| Basic Information | |
|---|---|
| Family ID | F086715 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MNQLSEILDEKGHDVLRIEADASVFEAVKRMVEANVGSL |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 92.45 % |
| % of genes near scaffold ends (potentially truncated) | 94.55 % |
| % of genes from short scaffolds (< 2000 bps) | 84.55 % |
| Associated GOLD sequencing projects | 92 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.455 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (28.182 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.909 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF04828 | GFA | 6.36 |
| PF00903 | Glyoxalase | 3.64 |
| PF00248 | Aldo_ket_red | 2.73 |
| PF00132 | Hexapep | 2.73 |
| PF12833 | HTH_18 | 1.82 |
| PF00291 | PALP | 1.82 |
| PF07883 | Cupin_2 | 1.82 |
| PF08241 | Methyltransf_11 | 1.82 |
| PF12681 | Glyoxalase_2 | 1.82 |
| PF00571 | CBS | 1.82 |
| PF00196 | GerE | 1.82 |
| PF02777 | Sod_Fe_C | 0.91 |
| PF00717 | Peptidase_S24 | 0.91 |
| PF08031 | BBE | 0.91 |
| PF02683 | DsbD | 0.91 |
| PF12900 | Pyridox_ox_2 | 0.91 |
| PF06293 | Kdo | 0.91 |
| PF09995 | MPAB_Lcp_cat | 0.91 |
| PF00990 | GGDEF | 0.91 |
| PF00574 | CLP_protease | 0.91 |
| PF00480 | ROK | 0.91 |
| PF07676 | PD40 | 0.91 |
| PF00753 | Lactamase_B | 0.91 |
| PF00932 | LTD | 0.91 |
| PF08240 | ADH_N | 0.91 |
| PF01544 | CorA | 0.91 |
| PF10502 | Peptidase_S26 | 0.91 |
| PF01370 | Epimerase | 0.91 |
| PF03450 | CO_deh_flav_C | 0.91 |
| PF13011 | LZ_Tnp_IS481 | 0.91 |
| PF01434 | Peptidase_M41 | 0.91 |
| PF00106 | adh_short | 0.91 |
| PF03816 | LytR_cpsA_psr | 0.91 |
| PF04851 | ResIII | 0.91 |
| PF01177 | Asp_Glu_race | 0.91 |
| PF05593 | RHS_repeat | 0.91 |
| PF00140 | Sigma70_r1_2 | 0.91 |
| PF00175 | NAD_binding_1 | 0.91 |
| PF12680 | SnoaL_2 | 0.91 |
| PF02872 | 5_nucleotid_C | 0.91 |
| PF00156 | Pribosyltran | 0.91 |
| PF07992 | Pyr_redox_2 | 0.91 |
| PF04191 | PEMT | 0.91 |
| PF00463 | ICL | 0.91 |
| PF01980 | TrmO | 0.91 |
| PF08327 | AHSA1 | 0.91 |
| PF13515 | FUSC_2 | 0.91 |
| PF06925 | MGDG_synth | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 6.36 |
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.82 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.82 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.91 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.91 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.91 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG0737 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family | Defense mechanisms [V] | 0.91 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.91 |
| COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 0.91 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.91 |
| COG2224 | Isocitrate lyase | Energy production and conversion [C] | 0.91 |
| COG3209 | Uncharacterized conserved protein RhaS, contains 28 RHS repeats | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.36 % |
| Unclassified | root | N/A | 23.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918013|NODE_8381_length_1254_cov_4.702552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1286 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0404283 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300000550|F24TB_10032452 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300000955|JGI1027J12803_107724506 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300000956|JGI10216J12902_103244889 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300001538|A10PFW1_11535286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Trinickia → Trinickia symbiotica | 505 | Open in IMG/M |
| 3300003659|JGI25404J52841_10126075 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300003996|Ga0055467_10233035 | Not Available | 576 | Open in IMG/M |
| 3300005165|Ga0066869_10090864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
| 3300005171|Ga0066677_10677755 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005435|Ga0070714_102448386 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300005553|Ga0066695_10357737 | Not Available | 914 | Open in IMG/M |
| 3300005764|Ga0066903_101751962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1185 | Open in IMG/M |
| 3300005840|Ga0068870_10666723 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300006049|Ga0075417_10595993 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006871|Ga0075434_101570861 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300006903|Ga0075426_10439137 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300006969|Ga0075419_10685923 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300009137|Ga0066709_102588522 | Not Available | 680 | Open in IMG/M |
| 3300009137|Ga0066709_104436609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009147|Ga0114129_10362126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1919 | Open in IMG/M |
| 3300009147|Ga0114129_11890518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300009162|Ga0075423_10242542 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300009162|Ga0075423_10685797 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300009840|Ga0126313_10049433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → unclassified Catenulispora → Catenulispora sp. 13_1_20CM_3_70_7 | 2959 | Open in IMG/M |
| 3300010323|Ga0134086_10359061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 578 | Open in IMG/M |
| 3300010430|Ga0118733_101995229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Wenzhouxiangellaceae → Wenzhouxiangella → Wenzhouxiangella marina | 1153 | Open in IMG/M |
| 3300011271|Ga0137393_11472019 | Not Available | 570 | Open in IMG/M |
| 3300011987|Ga0120164_1066325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300012201|Ga0137365_10748457 | Not Available | 714 | Open in IMG/M |
| 3300012204|Ga0137374_10503626 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
| 3300012350|Ga0137372_10173147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1747 | Open in IMG/M |
| 3300012351|Ga0137386_10841527 | Not Available | 659 | Open in IMG/M |
| 3300012353|Ga0137367_10062394 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300012353|Ga0137367_11169525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 516 | Open in IMG/M |
| 3300012355|Ga0137369_10091189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2526 | Open in IMG/M |
| 3300012355|Ga0137369_10519322 | Not Available | 839 | Open in IMG/M |
| 3300012355|Ga0137369_10555649 | Not Available | 804 | Open in IMG/M |
| 3300012360|Ga0137375_10123451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2583 | Open in IMG/M |
| 3300012360|Ga0137375_11089858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 621 | Open in IMG/M |
| 3300012532|Ga0137373_10752874 | Not Available | 723 | Open in IMG/M |
| 3300012679|Ga0136616_10007765 | All Organisms → cellular organisms → Bacteria | 5588 | Open in IMG/M |
| 3300012904|Ga0157282_10059627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 960 | Open in IMG/M |
| 3300012905|Ga0157296_10002161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2596 | Open in IMG/M |
| 3300012908|Ga0157286_10173496 | Not Available | 706 | Open in IMG/M |
| 3300012913|Ga0157298_10179160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 661 | Open in IMG/M |
| 3300012930|Ga0137407_11010622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300013765|Ga0120172_1156885 | Not Available | 536 | Open in IMG/M |
| 3300013772|Ga0120158_10079037 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 2076 | Open in IMG/M |
| 3300015358|Ga0134089_10326350 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300015359|Ga0134085_10304504 | Not Available | 701 | Open in IMG/M |
| 3300015372|Ga0132256_100102861 | All Organisms → cellular organisms → Bacteria | 2785 | Open in IMG/M |
| 3300015372|Ga0132256_103921366 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300016270|Ga0182036_10834258 | Not Available | 753 | Open in IMG/M |
| 3300017965|Ga0190266_10781707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 609 | Open in IMG/M |
| 3300018027|Ga0184605_10429218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
| 3300018031|Ga0184634_10490937 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300018061|Ga0184619_10293617 | Not Available | 745 | Open in IMG/M |
| 3300018071|Ga0184618_10004584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 3779 | Open in IMG/M |
| 3300018071|Ga0184618_10370994 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300018433|Ga0066667_11499223 | Not Available | 596 | Open in IMG/M |
| 3300018465|Ga0190269_10371717 | Not Available | 870 | Open in IMG/M |
| 3300018482|Ga0066669_11835615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
| 3300019869|Ga0193705_1091069 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300019884|Ga0193741_1020114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1720 | Open in IMG/M |
| 3300020002|Ga0193730_1158092 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300021080|Ga0210382_10289612 | Not Available | 720 | Open in IMG/M |
| 3300021080|Ga0210382_10323350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 680 | Open in IMG/M |
| 3300021344|Ga0193719_10244028 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300021363|Ga0193699_10331601 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300021510|Ga0222621_1061858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
| 3300022901|Ga0247788_1095445 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300023071|Ga0247752_1094384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300025459|Ga0208689_1016430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2132 | Open in IMG/M |
| 3300026873|Ga0207620_1020471 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300027453|Ga0207624_102219 | Not Available | 943 | Open in IMG/M |
| 3300027667|Ga0209009_1137683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300027873|Ga0209814_10430691 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 581 | Open in IMG/M |
| 3300027876|Ga0209974_10411239 | Not Available | 532 | Open in IMG/M |
| 3300028714|Ga0307309_10135534 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300028744|Ga0307318_10000591 | All Organisms → cellular organisms → Bacteria | 11837 | Open in IMG/M |
| 3300028744|Ga0307318_10177901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300028744|Ga0307318_10308705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300028771|Ga0307320_10012786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3002 | Open in IMG/M |
| 3300028787|Ga0307323_10057200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_4_69_9 | 1379 | Open in IMG/M |
| 3300028787|Ga0307323_10194325 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300028787|Ga0307323_10221045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300028791|Ga0307290_10079311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1193 | Open in IMG/M |
| 3300028793|Ga0307299_10168049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
| 3300028807|Ga0307305_10110205 | Not Available | 1271 | Open in IMG/M |
| 3300028824|Ga0307310_10093419 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300028824|Ga0307310_10138392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1115 | Open in IMG/M |
| 3300028828|Ga0307312_10606725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300028875|Ga0307289_10344492 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300028878|Ga0307278_10079309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1479 | Open in IMG/M |
| 3300028878|Ga0307278_10367199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300028881|Ga0307277_10359285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
| 3300031226|Ga0307497_10685577 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031231|Ga0170824_105153278 | Not Available | 521 | Open in IMG/M |
| 3300031748|Ga0318492_10740878 | Not Available | 527 | Open in IMG/M |
| 3300031938|Ga0308175_103000911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300031965|Ga0326597_10567920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1221 | Open in IMG/M |
| 3300032013|Ga0310906_11103535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 574 | Open in IMG/M |
| 3300032067|Ga0318524_10560870 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300032090|Ga0318518_10279957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
| 3300033550|Ga0247829_10120796 | All Organisms → cellular organisms → Bacteria | 2004 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 28.18% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.73% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.64% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.73% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.82% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.82% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.82% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.82% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.91% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.91% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.91% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.91% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918013 | Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies) | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011987 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0M | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012679 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ299 (21.06) | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026873 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A5-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027453 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-D (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Iowa-Corn-GraphCirc_02678850 | 2140918013 | Soil | MDQVSQILEEKGYDVLQIDAEASVYDAVKQMVAANV |
| ICChiseqgaiiDRAFT_04042831 | 3300000033 | Soil | MNRVSEILGNKGHDVLRIDAGASVLEAVKQMVEANIGS |
| F24TB_100324522 | 3300000550 | Soil | VNRVSEILGDKGHDVLKIEADAPVLEAVKRMVEANV |
| JGI1027J12803_1077245061 | 3300000955 | Soil | VHAVSDILDDKGHEVLQIEADATVHDAVKRMVEAN |
| JGI10216J12902_1032448891 | 3300000956 | Soil | MLLAVHRVGEILKEKGRDLFRIDANASVLEAVKRMVEHNVGSLLVD |
| A10PFW1_115352861 | 3300001538 | Permafrost | MNQLSEILNDVLRIEADASVFEAVKRMVEANVGSLLVTEG |
| JGI25404J52841_101260751 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MGQVSEILDAKGHKVLRIDADASALEAVKQMVAANVGSLLVI |
| Ga0055467_102330352 | 3300003996 | Natural And Restored Wetlands | VDRLSEILGEKGRRVLTIGAEASVFDAVKQMVEANVGALL |
| Ga0063356_1020286781 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MLVASEAGVQMKTLAEILETKGGDVLEIGAEATVLDAVRTMVEMNVGSLLV |
| Ga0066869_100908641 | 3300005165 | Soil | VNRVSEILGDKGRDVLAIDADAPVLEAVRQMVDANVGSLLVKR |
| Ga0066677_106777551 | 3300005171 | Soil | VHLVSDILEGKGREVLEVEADATVLDAVKRMVEANVGSLLV |
| Ga0070714_1024483861 | 3300005435 | Agricultural Soil | MSTVSEILGDKGRDVLKIDAGASVFEAVEQMVAANVGSLLVTDGGDIV |
| Ga0066695_103577371 | 3300005553 | Soil | MNQLLSGILDEKGHDVLQIDADASVFEAVKRMVEA |
| Ga0066903_1017519622 | 3300005764 | Tropical Forest Soil | MSQVSEILSDKGRNVLEIEAGATVREAVRAMVDANVGSLLVTS |
| Ga0068870_106667231 | 3300005840 | Miscanthus Rhizosphere | VNRVSEILGDKGRDVLAIDAGATVLEAVRQMIDANVGSLLVKQDDDV |
| Ga0075417_105959931 | 3300006049 | Populus Rhizosphere | MNHVSEILGDKGRDVLKIDAEASALDAVRQMVGANIGSLLV |
| Ga0075434_1015708612 | 3300006871 | Populus Rhizosphere | MNDQLADILADKGHDVFRIDADASVFEAVKMMVDTNVGSLLVTE |
| Ga0075426_104391371 | 3300006903 | Populus Rhizosphere | VTVNCLAEILDEKGGDVLEISVDTSVLEAVQEMVDHNVGSLLVTDGGE |
| Ga0075419_106859233 | 3300006969 | Populus Rhizosphere | MTVNRLAEILEEKGGDVLEIDGESSVFEAVQQMVENNVG |
| Ga0066709_1025885222 | 3300009137 | Grasslands Soil | VNQLSEILGEKGHHVLEIEADASVFEAVKQMVEANVGSLLVTTRS* |
| Ga0066709_1044366091 | 3300009137 | Grasslands Soil | MNHLSEILEDKGNEVLSIEAEASVFEAVKRMVEANVGSL |
| Ga0114129_103621264 | 3300009147 | Populus Rhizosphere | MKSLAEILEAKGGDVLEIDADATVLDAVRTMVEMNVG |
| Ga0114129_118905182 | 3300009147 | Populus Rhizosphere | MNQVSEILGDKGRDVLKIDAEASALDAVRQMVGANIGSLLVTD |
| Ga0075423_102425421 | 3300009162 | Populus Rhizosphere | LNRVSEILGDKGHDVLEIEADAPVLEAVKRMVDANVGSLLV |
| Ga0075423_106857971 | 3300009162 | Populus Rhizosphere | MNVLAEILEEKGHDVLKIDGEATVLAAVRRMVDANVGSLLVTEGDEI |
| Ga0075423_122828392 | 3300009162 | Populus Rhizosphere | MKSLAEILEAKGGEVLEIDADATVLDAVRTMVEMNVGSLLVT |
| Ga0116128_10255111 | 3300009518 | Peatland | MRDRVSDILGDKSRDVLAIESDASVYDAVKRMVERNVGS |
| Ga0126313_100494331 | 3300009840 | Serpentine Soil | MSQVSEILEAKGHNVLRIDADASILEAVKQMVTANVGSLLV |
| Ga0134086_103590612 | 3300010323 | Grasslands Soil | MGDLSQISEILTEKGRRVLKIDADASVLEAVELMVE |
| Ga0118733_1019952291 | 3300010430 | Marine Sediment | MSKVAEILGGKGRAVFTIEHSDSVFDAVKQMVEKNVGSL |
| Ga0105246_111762472 | 3300011119 | Miscanthus Rhizosphere | VGRVSDILRNKGRDVLKIDATETVFEAIKRMVEANVG |
| Ga0137393_114720191 | 3300011271 | Vadose Zone Soil | MFKGGDMNQLSEILAEKGHDVLRIEADASVFAAVKRMVEANVGSLLVTD |
| Ga0120164_10663251 | 3300011987 | Permafrost | MNQLSEILDEKGHEVLRIEADASVFEAVKRMVEANVGSLP |
| Ga0137365_107484571 | 3300012201 | Vadose Zone Soil | MNKVAEILGDKGHDVLRIDADASVLEAVKRMVEANIGS |
| Ga0137374_105036263 | 3300012204 | Vadose Zone Soil | LNRVSEILGDKGHDVLEIEADAPVLEPVTRMDDANAGSIIETKDS |
| Ga0137372_101731471 | 3300012350 | Vadose Zone Soil | VNQLSEILEEKGHQVLEIEADASVFEAVKQMVEANVGSLLVT |
| Ga0137386_108415272 | 3300012351 | Vadose Zone Soil | MNKVSEILGDKGRDVLRIDAEASVLDAVKQMVDANIGSLLVTKDG |
| Ga0137367_100623945 | 3300012353 | Vadose Zone Soil | MNQLSEILDGKGHEALRIEADTSVFEAVKRMVEANV |
| Ga0137367_111695253 | 3300012353 | Vadose Zone Soil | MNQISEILGDKGRDVLEIEADASVLEAVKRMVEAN |
| Ga0137369_100911895 | 3300012355 | Vadose Zone Soil | MNQLSEILDEKGHDVPRIEADASVFEAVKRMVEANVGSLLVTEGDEI |
| Ga0137369_105193221 | 3300012355 | Vadose Zone Soil | VNQVSEILEEKGHDVLQIEADASVSEAVKRMVEAN |
| Ga0137369_105556491 | 3300012355 | Vadose Zone Soil | MNQLADILDDKGDQVLRIEADASVFEAIERMVEAN |
| Ga0137375_101234511 | 3300012360 | Vadose Zone Soil | VNQVSQILEEKGHDVLQIEADASVFEAVKRMVEANVGSLLVT |
| Ga0137375_110898581 | 3300012360 | Vadose Zone Soil | VSQILEEKGHDVLQIEADASVFEAVKRMVEANVGSLLVT |
| Ga0137373_107528741 | 3300012532 | Vadose Zone Soil | VNQLSEILGEKGHQVLEIEADASVFEAVKQMVEANVGSLL |
| Ga0136616_100077657 | 3300012679 | Polar Desert Sand | MNQLSEILDEKGTDVLQIEADASVFEAVQRMVEANVGS |
| Ga0157282_100596273 | 3300012904 | Soil | MSVNRLAEILEGKGGHVLEIDADATVLEAVQQMVMMNVGSLLVT |
| Ga0157296_100021614 | 3300012905 | Soil | MGQVSEILDEKGHRVLMIDAGASVLEAVKQMVAANVGSLLV |
| Ga0157286_101734962 | 3300012908 | Soil | VNEVSQILDEKGHDVLQIDAEASVYEAVKQMVAANVASLLVSEGGEI |
| Ga0157298_101791602 | 3300012913 | Soil | MNQLSEVLDAKGHDVLRIDAAASVLEAAKRMVDAN |
| Ga0137407_110106221 | 3300012930 | Vadose Zone Soil | MNQLLSGILDEKGHDVLQIDADASVFEAVKRMVEANVGAL |
| Ga0120172_11568851 | 3300013765 | Permafrost | MHQLATILEEKGDEVFAIEADASVFEAIKRMVEANVGALLVTDEGE |
| Ga0120158_100790371 | 3300013772 | Permafrost | MNQLSEILNDVLRIEADASVFEAVKRMVEANVGSLLVTEGDEITGTA |
| Ga0134089_103263501 | 3300015358 | Grasslands Soil | VNRVSEILGDKGHDVLEIEADAPVLEAVKRMVDANVGSLLVTKDG |
| Ga0134085_103045041 | 3300015359 | Grasslands Soil | MNQLLSGILDEKGHDVLQIDADASVFEAVKRMVEANVGSLLVTESGEIR |
| Ga0132256_1001028611 | 3300015372 | Arabidopsis Rhizosphere | VNRVSEILGDKGHNVLEIEADAPVLEAVKQMVDANVGSLLVKKDG |
| Ga0132256_1039213662 | 3300015372 | Arabidopsis Rhizosphere | MSNVSEILGDKGGRVLKIEASASVFEAVQEMVEANVG |
| Ga0182036_108342583 | 3300016270 | Soil | MNTLQEILAEKGYEVLRVDAGVSVLEAVEQMVEANVGSLLVT |
| Ga0190266_107817072 | 3300017965 | Soil | MSVNRLAEILEEKGGQVLEIDADATVLEAVQQMVAMN |
| Ga0184605_104292181 | 3300018027 | Groundwater Sediment | MNQVSEILGDKGRDVIRIDADASVLEAVKQMVEANIGSLLVM |
| Ga0184634_104909372 | 3300018031 | Groundwater Sediment | MAVNRLYEILEEKGGEVLKVDAESSVFEAVQLMVEKNVGSLLVTE |
| Ga0184619_102936171 | 3300018061 | Groundwater Sediment | MNEVSEILGDKGHDVLQIDADASALDAVKRMVEANIGSLLVTKGG |
| Ga0184618_100045841 | 3300018071 | Groundwater Sediment | MNEVSEILGDKGHDVLRIDADASVLEAVKRMVEANIGS |
| Ga0184618_103709942 | 3300018071 | Groundwater Sediment | MAVNRLYEILEEKGGEVLEVDADASVFEAVQLMVEK |
| Ga0066667_114992231 | 3300018433 | Grasslands Soil | MNQLSEILGDKGGEVLKIGADASVFEAVETMVEANV |
| Ga0190269_103717171 | 3300018465 | Soil | VNRVSQILEEKGHDVLQIEAEASVHEAVKQMVAANVASLLVSD |
| Ga0066669_118356152 | 3300018482 | Grasslands Soil | MNQLSEILDEKGHDVLRIEADASAFEAVKRMVEANVGSLLVMEG |
| Ga0193705_10910691 | 3300019869 | Soil | MNQLSEILDEKGHDALRIEAEASVFEAVKRMVEANVGSLLVTVGG |
| Ga0193741_10201141 | 3300019884 | Soil | MTVNRLAEILEEKGGDVYEIDADATVLEAVQQMVARNVGSLLVTVEGEVT |
| Ga0193730_11580922 | 3300020002 | Soil | MNQLLSGILDEKGHDVLEIDADASVFEAVKRMVESNVGALLVT |
| Ga0210382_102896122 | 3300021080 | Groundwater Sediment | MNQLSEILDEKGHDVLRIEADASVFEAVKRMVEANVGSL |
| Ga0210382_103233502 | 3300021080 | Groundwater Sediment | VNQVSEILGDKGRDVLRIDAEASLLEAVKQMVEANIGS |
| Ga0193719_102440283 | 3300021344 | Soil | MNQVSEILGDKGHDVLRIDADASVLEAVKRMVEANIGSLLVTK |
| Ga0193699_103316012 | 3300021363 | Soil | MNQLSEVLDAKGRDVLRIDAAASVLEAARRMVDANVGSLLV |
| Ga0222621_10618582 | 3300021510 | Groundwater Sediment | MNQLLSGILDEKGHDVLRMDADASVFEAVKRMVEANVGS |
| Ga0247788_10954451 | 3300022901 | Soil | VNRVSEILGDKGRDVLAIDAGATVLEAVRQMIDANV |
| Ga0247752_10943841 | 3300023071 | Soil | MSVNRLAEILDEKGGHVLEIDADATVLDAVQQMVTMNVGSLLVTVEGE |
| Ga0208689_10164303 | 3300025459 | Peatland | MRDRVSDILGDKSRDVLAIESDASVYDAVKRMVERNVGSLLVT |
| Ga0207620_10204711 | 3300026873 | Soil | VNRVSEILGDKGRDVLAIDAGATVLEAVRQMIDANVGSLLVKQDDD |
| Ga0207624_1022191 | 3300027453 | Soil | MGQVSEILDEKGHRVLMIDAGASVLEAVKQMVAANVGS |
| Ga0209009_11376832 | 3300027667 | Forest Soil | VNQVSEILNGKGRDMLRIDADASVFEAVKQMVEAS |
| Ga0209814_104306911 | 3300027873 | Populus Rhizosphere | MNQVSEILGDKSRDVLKIDAEASALDAVRQMVGANIGSLLV |
| Ga0209974_104112392 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MGQVSEILDEKGHRVLMIDAGASVLEAVKQMVAANV |
| Ga0307309_101355342 | 3300028714 | Soil | LNRVSEILGDKGQDVLEIDADAPVLEAVKRMVDAN |
| Ga0307318_100005911 | 3300028744 | Soil | MNQVSQILEEKGDDVLQIEADASVHEAVKQMVAANVASLLVSEGGE |
| Ga0307318_101779011 | 3300028744 | Soil | MNQLSEILDEKGRDALRIEADASVFEAVKRMVDANVGSLLVTEGGEIT |
| Ga0307318_103087052 | 3300028744 | Soil | MTVNKLAEILEEKGRQVLEIDADATVLEAVQQMVELNVGSLLVTEG |
| Ga0307320_100127863 | 3300028771 | Soil | MNQLLSGILDEKGHDVLRMDADASVFEAVKRMVEANVGSL |
| Ga0307323_100572002 | 3300028787 | Soil | MNEVSEILGDKGHDVLQIDADASALEAVKRMVEANIGSLLVTKGGEITG |
| Ga0307323_101943253 | 3300028787 | Soil | MNQVSEILGDKGRDVLEIDADASVLEAVKQMVGAN |
| Ga0307323_102210452 | 3300028787 | Soil | VNQVSQILEEKGHDVLQIGADASVYEAVKEMVAANVASLLVTEGGEITG |
| Ga0307290_100793111 | 3300028791 | Soil | MCGPPRPTAGGADVNQVSQILEEKGHDVLQIGADASVYDAVKQMVAANVASLL |
| Ga0307299_101680491 | 3300028793 | Soil | MNQLSEILDEKGRDALRIEADASVFEAVKRMVDANVW |
| Ga0307305_101102051 | 3300028807 | Soil | MNQLSEILDEKGHDVLRIEADASVFEAVKRMVEANVG |
| Ga0307310_100934192 | 3300028824 | Soil | MSQVAEILAEKGRGLLKIEANASILEAVEQMVEANVGSLL |
| Ga0307310_101383921 | 3300028824 | Soil | MAVNRLYEILQEKGGEVLEIDADASVFAAVQLMVEKNVGSLLVTVSGDI |
| Ga0307312_106067252 | 3300028828 | Soil | MNQLSEILDEKGRDALRIEADASVFEAVKRMVDANV |
| Ga0307289_103444922 | 3300028875 | Soil | MAVNRLYEILEEKGGEVLKVDAESSVFEAVQLMVEKNVGSLLVTEGGD |
| Ga0307278_100793094 | 3300028878 | Soil | LNRVSEILGDKGHDVLEIEADAPVLEAVKRMVDANVGSLLVTKG |
| Ga0307278_103671991 | 3300028878 | Soil | MNQLSEILDEKGHDALRIEAEASVFEAVKRMVEAN |
| Ga0307277_103592851 | 3300028881 | Soil | MNQLLSGILDEKGHDVLRMDADASVFEAVKRMVEANVG |
| Ga0307497_106855771 | 3300031226 | Soil | VNRVSEILGDKGRDVLEIDAGAPVLEAVRQMVDANVGSLLV |
| Ga0170824_1051532781 | 3300031231 | Forest Soil | MAQLASILQGKSGGVLSIDADDSVFEAVRRMVEANVGA |
| Ga0318492_107408781 | 3300031748 | Soil | MSTVSEILGDKGSNVLRIDAGATVFEAVQQMVEANVGSLLV |
| Ga0308175_1030009111 | 3300031938 | Soil | MNQVSQILEEKGHDVLQIDADASVDEAVRQMVAANVA |
| Ga0326597_105679202 | 3300031965 | Soil | MNQLSEILDQKGHGVLEIEADASVYEAVKRMVEANVGSLLV |
| Ga0310906_111035351 | 3300032013 | Soil | MSELSEILDEKGSDVLRIEAEASVFDAVRRMVEANVGSL |
| Ga0318524_105608702 | 3300032067 | Soil | MNTVSEILGDKGGDVLRIHATASVFEAVQQMVEANVGSLLVTDGGDI |
| Ga0318518_102799572 | 3300032090 | Soil | MNTVSEILGDKGGDVLRIHATASVFEAVQQMVEANVGSLLVTD |
| Ga0247829_101207963 | 3300033550 | Soil | MNQVYEILGDKGRDVLRIDAEASALDAVRQMIGANI |
| ⦗Top⦘ |