Basic Information | |
---|---|
Family ID | F086699 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 45 residues |
Representative Sequence | MTTSSVNTLAQPLGEMPPDAIVFGRTEAMQAVRDRLTKLASANV |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 47.27 % |
% of genes near scaffold ends (potentially truncated) | 99.09 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.454 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.636 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.545 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.39% β-sheet: 0.00% Coil/Unstructured: 73.61% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF07238 | PilZ | 48.18 |
PF00158 | Sigma54_activat | 2.73 |
PF02518 | HATPase_c | 2.73 |
PF02954 | HTH_8 | 1.82 |
PF00072 | Response_reg | 0.91 |
PF00512 | HisKA | 0.91 |
PF06739 | SBBP | 0.91 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000789|JGI1027J11758_12851224 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300000789|JGI1027J11758_12855888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300004104|Ga0058891_1474437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300004132|Ga0058902_1212349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300004152|Ga0062386_101174097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300005175|Ga0066673_10766746 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005332|Ga0066388_102720219 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300005434|Ga0070709_11324578 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300005436|Ga0070713_101859125 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300005437|Ga0070710_11199746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
3300005529|Ga0070741_10103014 | All Organisms → cellular organisms → Bacteria | 3021 | Open in IMG/M |
3300005534|Ga0070735_10069543 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
3300005538|Ga0070731_10404734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
3300005541|Ga0070733_10637930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300005542|Ga0070732_10736445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
3300005556|Ga0066707_10210278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1258 | Open in IMG/M |
3300005568|Ga0066703_10207940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
3300005586|Ga0066691_10712591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
3300006050|Ga0075028_101045692 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300006052|Ga0075029_101089628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
3300006052|Ga0075029_101171732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 536 | Open in IMG/M |
3300006162|Ga0075030_101033989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 646 | Open in IMG/M |
3300006893|Ga0073928_10856888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
3300009089|Ga0099828_11871033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300009090|Ga0099827_11489793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
3300009638|Ga0116113_1047748 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300010048|Ga0126373_10758753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
3300010048|Ga0126373_11614704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300010048|Ga0126373_11946885 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
3300010335|Ga0134063_10142358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
3300010379|Ga0136449_101315684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1125 | Open in IMG/M |
3300010379|Ga0136449_101699914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
3300010396|Ga0134126_12642126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
3300011270|Ga0137391_10013544 | All Organisms → cellular organisms → Bacteria | 6591 | Open in IMG/M |
3300011271|Ga0137393_10554465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300012211|Ga0137377_11920473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300012353|Ga0137367_11080786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300012354|Ga0137366_10056647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2998 | Open in IMG/M |
3300012361|Ga0137360_10227543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
3300012469|Ga0150984_115681005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300014169|Ga0181531_10286867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300015241|Ga0137418_10498598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
3300016357|Ga0182032_10831250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300016702|Ga0181511_1044555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 696 | Open in IMG/M |
3300017942|Ga0187808_10440971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300017942|Ga0187808_10581250 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300017959|Ga0187779_11304512 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300017959|Ga0187779_11319793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300017972|Ga0187781_10469799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
3300017975|Ga0187782_10667038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
3300017994|Ga0187822_10289010 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300017995|Ga0187816_10016118 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2865 | Open in IMG/M |
3300017995|Ga0187816_10494695 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300017995|Ga0187816_10540402 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300018007|Ga0187805_10106452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
3300018018|Ga0187886_1227649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300018038|Ga0187855_10059628 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2354 | Open in IMG/M |
3300018062|Ga0187784_10124974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2100 | Open in IMG/M |
3300018062|Ga0187784_11302946 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300018090|Ga0187770_10762455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300018090|Ga0187770_11230881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
3300020579|Ga0210407_10461498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 993 | Open in IMG/M |
3300020582|Ga0210395_10618150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300021181|Ga0210388_10373009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
3300021401|Ga0210393_10037167 | All Organisms → cellular organisms → Bacteria | 3814 | Open in IMG/M |
3300021404|Ga0210389_11136498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300021405|Ga0210387_10436530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1162 | Open in IMG/M |
3300021405|Ga0210387_10653236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 933 | Open in IMG/M |
3300021407|Ga0210383_10044299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3707 | Open in IMG/M |
3300021433|Ga0210391_11113049 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300021559|Ga0210409_10103337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2627 | Open in IMG/M |
3300021559|Ga0210409_10236461 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
3300021559|Ga0210409_11546944 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300021560|Ga0126371_11029827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
3300021560|Ga0126371_12314906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
3300022528|Ga0242669_1044161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300022531|Ga0242660_1086236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
3300023056|Ga0233357_1032714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
3300025898|Ga0207692_10429297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
3300025898|Ga0207692_10914613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300025905|Ga0207685_10600941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300025928|Ga0207700_11526515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300027073|Ga0208366_1013700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
3300027590|Ga0209116_1105334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
3300027609|Ga0209221_1004435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3513 | Open in IMG/M |
3300027633|Ga0208988_1128881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
3300027641|Ga0208827_1162293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
3300027648|Ga0209420_1166266 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300027692|Ga0209530_1058758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1119 | Open in IMG/M |
3300027824|Ga0209040_10417252 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
3300027842|Ga0209580_10411788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300027867|Ga0209167_10070942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1742 | Open in IMG/M |
3300027905|Ga0209415_10564690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 855 | Open in IMG/M |
3300030509|Ga0302183_10038311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1927 | Open in IMG/M |
3300030730|Ga0307482_1124225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
3300030743|Ga0265461_10974123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300031023|Ga0073998_10587402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300031028|Ga0302180_10442521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300031231|Ga0170824_116191393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300031446|Ga0170820_16349661 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300031754|Ga0307475_10555362 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300031962|Ga0307479_10449072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1273 | Open in IMG/M |
3300031962|Ga0307479_11106031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
3300032160|Ga0311301_11534219 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
3300032174|Ga0307470_11508096 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300032180|Ga0307471_102495039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
3300032756|Ga0315742_12350401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300032954|Ga0335083_10369358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
3300032955|Ga0335076_11035319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
3300034282|Ga0370492_0112890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1112 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.45% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.18% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 7.27% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.27% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.36% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 6.36% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.36% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.55% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.55% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.55% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.64% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.73% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.73% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.82% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.82% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.82% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.91% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.91% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.91% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.91% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.91% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.91% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.91% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.91% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004132 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF240 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027692 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031023 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFA (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032756 | Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined Assembly | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J11758_128512241 | 3300000789 | Soil | MTNNSVSTFVQPLGEMPPESIVFGRTEAMXAVRDRLXKLAGANVPVLIQGE |
JGI1027J11758_128558881 | 3300000789 | Soil | MTSSSVNTLVQPLGEMPPDSIVFGRTETMHAVRDRLNKLAGANVPVLIE |
Ga0058891_14744372 | 3300004104 | Forest Soil | MTTSTVNTLVQPLGEMPPETIVFGHTESMLAVRDRLVKLAGANVP |
Ga0058902_12123491 | 3300004132 | Forest Soil | MTTSSVNTLAQPLGEMPPDAIVFGRTEAMQAVRDRLTKLASANV |
Ga0062386_1011740972 | 3300004152 | Bog Forest Soil | MTTSTVNTLTQPLGEMPPDAIVFGRTEAMQAVRDRLTKLASAN |
Ga0066673_107667461 | 3300005175 | Soil | MTSSSVNTLVQPIGEMPPEAIVFGRTEGMIAVRDRLMKLAGANVPVLIQ |
Ga0066388_1027202191 | 3300005332 | Tropical Forest Soil | MTTSVNTLVQPLGEMPPEPIVFGRTDVMQAVRDRLNKLAGANVPVLIQG |
Ga0070709_113245782 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTNSVNTLVQPLGEMPPETIVFGRTEGMNAVRDRLNKLAGANVPVLIQGES |
Ga0070713_1018591252 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTNSVNTLVQPLGEMPPETIVFGRTEGMNAVRDRLNKLAGANV |
Ga0070710_111997462 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTGSVNSLVQPLGEMPPETIVFGRTEAMNAVRDRLLKLASANVP |
Ga0070741_101030141 | 3300005529 | Surface Soil | MTISSVNTLVQPLGEMPPESIVFGRTEAMQAVRDRLTKLAGANVPVLIQ |
Ga0070735_100695434 | 3300005534 | Surface Soil | MAATSVSSLTQSLGEIPPESVVFGRTETMRALRERLQKLAGANVPVLIQGES |
Ga0070731_104047342 | 3300005538 | Surface Soil | MSTSNPVSSLIQPLGEMPPEAVVFGTTDAMRSLRERLAKIAGANVPVLIQGES |
Ga0070733_106379302 | 3300005541 | Surface Soil | MTTSSVSTFAQPLGEMPPDAIVFGRTEAMQAVRER |
Ga0070732_107364452 | 3300005542 | Surface Soil | MTSSGVNTLVQPLGEMPPDTIVFGRTEAMQAVRERLTKLAS |
Ga0066707_102102781 | 3300005556 | Soil | MTITSTVNALVQPLGEYPPESVVFGRTEAMQAVRDRLARLAGANVPVL |
Ga0066703_102079403 | 3300005568 | Soil | MTSSSVNTLAQPLGEMPPDAIVFGRTDAMQAVRDRLT |
Ga0066691_107125912 | 3300005586 | Soil | MSQAKCMSITTTVNPLIQPLGEMPPDEVVFGRTEAMQAVRDRLSKLAGANVP |
Ga0075028_1010456921 | 3300006050 | Watersheds | MTTSSVSSLVQPLGEMPPDTIVFGRSEAMQAVRDRLVKLAGANVPVLI |
Ga0075029_1010896281 | 3300006052 | Watersheds | MTTGSVNTLVQPLGEMPPDSIIFGRTEAMQAVRERLAKLAGA |
Ga0075029_1011717321 | 3300006052 | Watersheds | MTTSSVNSLVQPLGEMPPDAIVFGRTDAMQAVRDRLTKLASANVPVLIQGE |
Ga0075030_1010339892 | 3300006162 | Watersheds | MTTNSVSTFVQPLGEMPPEAVVFGRTEAMRAVRDRLTKLASAN |
Ga0073928_108568882 | 3300006893 | Iron-Sulfur Acid Spring | MTISSVSTLVQPLGEMPPDAIVFGRTEAMQSVRDRLTKLA |
Ga0099828_118710332 | 3300009089 | Vadose Zone Soil | MTTSSVNTLAQPLGEMPPDAIVFGRTEGMQAVRDR |
Ga0099827_114897932 | 3300009090 | Vadose Zone Soil | MTTTTAVNALVQPLGEYPPESVVFGRTEAMLAVHERLTRLAGANVPVLIQGESG |
Ga0116113_10477482 | 3300009638 | Peatland | MTTSGSVNALVQPLGEMPPEAIVFGRTEAMQALRERLLKLAG |
Ga0126373_107587532 | 3300010048 | Tropical Forest Soil | MTNVNTLVQPLGEMPPKTIIFGRTEGMQAVRDRLAKLAGANVPVL |
Ga0126373_116147041 | 3300010048 | Tropical Forest Soil | MTNVNTLVQPLGEMPPEAIIFGRTEAMRAVRDRLTKLAGANVPVLI |
Ga0126373_119468852 | 3300010048 | Tropical Forest Soil | MTTGSVNTLVQPLGEMPPDAIVFGRTEAMRNVRDRLTKLA |
Ga0134063_101423582 | 3300010335 | Grasslands Soil | MTITSTVNALVQPLVEYPPETVVFGRTEAMQAVRDRLARLAGANV |
Ga0136449_1013156842 | 3300010379 | Peatlands Soil | MSTSNPVSALIQPLGEMPPESIVFGGTEAMRALRERLAKIAGANVPVLIQGESG |
Ga0136449_1016999142 | 3300010379 | Peatlands Soil | MTTSSVNTLAQPLGEMPPDAIVFGRTEGMQAVRDRLTKLA |
Ga0134126_126421261 | 3300010396 | Terrestrial Soil | MTTGSVNSLVQPLGEMPPETIVFGRTEAMNAVRDRLLKLAGIGTAAG |
Ga0137391_100135441 | 3300011270 | Vadose Zone Soil | MLQAKYMSITSAVNPLIQPLGEMPPDAVVFGRTEAMQAVRDRLSKLAGANVPV |
Ga0137393_105544651 | 3300011271 | Vadose Zone Soil | MTTSSVNTLAQPLGEMPPDAIVFGRTEGMQAVRDRLTKLASANVPVLI |
Ga0137377_119204731 | 3300012211 | Vadose Zone Soil | MTTTTAVNALVQPLGEYPPESVVFGRTEAMLAVHERLTRLAGAN |
Ga0137367_110807862 | 3300012353 | Vadose Zone Soil | MTSSSVNTLVQPLGEMPPNAIVFGHTEGMQAVHDRLTKL |
Ga0137366_100566471 | 3300012354 | Vadose Zone Soil | MTTSSVSTLVQPLGEMPPDAIVFGRTDAMQAVRDRLNKLAGANVPV |
Ga0137360_102275433 | 3300012361 | Vadose Zone Soil | MSTSNPVSALIQPLGEMPPDSVVFGNTEAMRALRERLGKIAGANVPVLIQGE |
Ga0150984_1156810051 | 3300012469 | Avena Fatua Rhizosphere | MTTTTVNNLVQPLGEMPPETIVFGRSDAMNGVRDRLTKLAAANVPVLIQ |
Ga0181531_102868671 | 3300014169 | Bog | MTTTSSSVNSLVQPLGEMPPSAVVFGQTAAMQALQERLMKLAGANVPVLIQGES |
Ga0137418_104985981 | 3300015241 | Vadose Zone Soil | MSITSVVNPLIQPLGEMPPDAVVFGRTDAMQAVRDRLSK |
Ga0182032_108312503 | 3300016357 | Soil | MTTSVNTLVQPLGEMPPESIVFGRTESMQAVRDRLNKLAGANV |
Ga0181511_10445551 | 3300016702 | Peatland | MSTSHLVSSLVQPLGEMPPEAVFFGGTEAMRALRERLAKLASANVPVLIQGESGT |
Ga0187808_104409712 | 3300017942 | Freshwater Sediment | MTSSSLNTLVQPLGEMPPDAIVFGRTEAMQAVHDR |
Ga0187808_105812502 | 3300017942 | Freshwater Sediment | MTSNSVSTLVQPLGEMPPEPIVFGRSEAMNAVRDRLNKLAGA |
Ga0187779_113045121 | 3300017959 | Tropical Peatland | MTTSVNTLVQPLGEMPPDSIVFGRTDAMQSVRDRLNKLAGANVPVLIQGES |
Ga0187779_113197932 | 3300017959 | Tropical Peatland | MTTTTVNTLVQPLGEMPPETIVFGRSEAMQAVRDRLT |
Ga0187781_104697993 | 3300017972 | Tropical Peatland | MTTSSVNSLVQPLGEMPPEQIVFGRTEAMRAVHDRLTKLAGANVPVLIQG |
Ga0187782_106670382 | 3300017975 | Tropical Peatland | MTSSSVNTLVQPLGEMPPEAIVFGRTESMRAVRDRLTKLASANVPVLIQ |
Ga0187822_102890101 | 3300017994 | Freshwater Sediment | MTTSTVNSLVQPLGEMPPDAIFFGRTEGMRSVRDRLTKLAGA |
Ga0187816_100161184 | 3300017995 | Freshwater Sediment | MTTSSVNTLVQPLGEMPPDPIVFGRTEAMNAVRDRLTKLAGA |
Ga0187816_104946952 | 3300017995 | Freshwater Sediment | MTSSSVNTLVQPLGEMPPESIVFGRTDGMQAVRDRLTKLASANVPVL |
Ga0187816_105404021 | 3300017995 | Freshwater Sediment | MTTTSSVNSLVQPLGEMPPEAVVFGRTEAMSAVRDRLTKLAGANVPVLIQGES |
Ga0187805_101064521 | 3300018007 | Freshwater Sediment | MTTSSVNTLVQPLGEMPPEAIVFGRTEAMRAVHDRLTKLAGANVPVLIQGES |
Ga0187886_12276492 | 3300018018 | Peatland | MSTSHLVSSLVQPLGEMPPEAVFFGGTEAMRALRERLAKLASANVPVLIQG |
Ga0187855_100596281 | 3300018038 | Peatland | MTTSSSVNSLVQPLGEMPPSAVVFGQTAAMHALQERLMKLAG |
Ga0187784_101249744 | 3300018062 | Tropical Peatland | MNNASVNTLVQPLGEVPPDEIVFGRSEAMLSVRDRLVKLAGANVPVL |
Ga0187784_113029461 | 3300018062 | Tropical Peatland | MTSSSVNTLVQPLGEMPPEAVVFGHSETMLVVRDRLTKLAGANVPVLIQGE |
Ga0187770_107624551 | 3300018090 | Tropical Peatland | MNNSVNTLVQPLGEVPPDHVVFGRTEAMLSVRDRLAKLAG |
Ga0187770_112308812 | 3300018090 | Tropical Peatland | MTNSSVSTLVQPLGEMPPEAVVFGRTEAIQAVRDRP |
Ga0210407_104614982 | 3300020579 | Soil | MTISSLNTLVQPLGEMPPDAIVFGRSEAMQSVRERLTKLASAN |
Ga0210395_106181503 | 3300020582 | Soil | MTSGSVNTLVQPLGEMPPDHIVFGRTEAMQAVRERLTKLAGANV |
Ga0210388_103730093 | 3300021181 | Soil | MSTTNSVSSLVQPLGEMPPEAVVFGGTETMRALRERLAKIAGANVPVLIQ |
Ga0210393_100371671 | 3300021401 | Soil | MTTSTVNTLVQPLGEMPPETIVFGHTESMLAVRDRLLKL |
Ga0210389_111364982 | 3300021404 | Soil | MTTSNVNSLVQPLGEMPPDAVIFGRTDAMQAVRERLNKLAGANVPVLIQGES |
Ga0210387_104365301 | 3300021405 | Soil | MTTSSVNTLAQPLGEMPPDAIVFGRTEAMQAVRERLTKLASA |
Ga0210387_106532363 | 3300021405 | Soil | MTTSGVNTLVQPLGEMPPDAIVFGRTEAMRAVRERLTKLAAANVPVLIRG |
Ga0210383_100442994 | 3300021407 | Soil | MTTSSSVNSLVQPLGEMPPSAVVFGQTAAMQALQERLLKLAGAN |
Ga0210391_111130492 | 3300021433 | Soil | MTTSSVSTLVQPLGEMPPDAVVFGRGEAMRAVRERLAKLANANVPVLIQGES |
Ga0210409_101033371 | 3300021559 | Soil | MTSNSVNTLVQPLGEMPPETIVFGRTEGMNAVRDRLNKLAGANVPVLI |
Ga0210409_102364613 | 3300021559 | Soil | MTTSSVSSLVQPLGEMPPDSIVFGRTEAMQAVRDRLTKLASANVPVLIQGE |
Ga0210409_115469441 | 3300021559 | Soil | MTTSSVSSLVQPLGEMPPDSIVFGRTEAMQAVRDRLTKLAGAN |
Ga0126371_110298271 | 3300021560 | Tropical Forest Soil | MTTSSVNTLVQPLGEMPPDAIVFGRTENMQAVRSRLTKLAGANVPVLIQ |
Ga0126371_123149062 | 3300021560 | Tropical Forest Soil | MTTSVNTLVQPLGEMPPDAIVFGRTDAMQAVRDRLN |
Ga0242669_10441611 | 3300022528 | Soil | MTSNSVNTLVQPLGEMPPETIVFGRTEGMNAVRDRLNKLAGANVPV |
Ga0242660_10862361 | 3300022531 | Soil | MTTSTVNTLVQPLGEMPPEAIVFGHTESMLAVRDRLIKLAGANVPVLIQGES |
Ga0233357_10327142 | 3300023056 | Soil | MTTSSVNTLVQPLGEMPPESIVFGRTESMLAVRDRLIKLAGANVPVL |
Ga0207692_104292971 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSSSVNALVQPLGEMPPDAITFGRTEAMQAVRERLTKLA |
Ga0207692_109146132 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTGSVNSLVQPLGEMPPEAIVFGRTEAMGAVRDRLLKLAGANVPVLIQGE |
Ga0207685_106009411 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSTTVNTLVQPLGEMPPEAIVFGRTETMQAVRDRLTRLAG |
Ga0207700_115265152 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTGSVNSLVQPLGEMPPERIVFGRTEAMNAVRDRLLKLAGANVPVLIQGESG |
Ga0208366_10137003 | 3300027073 | Forest Soil | MTSNSVNTLVQPLGEMPPETIVFGRTEGMNAVRDRLNKLAGANVPVLIQGE |
Ga0209116_11053341 | 3300027590 | Forest Soil | MTTSSVNSLAQPLGEMPPDAIIFGRTEAMQAVRDRL |
Ga0209221_10044354 | 3300027609 | Forest Soil | MTTTSSVNSLVQPLGEMPPSAVVFGQTAAMQALQERL |
Ga0208988_11288812 | 3300027633 | Forest Soil | MSITSTVNPLIQPLGEMPPDAIVFGRTEAMQAVRDRLG |
Ga0208827_11622932 | 3300027641 | Peatlands Soil | MNSSNPVSSLVQPLGEMPPEAVVFGRTEAMQAVRDRLTKLAA |
Ga0209420_11662661 | 3300027648 | Forest Soil | MTTSGSVNSLVQPLGEMPPEAIVFGKTEAMQSLRERLLKLAGAHLPIER |
Ga0209530_10587581 | 3300027692 | Forest Soil | MTTSSSVNSLVQPLGEMPPSAVVFGQTAAMQALQERLMKLAGANVPVLIQGES |
Ga0209040_104172522 | 3300027824 | Bog Forest Soil | MTTSSLNTLAQPLGEMPPDAIVFGRTEAMQAVRDRLTKLA |
Ga0209580_104117882 | 3300027842 | Surface Soil | MPTTTVNTLVQPLGEMPPESIVFGRSETMNGVRDRLTKL |
Ga0209167_100709421 | 3300027867 | Surface Soil | MSSNGSVNSLVQPLGEMPPTAVVFGQTAAMQAVQERLVKLAGANVPVLIQATP |
Ga0209415_105646901 | 3300027905 | Peatlands Soil | MTTSSVNTLAQPLGEMPPDAIVFGRGEAMQAVRDRLTKLASANVPVLI |
Ga0302183_100383111 | 3300030509 | Palsa | MTTSTLNTLAQPLGETPPDAIVFGRTEAMQAVRDRLNKLASAN |
Ga0307482_11242252 | 3300030730 | Hardwood Forest Soil | MTTSTVNTLVQPLGEMPPEAIVFGHTESMLAVRDRLIKLAGANVPVLIQ |
Ga0265461_109741231 | 3300030743 | Soil | MTSSMTSSSVNSLVQPLGEMPPTGVVFGQTAAMQAVQER |
Ga0073998_105874021 | 3300031023 | Soil | MTISSVSTLVQPLGEMPPDAIVFGRTEAMQSVRERLTK |
Ga0302180_104425212 | 3300031028 | Palsa | MTTSSNVNSLVQPLGEMPPSAVVFGQTAAMQALRERLMKLAGANVPV |
Ga0170824_1161913931 | 3300031231 | Forest Soil | MTTGSVNTLVQPLGEMPPDSIVFGRTEAMQAVRERLAKLA |
Ga0170820_163496612 | 3300031446 | Forest Soil | MTTTTSGVNTLVQPLGEMPPATVVFGRTEGMQVVRERLIKLA |
Ga0307475_105553622 | 3300031754 | Hardwood Forest Soil | MTSSSVNTLVQPLGEMPPEAVVFGRTEAMRAVRERLAKLASANVPVLIQGE |
Ga0307479_104490724 | 3300031962 | Hardwood Forest Soil | MTSNSVNTLVQPLGEMPPETIVFGRTEGMNALRDRLNKLAGANVPVLIQG |
Ga0307479_111060312 | 3300031962 | Hardwood Forest Soil | MSITTTVNPLIQPLGEMPPDEVVFGRTEAMQAVRDRLSKLAGANV |
Ga0311301_115342191 | 3300032160 | Peatlands Soil | MMTTNSVSSLVQPLGEIPPASIIFGRTEAMQAVRDRLARLAAANVPVL |
Ga0307470_115080962 | 3300032174 | Hardwood Forest Soil | MTSNSVSTLVQPLGEMPPESIVFGGTEAMHAVRDRLNKLAGAN |
Ga0307471_1024950391 | 3300032180 | Hardwood Forest Soil | MTTSSVNSLVQPLGEMPPDAIVFGRTEAMQAVRDRLMKLASANVPVLIQ |
Ga0315742_123504012 | 3300032756 | Forest Soil | MTTSSVSTLVQPLGEMPPDAIVFGRTEAMQSVRDRLTK |
Ga0335083_103693581 | 3300032954 | Soil | MTNGSVNTLVQPLGEMPPDSIIFGKTEAMQAVRERLAKLAGANVPV |
Ga0335076_110353192 | 3300032955 | Soil | MTTSSVNTFVQPLGEMPPEAVVFGRTEGMQAVRDRLTKLAG |
Ga0370492_0112890_954_1112 | 3300034282 | Untreated Peat Soil | MSTSNPVSSLIQPLGEMPPEAIVFGGTDVMQALRERLAKIAGANVPVLIQGES |
⦗Top⦘ |