDEVGWATEILAGRELAKKNNRPVFLFTHDGHMAVGRC |
| Ga0318574_108954782 | 3300031680 | Soil | DDIAWVGDIREALKLARQHGRPVFLFTHDGRMNIGRC |
| Ga0318566_105619522 | 3300031779 | Soil | SSKRRSAPVGWVHTVVEAQRLAKEHNRPVFLFTHDGRMNLGRC |
| Ga0307410_107497552 | 3300031852 | Rhizosphere | RFDQTGWLTDIRSALKLAKEHDRPVFLFTHDGHMDVGRC |
| Ga0306923_123443792 | 3300031910 | Soil | SEKRFDEVGWATEILAGRELAKKNNRPVFLFTHDGHMAVGRC |
| Ga0307412_105895391 | 3300031911 | Rhizosphere | DCSPKPEERRFDRTGWLTDIRSALELANRHNRPVFLFTHDGRMGLGRC |
| Ga0306926_129510002 | 3300031954 | Soil | QPPATDKRFDEIGWAHDIRTALALAKEHDRPVFLFTHDGRINTGRC |
| Ga0307479_114040201 | 3300031962 | Hardwood Forest Soil | EDRKFDEIGWSNSIVDAEKLARQNNRPVFLFTQNGRIEIGRT |
| Ga0372943_0906504_1_144 | 3300034268 | Soil | WQPTAEERRFDEIGWAGGLRDAIRLAKAHGRPVFLFTHDGHMAIGRC |
| ⦗Top⦘ |