Metagenome Family F086718

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F086718
Family Type	Metagenome
Number of Sequences	110
Average Sequence Length	45 residues
Representative Sequence	TALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW
Number of Associated Samples	96
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.82 %
% of genes near scaffold ends (potentially truncated)	98.18 %
% of genes from short scaffolds (< 2000 bps)	97.27 %
Associated GOLD sequencing projects	90
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (97.273 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (13.636 % of family members)
Environment Ontology (ENVO)	Unclassified (36.364 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (55.455 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 23.53% β-sheet: 14.71% Coil/Unstructured: 61.76%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF00196	GerE	12.73
PF00571	CBS	2.73
PF00378	ECH_1	2.73
PF13692	Glyco_trans_1_4	1.82
PF01266	DAO	1.82
PF13858	DUF4199	1.82
PF09285	Elong-fact-P_C	0.91
PF00326	Peptidase_S9	0.91
PF13946	DUF4214	0.91
PF08447	PAS_3	0.91
PF00881	Nitroreductase	0.91
PF01872	RibD_C	0.91
PF00999	Na_H_Exchanger	0.91
PF00348	polyprenyl_synt	0.91
PF13189	Cytidylate_kin2	0.91
PF01223	Endonuclease_NS	0.91
PF13474	SnoaL_3	0.91
PF05016	ParE_toxin	0.91
PF00293	NUDIX	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG0025	NhaP-type Na+/H+ or K+/H+ antiporter	Inorganic ion transport and metabolism [P]	0.91
COG0142	Geranylgeranyl pyrophosphate synthase	Coenzyme transport and metabolism [H]	0.91
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.91
COG0475	Kef-type K+ transport system, membrane component KefB	Inorganic ion transport and metabolism [P]	0.91
COG1864	DNA/RNA endonuclease G, NUC1	Nucleotide transport and metabolism [F]	0.91
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.91
COG3004	Na+/H+ antiporter NhaA	Energy production and conversion [C]	0.91
COG3263	NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains	Energy production and conversion [C]	0.91
COG4651	Predicted Kef-type K+ transport protein, K+/H+ antiporter domain	Inorganic ion transport and metabolism [P]	0.91

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.27 %
Unclassified	root	N/A	2.73 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.27 %
Unclassified	root	N/A	2.73 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	97.27 %
Unclassified	root	N/A	2.73 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	71.82 %
Unclassified	root	N/A	2.73 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.82 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	13.64 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	11.82 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	11.82 %
Unclassified	root	N/A	2.73 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.91 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.73 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	11.82 %
Unclassified	root	N/A	2.73 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	1.82 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %
Acidobacteria bacterium 13_1_40CM_3_55_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6	0.91 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	11.82 %
Unclassified	root	N/A	2.73 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1.82 %
Bacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %
Acidobacteria bacterium 13_1_40CM_3_55_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	11.82 %
Unclassified	root	N/A	2.73 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	1.82 %
Paenibacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %
Acidobacteria bacterium 13_1_40CM_3_55_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	11.82 %
Unclassified	root	N/A	2.73 %
Acidobacteriaceae bacterium KBS 89	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	0.91 %
Aneurinibacillus group	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Aneurinibacillus group	0.91 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %
Acidobacteria bacterium 13_1_40CM_3_55_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	11.82 %
Unclassified	root	N/A	2.73 %
Ammoniphilus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Aneurinibacillus group → Ammoniphilus	0.91 %
Acidobacteriaceae bacterium KBS 89	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	0.91 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %
Acidobacteria bacterium 13_1_40CM_3_55_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	12.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	11.82 %
Unclassified	root	N/A	2.73 %
Ammoniphilus resinae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Aneurinibacillus group → Ammoniphilus → Ammoniphilus resinae	0.91 %
Acidobacteriaceae bacterium KBS 89	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	0.91 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.91 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.91 %
Acidobacteria bacterium 13_1_40CM_3_55_6	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6	0.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090014\|GPIPI_17429696	All Organisms → cellular organisms → Bacteria → Acidobacteria	1781	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104649426	All Organisms → cellular organisms → Bacteria	738	Open in IMG/M
3300000789\|JGI1027J11758_12211335	All Organisms → cellular organisms → Bacteria → Acidobacteria	879	Open in IMG/M
3300002407\|C687J29651_10138193	All Organisms → cellular organisms → Bacteria	798	Open in IMG/M
3300004782\|Ga0062382_10505960	All Organisms → cellular organisms → Bacteria	582	Open in IMG/M
3300005166\|Ga0066674_10082689	All Organisms → cellular organisms → Bacteria	1479	Open in IMG/M
3300005171\|Ga0066677_10552135	All Organisms → cellular organisms → Bacteria → Acidobacteria	659	Open in IMG/M
3300005187\|Ga0066675_11421763	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	508	Open in IMG/M
3300005340\|Ga0070689_100335074	All Organisms → cellular organisms → Bacteria	1266	Open in IMG/M
3300005343\|Ga0070687_100896251	All Organisms → cellular organisms → Bacteria → Acidobacteria	636	Open in IMG/M
3300005355\|Ga0070671_101535479	All Organisms → cellular organisms → Bacteria → Acidobacteria	590	Open in IMG/M
3300005436\|Ga0070713_101482204	All Organisms → cellular organisms → Bacteria → Acidobacteria	658	Open in IMG/M
3300005439\|Ga0070711_100922679	All Organisms → cellular organisms → Bacteria	746	Open in IMG/M
3300005440\|Ga0070705_100699089	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	796	Open in IMG/M
3300005441\|Ga0070700_100182677	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	1461	Open in IMG/M
3300005441\|Ga0070700_100326745	All Organisms → cellular organisms → Bacteria	1129	Open in IMG/M
3300005444\|Ga0070694_101480889	All Organisms → cellular organisms → Bacteria → Acidobacteria	574	Open in IMG/M
3300005451\|Ga0066681_10660606	All Organisms → cellular organisms → Bacteria → Acidobacteria	639	Open in IMG/M
3300005466\|Ga0070685_10845364	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	678	Open in IMG/M
3300005518\|Ga0070699_101316905	All Organisms → cellular organisms → Bacteria → Acidobacteria	662	Open in IMG/M
3300005543\|Ga0070672_101135615	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	695	Open in IMG/M
3300005546\|Ga0070696_101639146	All Organisms → cellular organisms → Bacteria → Acidobacteria	553	Open in IMG/M
3300005556\|Ga0066707_10347029	All Organisms → cellular organisms → Bacteria	971	Open in IMG/M
3300005563\|Ga0068855_102054270	All Organisms → cellular organisms → Bacteria	576	Open in IMG/M
3300005568\|Ga0066703_10877249	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300005598\|Ga0066706_10337591	All Organisms → cellular organisms → Bacteria	1193	Open in IMG/M
3300005617\|Ga0068859_100543267	All Organisms → cellular organisms → Bacteria → Acidobacteria	1257	Open in IMG/M
3300005719\|Ga0068861_101781296	All Organisms → cellular organisms → Bacteria → Acidobacteria	610	Open in IMG/M
3300005842\|Ga0068858_102033287	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	568	Open in IMG/M
3300005844\|Ga0068862_100510829	All Organisms → cellular organisms → Bacteria	1142	Open in IMG/M
3300006046\|Ga0066652_100534480	All Organisms → cellular organisms → Bacteria → Acidobacteria	1095	Open in IMG/M
3300006046\|Ga0066652_100908917	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	839	Open in IMG/M
3300006046\|Ga0066652_101519555	All Organisms → cellular organisms → Bacteria → Acidobacteria	620	Open in IMG/M
3300006871\|Ga0075434_100579874	All Organisms → cellular organisms → Bacteria → Acidobacteria	1141	Open in IMG/M
3300006871\|Ga0075434_101093830	All Organisms → cellular organisms → Bacteria	810	Open in IMG/M
3300006876\|Ga0079217_11723508	All Organisms → cellular organisms → Bacteria → Acidobacteria	505	Open in IMG/M
3300007258\|Ga0099793_10447144	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300009089\|Ga0099828_11054930	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	723	Open in IMG/M
3300009098\|Ga0105245_11699316	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	683	Open in IMG/M
3300009137\|Ga0066709_102517444	All Organisms → cellular organisms → Bacteria → Acidobacteria	693	Open in IMG/M
3300009147\|Ga0114129_10408772	All Organisms → cellular organisms → Bacteria	1788	Open in IMG/M
3300009147\|Ga0114129_12569555	All Organisms → cellular organisms → Bacteria → Acidobacteria	608	Open in IMG/M
3300009147\|Ga0114129_12865457	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	571	Open in IMG/M
3300009148\|Ga0105243_11077627	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	810	Open in IMG/M
3300009176\|Ga0105242_11563871	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	692	Open in IMG/M
3300009177\|Ga0105248_12778819	All Organisms → cellular organisms → Bacteria → Acidobacteria	558	Open in IMG/M
3300009553\|Ga0105249_10066014	All Organisms → cellular organisms → Bacteria → Acidobacteria	3330	Open in IMG/M
3300010159\|Ga0099796_10296267	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	684	Open in IMG/M
3300010301\|Ga0134070_10192329	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	746	Open in IMG/M
3300010304\|Ga0134088_10510747	All Organisms → cellular organisms → Bacteria → Acidobacteria	592	Open in IMG/M
3300010371\|Ga0134125_11398489	Not Available	763	Open in IMG/M
3300010371\|Ga0134125_13048214	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	508	Open in IMG/M
3300010397\|Ga0134124_11029420	All Organisms → cellular organisms → Bacteria → Acidobacteria	837	Open in IMG/M
3300010399\|Ga0134127_13176915	All Organisms → cellular organisms → Bacteria → Acidobacteria	537	Open in IMG/M
3300010399\|Ga0134127_13454950	All Organisms → cellular organisms → Bacteria → Acidobacteria	517	Open in IMG/M
3300011119\|Ga0105246_11039972	All Organisms → cellular organisms → Bacteria → Acidobacteria	744	Open in IMG/M
3300012021\|Ga0120192_10069435	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	664	Open in IMG/M
3300012198\|Ga0137364_11360446	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	527	Open in IMG/M
3300012202\|Ga0137363_11124884	Not Available	668	Open in IMG/M
3300012351\|Ga0137386_10475877	All Organisms → cellular organisms → Bacteria → Acidobacteria	900	Open in IMG/M
3300012354\|Ga0137366_11109371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Aneurinibacillus group → Ammoniphilus → Ammoniphilus resinae	544	Open in IMG/M
3300012530\|Ga0136635_10217966	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	656	Open in IMG/M
3300012532\|Ga0137373_10558728	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_3_55_6	867	Open in IMG/M
3300012582\|Ga0137358_10986465	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	546	Open in IMG/M
3300012681\|Ga0136613_10306654	All Organisms → cellular organisms → Bacteria	880	Open in IMG/M
3300012683\|Ga0137398_10578930	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	775	Open in IMG/M
3300012896\|Ga0157303_10286876	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	519	Open in IMG/M
3300012937\|Ga0162653_100058518	All Organisms → cellular organisms → Bacteria → Acidobacteria	607	Open in IMG/M
3300012944\|Ga0137410_11491307	All Organisms → cellular organisms → Bacteria	590	Open in IMG/M
3300012948\|Ga0126375_10269122	All Organisms → cellular organisms → Bacteria	1165	Open in IMG/M
3300012948\|Ga0126375_11149247	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	643	Open in IMG/M
3300012987\|Ga0164307_11912033	All Organisms → cellular organisms → Bacteria → Acidobacteria	503	Open in IMG/M
3300013297\|Ga0157378_11477764	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	724	Open in IMG/M
3300013306\|Ga0163162_11246279	All Organisms → cellular organisms → Bacteria → Acidobacteria	844	Open in IMG/M
3300013308\|Ga0157375_11200939	All Organisms → cellular organisms → Bacteria → Acidobacteria	890	Open in IMG/M
3300014157\|Ga0134078_10032317	All Organisms → cellular organisms → Bacteria → Acidobacteria	1726	Open in IMG/M
3300014157\|Ga0134078_10672512	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	504	Open in IMG/M
3300014326\|Ga0157380_12529952	All Organisms → cellular organisms → Bacteria → Acidobacteria	579	Open in IMG/M
3300015245\|Ga0137409_10716255	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	835	Open in IMG/M
3300015253\|Ga0180081_1087597	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	563	Open in IMG/M
3300015371\|Ga0132258_10517634	All Organisms → cellular organisms → Bacteria → Acidobacteria	2986	Open in IMG/M
3300018028\|Ga0184608_10382165	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300018071\|Ga0184618_10505281	All Organisms → cellular organisms → Bacteria → Acidobacteria	506	Open in IMG/M
3300018084\|Ga0184629_10122958	All Organisms → cellular organisms → Bacteria	1293	Open in IMG/M
3300018429\|Ga0190272_10601714	All Organisms → cellular organisms → Bacteria → Acidobacteria	964	Open in IMG/M
3300018466\|Ga0190268_11209631	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	627	Open in IMG/M
3300018469\|Ga0190270_11966154	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300018920\|Ga0190273_10031520	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2505	Open in IMG/M
3300018920\|Ga0190273_10408916	All Organisms → cellular organisms → Bacteria	958	Open in IMG/M
3300019487\|Ga0187893_10265006	All Organisms → cellular organisms → Bacteria	1252	Open in IMG/M
3300019767\|Ga0190267_10966806	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	593	Open in IMG/M
3300025936\|Ga0207670_10638144	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	877	Open in IMG/M
3300025941\|Ga0207711_11670881	All Organisms → cellular organisms → Bacteria → Acidobacteria	580	Open in IMG/M
3300025941\|Ga0207711_12111229	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	506	Open in IMG/M
3300025949\|Ga0207667_11579830	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	625	Open in IMG/M
3300026023\|Ga0207677_11090926	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	727	Open in IMG/M
3300026089\|Ga0207648_10565185	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1046	Open in IMG/M
3300026142\|Ga0207698_11842249	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	620	Open in IMG/M
3300026142\|Ga0207698_12669605	Not Available	508	Open in IMG/M
3300026296\|Ga0209235_1060510	All Organisms → cellular organisms → Bacteria	1772	Open in IMG/M
3300026318\|Ga0209471_1086338	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89	1377	Open in IMG/M
3300026318\|Ga0209471_1123005	All Organisms → cellular organisms → Bacteria → Acidobacteria	1102	Open in IMG/M
3300026332\|Ga0209803_1159973	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	864	Open in IMG/M
3300027681\|Ga0208991_1227013	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300027691\|Ga0209485_1019836	All Organisms → cellular organisms → Bacteria → Acidobacteria	1529	Open in IMG/M
3300027876\|Ga0209974_10335241	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	584	Open in IMG/M
3300028047\|Ga0209526_10136107	All Organisms → cellular organisms → Bacteria	1723	Open in IMG/M
3300032179\|Ga0310889_10653125	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	546	Open in IMG/M
3300033004\|Ga0335084_11270045	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	734	Open in IMG/M
3300034172\|Ga0334913_066619	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	759	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	71.82%
Host-Associated	Host-Associated	28.18%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	65.45%
Plants	Host-Associated → Plants	28.18%
Aquatic	Environmental → Aquatic	6.36%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	63.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.36%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.82%
Sediment	Environmental → Aquatic → Sediment	3.64%
Freshwater	Environmental → Aquatic → Freshwater	2.73%
Cave	Environmental → Terrestrial → Cave	0.91%
Agricultural Field	Environmental → Terrestrial → Agricultural Field	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	48.18%
Loam	Environmental → Terrestrial → Soil → Loam	14.55%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.55%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.91%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.64%
Ice	Environmental → Aquatic → Freshwater → Ice	1.82%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.82%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.91%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.09%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	15.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.91%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.64%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.82%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.91%
Desert	Environmental → Terrestrial → Soil → Unclassified → Desert	0.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.91%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.91%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.91%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.91%
Unclassified	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	13.64%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	10.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.27%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.27%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.55%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.55%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	3.64%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.64%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.64%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.64%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.73%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.82%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.82%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.82%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.82%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.82%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.91%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.91%
Terrestrial	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial	0.91%
Sub-Biocrust Soil	Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.91%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	0.91%
Soil	Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil	0.91%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.91%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090014	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300002407	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1	Environmental	Open in IMG/M
3300004782	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh	Environmental	Open in IMG/M
3300005166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012021	Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012530	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)	Environmental	Open in IMG/M
3300012532	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012681	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)	Environmental	Open in IMG/M
3300012683	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG	Environmental	Open in IMG/M
3300012896	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2	Environmental	Open in IMG/M
3300012937	Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300015253	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10D	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018466	Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018920	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300019767	Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026296	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300027681	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027691	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)	Environmental	Open in IMG/M
3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)	Host-Associated	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300032179	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300034172	Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 9HMS	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPIPI_03862120	2088090014	Soil	VIPSRRRSIQXLRESDSIAAALNSMSIGRYRHIPVQKSDGSYYVTSIKHVLKYLARSEW
INPhiseqgaiiFebDRAFT_1046494262	3300000364	Soil	NKMSLGRYRRIPYQKSDGSFSVATIRSVLKYIAQEDW*
JGI1027J11758_122113351	3300000789	Soil	TAVXDLMTSXPEXLHEXDSVAAALNXMSMGRYRHIPVKXHDGSYIVTSIKSVLIYIAKEDW*
C687J29651_101381931	3300002407	Soil	DSVATALNKMYLGRYRHIPVLKGDGSYRVTSIKSVLKYIAGEDW*
Ga0062382_105059601	3300004782	Wetland Sediment	EKDSVATAVNKMSMGRYRHIPVRKTDGSYSVISIKHVLKYIAKAKW*
Ga0066674_100826893	3300005166	Soil	GKDARPDHTTVKELMSPDPEILSERDSVATAVNKMSLGRYRHIPVRKADGSYSFTSIKHVLKYIAKANW*
Ga0066677_105521351	3300005171	Soil	FLRETDSVATAVNKMSMGRYRHIPIYKGDGTYSVTSIKHVLKYIAKAEW*
Ga0066675_114217632	3300005187	Soil	SVATALNKMSMGRYRHIPVEKSDGAYSVTSIKHVLKYLAKANW*
Ga0070689_1003350742	3300005340	Switchgrass Rhizosphere	SADPGTLDESNSVAEALNKMSLGRYRHLPYRKADGSYAVASIQSVLKYIAQEDW*
Ga0070687_1008962512	3300005343	Switchgrass Rhizosphere	SANPEVLRETDSIAIALNKMSIGRYRHIPVQKADGSYCVTSIKHVLKHLARSQW*
Ga0070671_1015354792	3300005355	Switchgrass Rhizosphere	ANPEILRDTDSVATALNKMSMGRYRHIPVRRADGSYGVTSIKHVLKYLAQAEW*
Ga0070713_1014822042	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	ALNKMSMGRYRHIPVQKSDGSYCVTSIKHVLKYLARSQW*
Ga0070711_1009226791	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	LNETDSVATAVNKMSMGRYRHIPIRKADGSYSVISIKHVLKYIAKAEW*
Ga0070705_1006990891	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	LNETDSVAAALNKMSLGRYRHIPVARNDGSYAVISIKNVLKYIAQENW*
Ga0070700_1001826771	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	TALSKMSLGRYRHIPVVKADGSYAVTSIKHVLKYIAKEDW*
Ga0070700_1003267451	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	PEMLRETDSVATALNKMSMGRYRHIPVRKADGTFVVTSIKHVLKYIAKEDW*
Ga0070694_1014808891	3300005444	Corn, Switchgrass And Miscanthus Rhizosphere	AIALNKMSIGRFRHIPVQKADGSYCVTSIKHVLKHLARSQW*
Ga0066681_106606062	3300005451	Soil	EVLSETDSVATALNKMSMGRYRHIPLQKADGSYAVTSIKHVLKYIAKEEW*
Ga0070685_108453642	3300005466	Switchgrass Rhizosphere	RYRHLPFRKADGSFAVASIQSVLKYIAQEDWTRPAFPS
Ga0070699_1013169051	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	AAALNKMSLGRYRHIPLRKADGSYSVTSIKHVLKYIAKAKW*
Ga0070672_1011356151	3300005543	Miscanthus Rhizosphere	KMSMGRYRHIPVVKNDGTYSVTSIKHVLRYIAKETW*
Ga0070696_1016391461	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	DSVAVALNKMSLGGFRHIPVVRKDRSYTVVSIKNVLDYIARADW*
Ga0066707_103470291	3300005556	Soil	ANPETLHETDSVATALNKMSMGRYRHIPVQKSDGGYSVTSIKHVLKYIAKANW*
Ga0068855_1020542701	3300005563	Corn Rhizosphere	SLGRYRHVPFKRIDGTYAVASIRSVLKYIAREDW*
Ga0066703_108772491	3300005568	Soil	ETDSVATALNKMSMGRYRHIPVQKSDGTYCVTSIKHVLKYLAKAEW*
Ga0066706_103375913	3300005598	Soil	PETLHETDSVATALNKMSMGRYRHIPVRKSDGAYSVTSIKHVLKYIAKANW*
Ga0068859_1005432672	3300005617	Switchgrass Rhizosphere	AALNKMSLGRYRHIPVQRADGTFCVTSIKHVLQYLARSQW*
Ga0068861_1017812961	3300005719	Switchgrass Rhizosphere	IAAALNKMSLGRYRHLPVIKHDGNYFVTSIKSVLQYIAREDW*
Ga0068858_1020332871	3300005842	Switchgrass Rhizosphere	LNKMSLGRYRHIPFKKADGTYAVASIKSVLKYIAQEDW*
Ga0068862_1005108291	3300005844	Switchgrass Rhizosphere	ETLNETDSVAEALNRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW*
Ga0066652_1005344801	3300006046	Soil	SDSVATAVNKMSMGPYRHIPVRRADGSYSVTSIKHVLKYIAREEW*
Ga0066652_1009089173	3300006046	Soil	NKMSMGRYRHIPVQKSDGAYSVTSIKHVLKYIAKADW*
Ga0066652_1015195551	3300006046	Soil	MSMGRYRHIPIYKGDGTYSVTSIKHVLKYIAKEEWSLAT*
Ga0075434_1005798742	3300006871	Populus Rhizosphere	PEALRETDSVAVALNKMSMGHYRHIPVQMSDGSYCVTSIRHVLKYLARSQW*
Ga0075434_1010938302	3300006871	Populus Rhizosphere	ETDSVATALNKMSMGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0079217_117235082	3300006876	Agricultural Soil	SVATALSKMSLGRYRHIPVKKIDGTYAVTSIKHVLKYIAKEDW*
Ga0099793_104471441	3300007258	Vadose Zone Soil	NPEVLDETDSVAEALNKMSLGRYRHIPFKKSDGTYSVASIKSVLKYIAQEDW*
Ga0099828_110549302	3300009089	Vadose Zone Soil	ATALNKMSMGRYRHIPIRKADGSYSVTSIKHVLKYIAKAEW*
Ga0105245_116993161	3300009098	Miscanthus Rhizosphere	HERDSVAEALNKMSLGRYRHIPFKKADGTHAAASIKSVLKYIAQEDW*
Ga0066709_1025174442	3300009137	Grasslands Soil	MSMGRYRHIPLQKADGSYAVTSIKHVLKYIAKEEW*
Ga0114129_104087725	3300009147	Populus Rhizosphere	SIGRYRHIPVMKNDGSYSVISIKNVLKYIAKENW*
Ga0114129_125695551	3300009147	Populus Rhizosphere	QLMSTNPEVLLDTDSVAVAVNKMSLGRYRHIPVQKSDGTYCVTSIKHVLKHLARSEW*
Ga0114129_128654572	3300009147	Populus Rhizosphere	HKMSTGRYRHIPVRKADGSYTVASIKSVLKYIAQEDW*
Ga0105243_110776271	3300009148	Miscanthus Rhizosphere	NKMSLGRYRHLPILKNDGGYSVTSIKSVLQYIAREDW*
Ga0105242_115638711	3300009176	Miscanthus Rhizosphere	HERDSVAEALNKMSLGRYRHIPFKKADGTYAVASIKSVLKYIAQEDW*
Ga0105248_127788193	3300009177	Switchgrass Rhizosphere	EVLLETDSIAAALNKMSMGRYRHIPVQKSDGTFCVTSIKHVLKYLARSQW*
Ga0105249_100660141	3300009553	Switchgrass Rhizosphere	TALNKMSLGRYRHIPVVKADGTYSVTSIKHVLRYIAKETW*
Ga0099796_102962672	3300010159	Vadose Zone Soil	PEVLTDRDSVATAVNKMSIGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0134070_101923291	3300010301	Grasslands Soil	ETLHETDSVATALNKMSMGRYRHIPVRKSDGAYSVTSIKHVLKYIAKANW*
Ga0134088_105107471	3300010304	Grasslands Soil	SDSVATALNKMSMGRYRHIPIQKFDGSYAVTSIKHVLKYIAKEDW*
Ga0134125_113984891	3300010371	Terrestrial Soil	EALNKMSLGRYRHLPFKKADGSYAVASIQSVLRYIAQEDW*
Ga0134125_130482141	3300010371	Terrestrial Soil	NAAGIAVKELMSPNPEALDETNSVAEALNKMSLGRYRHLPFRKADGSYAVASIQSVLQYIAQEDW*
Ga0134124_110294201	3300010397	Terrestrial Soil	SVATALNKMSMGHYRHIPVQNSDGSYCVTSIKHVLKYLAKAEW*
Ga0134127_131769151	3300010399	Terrestrial Soil	LMSANPEVLRETDSIAVALNKMSLGRYRHIPVQKSDGSYCVTSIKHVLKHLARSQW*
Ga0134127_134549502	3300010399	Terrestrial Soil	ATALNKMSMGRYRHIPIQRADGTYCVTSIKHVLKYLARSEW*
Ga0105246_110399721	3300011119	Miscanthus Rhizosphere	TDSVAVALNKMSMGHYRHIPVEMSDGSYCVTSIRHVLKYLARSQW*
Ga0120192_100694353	3300012021	Terrestrial	ENPETLHEQDSWATALNRMSTGRYRHIPVRKADGTHMVASINSVLRYIAKEDW*
Ga0137364_113604462	3300012198	Vadose Zone Soil	LMSIFPEVLSERDSVATAVNKMSMGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0137363_111248841	3300012202	Vadose Zone Soil	TALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW*
Ga0137386_104758772	3300012351	Vadose Zone Soil	VRELMSANPEVLSETDSVATALNKMSMGRYRHSPVQKADGSYSGTSIKHVLKYIAKEEW*
Ga0137366_111093712	3300012354	Vadose Zone Soil	ALNKMSMGRYRHIPVQKADGSYSVTSIKHVLKYIAKEEW*
Ga0136635_102179661	3300012530	Polar Desert Sand	TLRETDSVASALNKMAMGRYRHVPVARTGGGYSVASIKSVLKYIAQEDW*
Ga0137373_105587281	3300012532	Vadose Zone Soil	NKMSMGRYRHIPVKKSDGTYCVTSIKHVLKYIAKEDW*
Ga0137358_109864652	3300012582	Vadose Zone Soil	ETDSVATALNKMSMGRYRHIPVRKADGSYSVTSIKHVIKYIAKAEW*
Ga0136613_103066541	3300012681	Polar Desert Sand	ALNKMALGRYRHVPIARRDGGYSVASIKSVLKYIAREDW*
Ga0137398_105789302	3300012683	Vadose Zone Soil	LMSLNPEILSETDSVATAVNKMSMGRYRHIPVRKADGSYSVISIKHVLKYIAKAEW*
Ga0157303_102868762	3300012896	Soil	TAVNKMSMGRYRHIPVRKADGTYSVTSIKHVLKYIAKAEW*
Ga0162653_1000585182	3300012937	Soil	IVVAFSVAVALNKMSMGHYRHIPVEMSDGSYCVTSIRHVLKYLARSQW*
Ga0137410_114913071	3300012944	Vadose Zone Soil	NKMSLGRYRHIPFQRSDGSYAVASIKSVLKYIAQEDW*
Ga0126375_102691221	3300012948	Tropical Forest Soil	LRDTDSVATALNKMSLGRYRHIPVRKGDGSYSVTSIKHVLKYIAKAEW*
Ga0126375_111492472	3300012948	Tropical Forest Soil	SLGRYRHIPVRKADGSYCVTSIKHVLKYIAKAEW*
Ga0164307_119120332	3300012987	Soil	MSIGRYRHIPVQRADGSYCVTSIKHVLKHLARSQW*
Ga0157378_114777642	3300013297	Miscanthus Rhizosphere	LHETDSVAEALNKMSLGRYRHIPYLKSDGTYAVASIKSVLKYIAQEDW*
Ga0163162_112462791	3300013306	Switchgrass Rhizosphere	AAALNKMSMGRYRHIPVQKSDGSYCVTSIKHVLKYLARSQW*
Ga0157375_112009391	3300013308	Miscanthus Rhizosphere	MSMGRYRHIPVQKSDGTFCVTSIKHVLKYLARSRW*
Ga0134078_100323171	3300014157	Grasslands Soil	DSVATALNKMSMGRYRHIPVQKSDGAYSVTSIKHVLKYIAKANW*
Ga0134078_106725122	3300014157	Grasslands Soil	SPDPEILSERDSVATAVNKMSLGRYRHIPVRKADGSYSVTSIKHVLKYIAKANW*
Ga0157380_125299521	3300014326	Switchgrass Rhizosphere	LNRMSVGRYRHLPVIKSDGSYTVASIKSVLNYIAKEDW*
Ga0137409_107162551	3300015245	Vadose Zone Soil	MFPEVLSDRDSVATAVNKMSIGRYRHIPVRKADGSYSVTSIKHVLKYIAKAEW*
Ga0180081_10875972	3300015253	Soil	MSIGRYRHIPVLKADGSYSVTSIKHVLKYIAKADW*
Ga0132258_105176344	3300015371	Arabidopsis Rhizosphere	ALNKMAMGRYRHIPVLKNDGNYAVISIKNVLKYIAQENW*
Ga0184608_103821653	3300018028	Groundwater Sediment	MSLGRYRHIPFKKVDGSYAVASIQSVLKYIAQEDW
Ga0184618_105052811	3300018071	Groundwater Sediment	ETDSVATAVNKMSMGRYRHIPLRKADGSYSVTSIKHVLKYIAKAKW
Ga0184629_101229582	3300018084	Groundwater Sediment	NPETLHEEDSVAEALNKMSLGRYRHVPFKRIDGTYAVASIKSVLKYIAKEDW
Ga0190272_106017141	3300018429	Soil	HESIAFALNKMSIGRYRHIPIEREDGSYTVASIKSVLNYIAQEDW
Ga0190268_112096311	3300018466	Soil	EHDSVAAALNKMSLGKYRHLPVKRADGSYAVASIKSVLKYIAAEDW
Ga0190270_119661542	3300018469	Soil	VKELMSANPESLDETSSVAEALNKMSLGRYRHIPFKKADGGYAVASIQSVLRYIAQEDW
Ga0190273_100315204	3300018920	Soil	NSIAEALNKMSLGRYRHIPFKKADGSYAVASIQSVLKYIAQEDW
Ga0190273_104089162	3300018920	Soil	KMAMGRYRHVPIVRDDGGYSIASIKSVLKYIAQEDW
Ga0187893_102650062	3300019487	Microbial Mat On Rocks	LNRMSIGRFRHIPVVKQDGSYGVISIKNVLKYIAREDW
Ga0190267_109668062	3300019767	Soil	AALNKMAMGRYRHVPIARNDGSYSVASIKSVLRYIAQEEW
Ga0207670_106381441	3300025936	Switchgrass Rhizosphere	NRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW
Ga0207711_116708812	3300025941	Switchgrass Rhizosphere	ANPEVLRETDSIAIALNKMSIGRYRHIPVQKADGSYCVTSIKHVLKHLARSQW
Ga0207711_121112292	3300025941	Switchgrass Rhizosphere	SVATALNKMSMGRYRHIPVRRADGSYGVTSIKHVLKYLAQAEW
Ga0207667_115798301	3300025949	Corn Rhizosphere	HEEDSVAEALNKMSLGRYRHVPFKRIDGTYAVASIRSVLKYIAREDW
Ga0207677_110909261	3300026023	Miscanthus Rhizosphere	NKMSLGRYRHLPFRKADGSFAVASIQSVLKYIALEDW
Ga0207648_105651852	3300026089	Miscanthus Rhizosphere	SVAEALNKMSLGRFRHIPFKKADGTYAVASIRSVLKYIAREDW
Ga0207698_118422492	3300026142	Corn Rhizosphere	EALNRMSMGRYRHLPFRKADGSFAVASIQSVLKYIAQEDW
Ga0207698_126696052	3300026142	Corn Rhizosphere	TNSVAEALNKMSLGRYRHLPFKKADGSYAVASIQSVLRYIAQEDW
Ga0209235_10605103	3300026296	Grasslands Soil	KMSLGRYRHIPVTRKDGSYSVTSIKSVLKYIAREDW
Ga0209471_10863381	3300026318	Soil	SVATAVNKMSMGRYRHIPVEKSDGAYSVTSIKHVLKYLAKANW
Ga0209471_11230052	3300026318	Soil	DSVATALNKMSMGRYRHIPVLKADGTYAVTSIKHVLRYIAKENW
Ga0209803_11599731	3300026332	Soil	EMLKETDSVATALNKMSMGRYRHIPVQKSDGSYSVTSIKHVLKYIAKEDW
Ga0208991_12270131	3300027681	Forest Soil	DSVAAALSKMSLGRYRHLPVARQDGGYSVTSIKSVLKYLAKKDW
Ga0209485_10198362	3300027691	Agricultural Soil	EYDSVATALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW
Ga0209974_103352411	3300027876	Arabidopsis Thaliana Rhizosphere	TALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW
Ga0209526_101361071	3300028047	Forest Soil	LNKMSMGRYRHIPITHKDGSYSVTSIKNVLQYIGREDW
Ga0310889_106531251	3300032179	Soil	EVLHEYDSVATALNKMSIGRYRHIPVKKNDGSFTVTSIKSVLNYIAKEDW
Ga0335084_112700452	3300033004	Soil	DLMSVNPEFLRDTDSVATALNKMSMGRYRHIPVRKADGSYCVTSIKHVLKYIAKAEW
Ga0334913_066619_650_757	3300034172	Sub-Biocrust Soil	MAMGRYRHVPVAENDGSYSVTSIKHVLKYIAQEDW

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F086718

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences