| Basic Information | |
|---|---|
| Family ID | F086746 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRGEGAAPG |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 26.36 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.091 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (18.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (30.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 0.00% Coil/Unstructured: 62.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF01520 | Amidase_3 | 50.00 |
| PF00296 | Bac_luciferase | 32.73 |
| PF02195 | ParBc | 7.27 |
| PF00085 | Thioredoxin | 5.45 |
| PF13193 | AMP-binding_C | 1.82 |
| PF01381 | HTH_3 | 0.91 |
| PF00392 | GntR | 0.91 |
| PF02527 | GidB | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 50.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 32.73 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.09 % |
| Unclassified | root | N/A | 0.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_10158372 | All Organisms → cellular organisms → Bacteria | 2389 | Open in IMG/M |
| 3300000955|JGI1027J12803_102125661 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300004114|Ga0062593_102184894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300004157|Ga0062590_102980051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300004479|Ga0062595_102535590 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300005294|Ga0065705_11145915 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300005345|Ga0070692_10318277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 956 | Open in IMG/M |
| 3300005347|Ga0070668_100769936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300005354|Ga0070675_100273596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1482 | Open in IMG/M |
| 3300005438|Ga0070701_10315193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300005441|Ga0070700_100850417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
| 3300005444|Ga0070694_101570541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
| 3300005471|Ga0070698_100507822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1144 | Open in IMG/M |
| 3300005471|Ga0070698_101849392 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300005713|Ga0066905_100451451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1057 | Open in IMG/M |
| 3300005844|Ga0068862_100229533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1683 | Open in IMG/M |
| 3300006049|Ga0075417_10062194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1636 | Open in IMG/M |
| 3300006058|Ga0075432_10000639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10710 | Open in IMG/M |
| 3300006847|Ga0075431_101885133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 553 | Open in IMG/M |
| 3300009094|Ga0111539_10169865 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
| 3300009148|Ga0105243_10023400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4704 | Open in IMG/M |
| 3300009157|Ga0105092_10056545 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300009553|Ga0105249_13291023 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300009609|Ga0105347_1257474 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009678|Ga0105252_10433294 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300009801|Ga0105056_1012915 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300009804|Ga0105063_1028004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 710 | Open in IMG/M |
| 3300009811|Ga0105084_1000999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3021 | Open in IMG/M |
| 3300009811|Ga0105084_1002002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2464 | Open in IMG/M |
| 3300009818|Ga0105072_1072179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300009822|Ga0105066_1070448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300009823|Ga0105078_1017915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300009836|Ga0105068_1056759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
| 3300010038|Ga0126315_10008810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4693 | Open in IMG/M |
| 3300010041|Ga0126312_10197845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1404 | Open in IMG/M |
| 3300010041|Ga0126312_11017540 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010400|Ga0134122_10350175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1286 | Open in IMG/M |
| 3300010403|Ga0134123_10731954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 972 | Open in IMG/M |
| 3300011412|Ga0137424_1001738 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300012204|Ga0137374_10664182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
| 3300012353|Ga0137367_10024836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4660 | Open in IMG/M |
| 3300012355|Ga0137369_10725955 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012358|Ga0137368_10244503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1244 | Open in IMG/M |
| 3300012938|Ga0162651_100084255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300012985|Ga0164308_11467134 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300015371|Ga0132258_10764576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2434 | Open in IMG/M |
| 3300015371|Ga0132258_11987727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1463 | Open in IMG/M |
| 3300015373|Ga0132257_100896143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1112 | Open in IMG/M |
| 3300017965|Ga0190266_10052760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1448 | Open in IMG/M |
| 3300018028|Ga0184608_10014516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2754 | Open in IMG/M |
| 3300018055|Ga0184616_10099453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1036 | Open in IMG/M |
| 3300018076|Ga0184609_10020445 | All Organisms → cellular organisms → Bacteria | 2617 | Open in IMG/M |
| 3300018076|Ga0184609_10145999 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300018081|Ga0184625_10027996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2740 | Open in IMG/M |
| 3300018084|Ga0184629_10442084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300018465|Ga0190269_10022149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2860 | Open in IMG/M |
| 3300018466|Ga0190268_10002062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3996 | Open in IMG/M |
| 3300018469|Ga0190270_10131581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1992 | Open in IMG/M |
| 3300019767|Ga0190267_10003729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3800 | Open in IMG/M |
| 3300020016|Ga0193696_1029112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300021081|Ga0210379_10152929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 982 | Open in IMG/M |
| 3300021344|Ga0193719_10108225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1209 | Open in IMG/M |
| 3300021510|Ga0222621_1063468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 777 | Open in IMG/M |
| 3300025735|Ga0207713_1059472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1466 | Open in IMG/M |
| 3300025935|Ga0207709_10050549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2543 | Open in IMG/M |
| 3300025938|Ga0207704_10360414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1135 | Open in IMG/M |
| 3300027006|Ga0209896_1023911 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300027056|Ga0209879_1000105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8981 | Open in IMG/M |
| 3300027056|Ga0209879_1001048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3584 | Open in IMG/M |
| 3300027056|Ga0209879_1013713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1330 | Open in IMG/M |
| 3300027163|Ga0209878_1004899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1946 | Open in IMG/M |
| 3300027209|Ga0209875_1033698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 614 | Open in IMG/M |
| 3300027577|Ga0209874_1085227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 769 | Open in IMG/M |
| 3300027682|Ga0209971_1096241 | Not Available | 724 | Open in IMG/M |
| 3300027695|Ga0209966_1053520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 862 | Open in IMG/M |
| 3300027743|Ga0209593_10146391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300027952|Ga0209889_1100716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 579 | Open in IMG/M |
| 3300027961|Ga0209853_1119230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
| 3300028587|Ga0247828_10340030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
| 3300028589|Ga0247818_10960233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300028592|Ga0247822_11305651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300028720|Ga0307317_10287750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300028722|Ga0307319_10071334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1100 | Open in IMG/M |
| 3300028722|Ga0307319_10246891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 587 | Open in IMG/M |
| 3300028755|Ga0307316_10029088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1797 | Open in IMG/M |
| 3300028796|Ga0307287_10239489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300028803|Ga0307281_10163462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
| 3300028812|Ga0247825_10320384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1086 | Open in IMG/M |
| 3300028812|Ga0247825_11385328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300028819|Ga0307296_10114748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1446 | Open in IMG/M |
| 3300028876|Ga0307286_10052659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1382 | Open in IMG/M |
| 3300030336|Ga0247826_10009041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3989 | Open in IMG/M |
| 3300030336|Ga0247826_11203912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300031170|Ga0307498_10402829 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300031562|Ga0310886_10998173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300031824|Ga0307413_11200292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300031847|Ga0310907_10597103 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031854|Ga0310904_10447253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
| 3300031858|Ga0310892_10099785 | All Organisms → cellular organisms → Bacteria | 1586 | Open in IMG/M |
| 3300031908|Ga0310900_10595566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
| 3300031908|Ga0310900_10743505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 789 | Open in IMG/M |
| 3300031913|Ga0310891_10214803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300031944|Ga0310884_10292052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 906 | Open in IMG/M |
| 3300032012|Ga0310902_10022668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2779 | Open in IMG/M |
| 3300032075|Ga0310890_10133234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1617 | Open in IMG/M |
| 3300032122|Ga0310895_10610920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
| 3300033550|Ga0247829_10239087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1457 | Open in IMG/M |
| 3300033551|Ga0247830_10480080 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300034115|Ga0364945_0107391 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300034150|Ga0364933_157162 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 18.18% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.45% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 15.45% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.64% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.64% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.73% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.73% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.73% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.82% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.82% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.82% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.91% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300009801 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027163 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| 3300034150 | Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_101583721 | 3300000891 | Soil | MQAPSDAELRRAGKALALGFVLGLVLLLVARRARALAGGPDLR* |
| JGI1027J12803_1021256612 | 3300000955 | Soil | MEAPSDAELRRAGKALALGFVLGLVLLAVARRAPG |
| Ga0062593_1021848942 | 3300004114 | Soil | MQAPSDAELRRAGKALALGFVLGLVLLLMARRARALAGGPDLR* |
| Ga0062590_1029800512 | 3300004157 | Soil | ASGCSRATPPTYDTHPMGAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG |
| Ga0062595_1025355902 | 3300004479 | Soil | MGAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG* |
| Ga0065705_111459151 | 3300005294 | Switchgrass Rhizosphere | MEVPADAELRRAGKALALGFALGLVLLLVARRTSGRRVGGADPR* |
| Ga0070692_103182772 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | SHRRTIPVPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDEEGSG* |
| Ga0070668_1007699362 | 3300005347 | Switchgrass Rhizosphere | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDKEGSG* |
| Ga0070675_1002735962 | 3300005354 | Miscanthus Rhizosphere | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDEEGSG* |
| Ga0070701_103151932 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG* |
| Ga0070700_1008504172 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MQAPSDAELRRAGKALALGFVLGLVLLLRLAAPGQLAGGPDLR* |
| Ga0070694_1015705412 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DAELRRAGKALALGFVLGLVLLLVARRAPRQLAGGPDPR* |
| Ga0070698_1005078221 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RATPPPYDTHPMDAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRAAPT* |
| Ga0070698_1018493922 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEAPSDAELGRAGKALALGLALGLVLLLVARRPAGRRARGGANPGEGDALG* |
| Ga0066905_1004514512 | 3300005713 | Tropical Forest Soil | LRRAGKALALGFALGLVLLALARRAPGGRGEEARSG* |
| Ga0068862_1002295332 | 3300005844 | Switchgrass Rhizosphere | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG* |
| Ga0075417_100621942 | 3300006049 | Populus Rhizosphere | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEASG* |
| Ga0075432_100006395 | 3300006058 | Populus Rhizosphere | MKAPSDDELRRAGKAIALGFALGLVLLALARRAPGRRGEEGSG* |
| Ga0075431_1018851331 | 3300006847 | Populus Rhizosphere | PIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG* |
| Ga0111539_101698654 | 3300009094 | Populus Rhizosphere | MDAPTDAELRRAGKAFALGFALGLALLLVARRAPGRRVGGADPR* |
| Ga0105243_100234003 | 3300009148 | Miscanthus Rhizosphere | MKAPSDDELRRAGRALALGFALGLVLLALARRAPGRRDEEGSG* |
| Ga0105092_100565452 | 3300009157 | Freshwater Sediment | MEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEDARSG* |
| Ga0105249_132910232 | 3300009553 | Switchgrass Rhizosphere | MEAPSDAELRLAGKALVLGFALGLVLLLVARRAQRQ |
| Ga0105347_12574742 | 3300009609 | Soil | MEAPSDAELRRAGKALALGFALGIVLLLVARRAPGQRAGGGTPGSGDPVR* |
| Ga0105252_104332942 | 3300009678 | Soil | MEAPSDAELRRAGKALALGFALGLVLLLVARRAPGQRGGGANRG* |
| Ga0105056_10129152 | 3300009801 | Groundwater Sand | MEAPSDAELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG* |
| Ga0105063_10280042 | 3300009804 | Groundwater Sand | MEAPSDDELRRAGKALALGFVLGLVLLALASRAPGRRGEGATSG* |
| Ga0105084_10009994 | 3300009811 | Groundwater Sand | MEAPSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG* |
| Ga0105084_10020023 | 3300009811 | Groundwater Sand | MKAPSDDELRSAGKALALGFALGLVLLALARRAPGRRGEEGSG* |
| Ga0105072_10721791 | 3300009818 | Groundwater Sand | DDELRRAGKALALGFALGLVLLALARRAPGRRGEERRSG* |
| Ga0105066_10704482 | 3300009822 | Groundwater Sand | PSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG* |
| Ga0105078_10179151 | 3300009823 | Groundwater Sand | RTIPIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG* |
| Ga0105068_10567591 | 3300009836 | Groundwater Sand | PYDTHPMEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEDARSG* |
| Ga0126315_100088105 | 3300010038 | Serpentine Soil | MKAPRDDELRRAGKALGLGFVLGLVLLVLARRAPGRRGEESAPG* |
| Ga0126312_101978452 | 3300010041 | Serpentine Soil | MKAPPDEELRRAGKALGLGFVLGLVLLVLARRAPGRRGEGSAPG* |
| Ga0126312_110175402 | 3300010041 | Serpentine Soil | MEALSDDELRRAGKALSLGFVLGLVLLALARRATGRRGEGAASG* |
| Ga0134122_103501752 | 3300010400 | Terrestrial Soil | MEAPSEAELRRAGKALVLGFALGLVLLLVARRAPGQRAGGANPG* |
| Ga0134123_107319542 | 3300010403 | Terrestrial Soil | MEAPSDAELRRAGKALVLGFALGLVLLLVARRAQRQHAGGANPG* |
| Ga0137424_10017383 | 3300011412 | Soil | MEAPSDAELRRAGKALALGFALGLVLLLVARRAPGQRAGGADRA* |
| Ga0137374_106641822 | 3300012204 | Vadose Zone Soil | MEAPSDDEVRRAGKALALGFVLGLVLLTLARRATGRRGEGAASG* |
| Ga0137367_100248364 | 3300012353 | Vadose Zone Soil | MEAPSDDEVRRAGKALALGFVLGLVLLALARRVPSRRGEGAASG* |
| Ga0137369_107259552 | 3300012355 | Vadose Zone Soil | MEAPSDAELRRAGKALALGFALGLLLLLVARRAPGQRAGGANPG* |
| Ga0137368_102445032 | 3300012358 | Vadose Zone Soil | MEAPSDDELRRAGKALGLGFVLGLVLLALARRAPGRRGEGAASG* |
| Ga0162651_1000842551 | 3300012938 | Soil | PPPYDTHPMEAPSDAERRRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPG* |
| Ga0164308_114671342 | 3300012985 | Soil | MEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR* |
| Ga0132258_107645762 | 3300015371 | Arabidopsis Rhizosphere | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGPRGEEGSG* |
| Ga0132258_119877272 | 3300015371 | Arabidopsis Rhizosphere | MGAPSDAELRRAGKALALGFALGLVLLLVARRAPGRRVGGANPG* |
| Ga0132257_1008961432 | 3300015373 | Arabidopsis Rhizosphere | MEVPADAELRRAGKALALGFALGLVLLLVARRAPGGRVGGANPG* |
| Ga0190266_100527602 | 3300017965 | Soil | MEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRATPT |
| Ga0184608_100145163 | 3300018028 | Groundwater Sediment | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG |
| Ga0184616_100994532 | 3300018055 | Groundwater Sediment | MEVPSGAELRRAAKALVPGFALGLVLLLVARRAPGKYAGGANAG |
| Ga0184609_100204452 | 3300018076 | Groundwater Sediment | MEAPSDAELRRAGKALALGFVLGLVLLAVARRAPDRRGEGAAPG |
| Ga0184609_101459992 | 3300018076 | Groundwater Sediment | MKAPSDDELRRAGKALALGFALGLVVLALARRASGRRGEEGRSG |
| Ga0184625_100279962 | 3300018081 | Groundwater Sediment | MEAPSEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKRG |
| Ga0184629_104420842 | 3300018084 | Groundwater Sediment | MEAPSDAELRRAGKALALGFALGLVLLLVARRAGRADPG |
| Ga0190269_100221494 | 3300018465 | Soil | MKTPSDAELLRAGKALALGFVLGLVLLAVARRAPGRRAAPT |
| Ga0190268_100020624 | 3300018466 | Soil | MDAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRAAPS |
| Ga0190270_101315812 | 3300018469 | Soil | MEAPSEAELRRAGKALALGFALGLVLLLVARRAPERRAGGADRG |
| Ga0190267_100037294 | 3300019767 | Soil | MEAPSDADLRRAGKALALGFVLGLVLLAVARRAPGRRAAPS |
| Ga0193696_10291122 | 3300020016 | Soil | MEAPSDAELRRAGKALALGFALGLVLLLVARRSPGQRAGGANPG |
| Ga0210379_101529292 | 3300021081 | Groundwater Sediment | MEAPSDAELRRAGTALALGFALGLVLLLVARRASGQRAGGTNPG |
| Ga0193719_101082252 | 3300021344 | Soil | MGAPSDAELRRAGKALALGFALGLVLLLVGRRAPGRRVGGANPR |
| Ga0222621_10634682 | 3300021510 | Groundwater Sediment | SHRRTIPIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG |
| Ga0207713_10594722 | 3300025735 | Switchgrass Rhizosphere | MGAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG |
| Ga0207709_100505493 | 3300025935 | Miscanthus Rhizosphere | MKAPSDDELRRAGRALALGFALGLVLLALARRAPGRRDEEGSG |
| Ga0207704_103604142 | 3300025938 | Miscanthus Rhizosphere | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRDEEGSG |
| Ga0209896_10239112 | 3300027006 | Groundwater Sand | MEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG |
| Ga0209879_10001057 | 3300027056 | Groundwater Sand | MEAPSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG |
| Ga0209879_10010483 | 3300027056 | Groundwater Sand | MKTPSDAELLRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPS |
| Ga0209879_10137132 | 3300027056 | Groundwater Sand | MKAPSDDELRSAGKALALGFALGLVLLALARRAPGRRGEEGSG |
| Ga0209878_10048993 | 3300027163 | Groundwater Sand | MEAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEDARSG |
| Ga0209875_10336982 | 3300027209 | Groundwater Sand | PSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG |
| Ga0209874_10852272 | 3300027577 | Groundwater Sand | MEASPDAELRRAGKALALGFVLGLVLLAIARRGRGRRGEEAASG |
| Ga0209971_10962412 | 3300027682 | Arabidopsis Thaliana Rhizosphere | APSDAELRRAVKALALGFVLGLVLLAVARRAPGRRAAPS |
| Ga0209966_10535202 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MKAPSDDELWRAGKALALGFALGLVLLALARRAPGRRGEDARSG |
| Ga0209593_101463912 | 3300027743 | Freshwater Sediment | MKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG |
| Ga0209889_11007162 | 3300027952 | Groundwater Sand | APSDDELRRAGKALALGFVLGLVLLALARRAPGRRGEEAASG |
| Ga0209853_11192302 | 3300027961 | Groundwater Sand | PIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG |
| Ga0247828_103400301 | 3300028587 | Soil | RASGCSRGTPPPYDTQPMEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADP |
| Ga0247818_109602332 | 3300028589 | Soil | MEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR |
| Ga0247822_113056511 | 3300028592 | Soil | IYDIHPMEAPSEAEREPQRERLAGAPELGLVLLLVARRAPGLRAGGAKRG |
| Ga0307317_102877501 | 3300028720 | Soil | DDELRRAGKALALGFALGLVLLALARRAPGRRGEEGRSG |
| Ga0307319_100713342 | 3300028722 | Soil | MEAPSDDELRRAGKALALGFVLGLVLLALGRRATGRCREGAAPG |
| Ga0307319_102468911 | 3300028722 | Soil | SVAERRRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPG |
| Ga0307316_100290882 | 3300028755 | Soil | MEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRGEGAAPG |
| Ga0307287_102394892 | 3300028796 | Soil | MEAPSDAELRRAGKALALGFVLGLALLAVGRRAPDRRGEGAAPG |
| Ga0307281_101634622 | 3300028803 | Soil | MEAPSDAELRRAGKALALGFALGLVLLLVARRASGQRAGGTNPG |
| Ga0247825_103203842 | 3300028812 | Soil | MEVPSGAELWRAARALVLGFALGLVLLLVARHAPGQDAGGANAG |
| Ga0247825_113853282 | 3300028812 | Soil | IPIPMKAPSDDELRRAGKALALGFALGLVLLALARRAPGRRGEEGSG |
| Ga0307296_101147482 | 3300028819 | Soil | MQAPSDAELLRAGKALALGFALGLVLLLVARRAPGRRAGG |
| Ga0307286_100526593 | 3300028876 | Soil | HPMEAPSDAELRRAGKALALGFVLGLVLLAVARRAPGRRGQRAAPS |
| Ga0247826_100090412 | 3300030336 | Soil | MEAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGAGPR |
| Ga0247826_112039121 | 3300030336 | Soil | SIYDIHPMEAPFEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKPG |
| Ga0307498_104028291 | 3300031170 | Soil | MGTPSDAELRRAGKALALGFALGLVLLLVARRASGRRIGGANPG |
| Ga0310886_109981732 | 3300031562 | Soil | THPMGAPSDAELRRAGKALALGFALGLVLLLVARRESGRRVGGANPG |
| Ga0307413_112002922 | 3300031824 | Rhizosphere | DDELRRAGKALGLGFVLGLVLLVLARRAPGRRGEGSPPG |
| Ga0310907_105971032 | 3300031847 | Soil | MEVPADAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR |
| Ga0310904_104472532 | 3300031854 | Soil | MEAPTDAELRRAGKALALGFALGLVLLLVARRTSGRRVGGADPR |
| Ga0310892_100997852 | 3300031858 | Soil | MEVPADAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG |
| Ga0310900_105955662 | 3300031908 | Soil | MEVPADAELRRAGKALALGFALGLVLLLVARRTSGRRVGGADPR |
| Ga0310900_107435052 | 3300031908 | Soil | MEAPSDAELRRAGKALVLGFALGLVLLLVARRAQRQRAGGANPD |
| Ga0310891_102148032 | 3300031913 | Soil | MEAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGAGPR |
| Ga0310884_102920522 | 3300031944 | Soil | MEAPSDAELRRAGKALALGFALGLVLLLVARRAPERRAGGADRG |
| Ga0310902_100226684 | 3300032012 | Soil | MEAPSDAELRRAGKALALGFALGLVLLLVARRASGRRVGGADPR |
| Ga0310890_101332343 | 3300032075 | Soil | MDAPTDAELRRAGKALALGFALGLVLLLVARRASGRRVGGAGPR |
| Ga0310895_106109201 | 3300032122 | Soil | RGTPPPYDTQPMEVPADAELRRAGKALALGFALGLVLLLVARRASGRRVGGANPG |
| Ga0247829_102390872 | 3300033550 | Soil | MEAPFEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKRG |
| Ga0247830_104800802 | 3300033551 | Soil | MEAPSEAELRRAGKALALGFALGLVLLLVARRAPGLRAGGAKPG |
| Ga0364945_0107391_65_199 | 3300034115 | Sediment | MKAPSDDELRRAGKALALGFALGLMLLALARRTPGRRGEEGRSG |
| Ga0364933_157162_361_495 | 3300034150 | Sediment | MEAPSGAELRRAAKALVVGFALGLVLLLVARHAPGKYAGGANAG |
| ⦗Top⦘ |