 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F086667 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (41.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.273 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.727 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 85.71% β-sheet: 0.00% Coil/Unstructured: 14.29% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF13975 | gag-asp_proteas | 11.82 |
| PF00188 | CAP | 8.18 |
| PF02518 | HATPase_c | 3.64 |
| PF13650 | Asp_protease_2 | 2.73 |
| PF03401 | TctC | 1.82 |
| PF12570 | DUF3750 | 1.82 |
| PF08241 | Methyltransf_11 | 0.91 |
| PF04851 | ResIII | 0.91 |
| PF00561 | Abhydrolase_1 | 0.91 |
| PF06826 | Asp-Al_Ex | 0.91 |
| PF00589 | Phage_integrase | 0.91 |
| PF13744 | HTH_37 | 0.91 |
| PF06945 | DUF1289 | 0.91 |
| PF02738 | MoCoBD_1 | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 8.18 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.82 |
| COG2985 | Uncharacterized membrane protein YbjL, putative transporter | General function prediction only [R] | 0.91 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 41.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.18% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.82% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.82% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.91% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908029 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027480 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_v1_00271520 | 2124908029 | Soil | MIFEAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE |
| A5_c1_01547100 | 2124908044 | Soil | MVLQKVGIERMIFEAALFLVLVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| JGI12053J15887_100100905 | 3300001661 | Forest Soil | MILEATLFLVLILLMAVPIVKAYEWLQDFLYGPYINRGE* |
| JGI12053J15887_100832562 | 3300001661 | Forest Soil | MVLQKVGIERMIFEATLFLIFVLVMTVPIVKAYEWLQDFLYGPYINRGK* |
| JGI12053J15887_101236843 | 3300001661 | Forest Soil | MIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| JGI25612J43240_10053422 | 3300002886 | Grasslands Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0070698_1008916061 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFEAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE* |
| Ga0066704_101976713 | 3300005557 | Soil | MIVEAALLLILILAMTIPTVKAYEWLQDFLYGPYINRGE* |
| Ga0075023_1000773104 | 3300006041 | Watersheds | FEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0075024_1000108832 | 3300006047 | Watersheds | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYNNRRK* |
| Ga0075024_1008917882 | 3300006047 | Watersheds | MIFKAGLLLILILLITIPIVKAYEWLQDFLYGPYINRGE* |
| Ga0075028_1000147671 | 3300006050 | Watersheds | MALQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0099793_102451283 | 3300007258 | Vadose Zone Soil | MVLQKVGIERMILEATLFLVLILLMAVPIVKAYEWLQDFLYGPYINRGE* |
| Ga0099794_100062455 | 3300007265 | Vadose Zone Soil | MVLQKVGIERMIFEAALLFILILLMTIPIVKAYEWLQDFLYGPYIHRGK* |
| Ga0099795_101640142 | 3300007788 | Vadose Zone Soil | MVLQKVGIERMILEATLFLVLILLMAAPIVKAYEWLQDFLYGPYINRGE* |
| Ga0099829_102196733 | 3300009038 | Vadose Zone Soil | MILEAALLLILILLITIPIVKAYEWLQDFLYGPYINR |
| Ga0099830_100725073 | 3300009088 | Vadose Zone Soil | MIFEAALFLILILLMTVPIVKAYEWLQDFLYGPYINRGK* |
| Ga0099828_105364853 | 3300009089 | Vadose Zone Soil | SMVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137392_104307942 | 3300011269 | Vadose Zone Soil | MILEAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE* |
| Ga0137392_106888672 | 3300011269 | Vadose Zone Soil | MALQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYIN |
| Ga0137393_101750351 | 3300011271 | Vadose Zone Soil | MILEAALLLILILLITIPIVKAYEWLQDFLYGPYIN |
| Ga0137393_101874091 | 3300011271 | Vadose Zone Soil | GRMIFEAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE* |
| Ga0137393_104173832 | 3300011271 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILILLMTVPIVKAYEWLQDFLYGPYINRGK* |
| Ga0137393_107414831 | 3300011271 | Vadose Zone Soil | MILEAALLLILILLMTIPIVKAYEWLQDFLYGPYINRGE* |
| Ga0137393_114882181 | 3300011271 | Vadose Zone Soil | MIFEAALLLILILLITIPIVKAYEWLQDFLYGPYINR |
| Ga0137389_107188902 | 3300012096 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRR |
| Ga0137365_104395131 | 3300012201 | Vadose Zone Soil | MIVEAALLLILAMTIPIVKAYEWLQDFLYGPYINRGE* |
| Ga0137363_103553552 | 3300012202 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKACEWLQDFLYGPYINRRK* |
| Ga0137363_107122282 | 3300012202 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLVLVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137362_100050543 | 3300012205 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKACEWFQDFLYGPYINRRK* |
| Ga0137380_103220431 | 3300012206 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDF |
| Ga0137379_102350193 | 3300012209 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLVLVPAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137377_102028043 | 3300012211 | Vadose Zone Soil | MIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPCINRRK* |
| Ga0137370_103428893 | 3300012285 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYITRRQ* |
| Ga0137387_109114662 | 3300012349 | Vadose Zone Soil | MIIEAALFLILVLAMTVPIVKAYEWLQDFLYGPCINRRK* |
| Ga0137387_110178211 | 3300012349 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFL* |
| Ga0137386_110661491 | 3300012351 | Vadose Zone Soil | GIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137384_112557331 | 3300012357 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINR |
| Ga0137375_100551885 | 3300012360 | Vadose Zone Soil | MVLQKVGIERVIFEAALFLVLVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137360_102540202 | 3300012361 | Vadose Zone Soil | MVLQKVGIERMIFEAARFLILVLAMTVPIVKACEWLQDFLYGPYINRRK* |
| Ga0137390_102402541 | 3300012363 | Vadose Zone Soil | EAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE* |
| Ga0137390_112965822 | 3300012363 | Vadose Zone Soil | MVLQKVGIERMIVEAALFLILVLAMMVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137396_101927742 | 3300012918 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPCINRRK* |
| Ga0137416_100336715 | 3300012927 | Vadose Zone Soil | MVLQKVGIERMIFEAALLFILILLMTIPIVKAYECLQDFLYGPYILRGK* |
| Ga0137416_100698162 | 3300012927 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLIFVLIMTVLIVKAYEWLQEFLYGPYINRGE* |
| Ga0137404_105394602 | 3300012929 | Vadose Zone Soil | MALQKVGIERMIFEAALFLVLVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137407_115121412 | 3300012930 | Vadose Zone Soil | MVLQKVGIERMVFEAALFLVLVLAMTVPIVKAYEWLQDFLYGPYINRRK* |
| Ga0137410_100317431 | 3300012944 | Vadose Zone Soil | QKVGIERMIFEAALLFILILLMTIPIVKAYEWLQDFLYGPYIHRGK* |
| Ga0137411_13205753 | 3300015052 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLVLAMTVPIVKAYEWLQDFLYGPYINRRNEPGRAD* |
| Ga0184604_101975082 | 3300018000 | Groundwater Sediment | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0184608_100097105 | 3300018028 | Groundwater Sediment | MVLQKVGIERMIVEAALFLILVLAMTVPIVKAYEWLQDFLYGPYIDRRK |
| Ga0184620_100204662 | 3300018051 | Groundwater Sediment | MVLQKVGIERMIVEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0184638_10152475 | 3300018052 | Groundwater Sediment | MIFEAALFLIFVLAMTVPIVKAYEWLQEFLYGPYINRRK |
| Ga0184626_100055796 | 3300018053 | Groundwater Sediment | MVLQKVGIERMIFEAALFLIFVLAMTVPIVKAYEWLQEFLYGPYINRRK |
| Ga0184621_100109414 | 3300018054 | Groundwater Sediment | MVLQKVGIERMIGEAALFLILVLAMTVPIVKAYEWLQDFLYGPYIDRRK |
| Ga0184618_100363914 | 3300018071 | Groundwater Sediment | MVLQKVGIERMIFEAALFLVLVPAMTVPIVKAYEWLQDFLYSPYINRRK |
| Ga0184609_102193131 | 3300018076 | Groundwater Sediment | MVLQKVGIERMIVEAALFLILVLAMMVPMVKAYEWLQDFLYGPYINRRK |
| Ga0066669_105298091 | 3300018482 | Grasslands Soil | MVLQKVGIERMIFEAALFLVLVLAMTVPIVKAYEWLQDFLYGPYINRGE |
| Ga0137408_10966081 | 3300019789 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKACEWLQDFLYGPYINRRK |
| Ga0193705_11037922 | 3300019869 | Soil | QKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYIDRRK |
| Ga0193722_11506312 | 3300019877 | Soil | FEAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE |
| Ga0193715_10721612 | 3300019878 | Soil | MALQKVGIERMIFEAGLFLILVLAMTVPIKAYEWLQDFLYGPYINRRK |
| Ga0193723_100087912 | 3300019879 | Soil | MIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0193713_10138362 | 3300019882 | Soil | MVLQKVGIERMIFEAALLFILILLMTIPIVKAYEWLQDFLYGPYIHRGK |
| Ga0193727_10142295 | 3300019886 | Soil | MIFEAALLFILILLMTIPIVKAYEWLQDFLYGPYIHRGK |
| Ga0193727_10333434 | 3300019886 | Soil | MVLQKVGIERMIFETALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0193729_12371211 | 3300019887 | Soil | MVLQKVGIERMIVEAALFLILVLAMTVPIVKAYEWLQD |
| Ga0193728_12384121 | 3300019890 | Soil | MALQKVGIERMIFEAGLFLILVLAMTVPIKAYEWLQDFL |
| Ga0193731_10544971 | 3300020001 | Soil | MALQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPY |
| Ga0193730_10380222 | 3300020002 | Soil | MALQKVGIERMIFEAALFLILVLVMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0193755_10043741 | 3300020004 | Soil | MALQKVGTERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPSINR |
| Ga0193755_10250671 | 3300020004 | Soil | MIVEAALFLILVLAMTVPIVKAYEWLQDFLYGPYIDRR |
| Ga0193755_11292363 | 3300020004 | Soil | MVLQKVGTERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0193726_100048729 | 3300020021 | Soil | MIFEAALFLVLILATTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0193745_10042523 | 3300020059 | Soil | MIFEAGLFLILVLAMTVPIKAYEWLQDFLYGPYINRRK |
| Ga0193724_10253681 | 3300020062 | Soil | MIFEAALLFILILLMTIPIVKAYEWLQDFLYGPYIHR |
| Ga0179592_104976382 | 3300020199 | Vadose Zone Soil | MIFEAALLFILILLMTIPIVKAYEWLQDFLYGPYI |
| Ga0210382_100096511 | 3300021080 | Groundwater Sediment | MVLQKVGIERMIFEAALFLVLVPAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0193719_101319643 | 3300021344 | Soil | MVLQKVGIERMIVEAALFLILVLAMMVPIVKAYEWLQDFLYGPYINR |
| Ga0193699_101042302 | 3300021363 | Soil | MVLQKVGIERMIFEAALFLMLVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0193699_103233421 | 3300021363 | Soil | MALQKVGIERMIFEAALFLVLILATTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0224452_12494621 | 3300022534 | Groundwater Sediment | MVLQKVGIERMIVEAALFLILVLAMMVPIVKAYEWLQDFLYGPYINRRK |
| Ga0137417_10098193 | 3300024330 | Vadose Zone Soil | MVLQKVGIERMILEATLFLVLILLMAAPIVKAYEWLQDFLYGPYINRGE |
| Ga0137417_10766046 | 3300024330 | Vadose Zone Soil | MILEATLFLVLILLMAAPIVKAYEWLQDFLYGPYINRGE |
| Ga0137417_10992102 | 3300024330 | Vadose Zone Soil | MVLQKVGIERMILEATLFLVLILLMAVPIVKAYEWLQDFLYGPYINRGE |
| Ga0209438_10249085 | 3300026285 | Grasslands Soil | MVLQKVGIERMIFEAALLFILILLMTIPIVKAYEWLQDFLYGPYIPRGK |
| Ga0209471_10449182 | 3300026318 | Soil | MIVEAALLLILILAMTIPTVKAYEWLQDFLYGPYINRGE |
| Ga0209131_10167945 | 3300026320 | Grasslands Soil | MVLQKVGIERMIFEAALFLIFVLIMTVLIVKAYEWLQEFLYGPYINRGE |
| Ga0257170_10523621 | 3300026351 | Soil | FEAALLFILILLMTIPIVKAYEWLQDFLYGPYIHRGK |
| Ga0257160_10770351 | 3300026489 | Soil | GSMIFEAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE |
| Ga0209648_103696512 | 3300026551 | Grasslands Soil | MFFEASLFLHFNLVTTVLIVKAYEWLQDFHYGPYINRGK |
| Ga0209213_10026895 | 3300027383 | Forest Soil | MILEATLFLVLILLMAVPIVKAYEWLQDFLYGPYINRGE |
| Ga0208995_10282782 | 3300027388 | Forest Soil | MIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINR |
| Ga0208993_10254782 | 3300027480 | Forest Soil | MVLQKVGIERMILEATLFLVLILLMAVPIVKAYEWLQDFLYGPYINRRK |
| Ga0208988_11581951 | 3300027633 | Forest Soil | MVLQKVGIERMIFEATLFLIFVLVMTVPIVKAYEWLQDFLYGPYINRGK |
| Ga0209076_10088343 | 3300027643 | Vadose Zone Soil | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPCINRRK |
| Ga0209118_10447482 | 3300027674 | Forest Soil | MIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRGE |
| Ga0209701_104724723 | 3300027862 | Vadose Zone Soil | VVLQKVGIERMIFEAALFLILILLMTVPIVKAYEWLQDFLYGPYINRGK |
| Ga0209283_100724525 | 3300027875 | Vadose Zone Soil | EAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE |
| Ga0209068_103591413 | 3300027894 | Watersheds | MALQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0209068_104438481 | 3300027894 | Watersheds | MVLQKVGIERMIFEAALFLILVLAMTVPIVKAYEWLQDFLYGPYNNRRK |
| Ga0209488_101080471 | 3300027903 | Vadose Zone Soil | RMIFEAALLLILILLITIPIVKAYEWLQDFLYGPYINRGE |
| Ga0209069_110397332 | 3300027915 | Watersheds | MIFKAGLLLILILLITIPIVKAYEWLQDFLYGPYINRGE |
| Ga0209526_102346361 | 3300028047 | Forest Soil | MVLQKVGIERMIFEAALFLILVLIMTVLIVKAYEWLQEFLYGPYINRGE |
| Ga0307311_101378563 | 3300028716 | Soil | IERMIFEAGLFLILVLAMTVPIKAYEWLQDFLYGPYINRRK |
| Ga0307296_102220133 | 3300028819 | Soil | QKVGIERMIVEAALFLILVLAMTVPIVKAYEWLQDFLYGPYINRRK |
| Ga0307278_100917193 | 3300028878 | Soil | MVLQKVGIERMIVEAALFLILVLAMMVPIVKAYEW |
| Ga0311348_111792752 | 3300030019 | Fen | KVGIARMIFEATLFLILIVLMAIPIVKAYEWLQDFLYGPYINRGK |
| Ga0311333_101581353 | 3300030114 | Fen | MIFEATLFLILIVLMAIPIVKAYEWLQDFLYGPYINRGK |
| Ga0307501_101626281 | 3300031152 | Soil | MALQKVGIERMIFEAALFLVLVPAMTIPIVKAYEWLQDFLYGPYINRRK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |