| Basic Information | |
|---|---|
| Family ID | F086519 |
| Family Type | Metagenome |
| Number of Sequences | 110 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MMADRSLGLVFWRVLDALDYWLTLTRLRILDALCGEGVEITADE |
| Number of Associated Samples | 64 |
| Number of Associated Scaffolds | 110 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 52.73 % |
| % of genes near scaffold ends (potentially truncated) | 40.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.64 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (41.818 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.545 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.364 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 110 Family Scaffolds |
|---|---|---|
| PF02586 | SRAP | 2.73 |
| PF13404 | HTH_AsnC-type | 0.91 |
| PF04964 | Flp_Fap | 0.91 |
| PF00486 | Trans_reg_C | 0.91 |
| PF12587 | DUF3761 | 0.91 |
| PF01695 | IstB_IS21 | 0.91 |
| PF04392 | ABC_sub_bind | 0.91 |
| PF06627 | DUF1153 | 0.91 |
| PF14534 | DUF4440 | 0.91 |
| PF00872 | Transposase_mut | 0.91 |
| COG ID | Name | Functional Category | % Frequency in 110 Family Scaffolds |
|---|---|---|---|
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 2.73 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.91 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.91 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.91 |
| COG3847 | Flp pilus assembly protein, pilin Flp | Extracellular structures [W] | 0.91 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2040502001|FACENC_GAMC6GA01AIFIZ | Not Available | 516 | Open in IMG/M |
| 3300005332|Ga0066388_102637407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 916 | Open in IMG/M |
| 3300005332|Ga0066388_102805778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 890 | Open in IMG/M |
| 3300005332|Ga0066388_102844720 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 884 | Open in IMG/M |
| 3300005332|Ga0066388_105709338 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 630 | Open in IMG/M |
| 3300005439|Ga0070711_101542641 | Not Available | 580 | Open in IMG/M |
| 3300005439|Ga0070711_101921118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 520 | Open in IMG/M |
| 3300005764|Ga0066903_100763397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1720 | Open in IMG/M |
| 3300005764|Ga0066903_100874640 | Not Available | 1621 | Open in IMG/M |
| 3300005764|Ga0066903_101320134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1349 | Open in IMG/M |
| 3300005764|Ga0066903_105503481 | Not Available | 668 | Open in IMG/M |
| 3300009098|Ga0105245_11091689 | Not Available | 844 | Open in IMG/M |
| 3300010046|Ga0126384_10320770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1281 | Open in IMG/M |
| 3300010046|Ga0126384_11256008 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 685 | Open in IMG/M |
| 3300010046|Ga0126384_11822944 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
| 3300010048|Ga0126373_12045959 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 635 | Open in IMG/M |
| 3300010048|Ga0126373_12873159 | Not Available | 537 | Open in IMG/M |
| 3300010048|Ga0126373_13287336 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300010358|Ga0126370_10665321 | Not Available | 909 | Open in IMG/M |
| 3300010359|Ga0126376_11443369 | Not Available | 714 | Open in IMG/M |
| 3300010360|Ga0126372_11882781 | Not Available | 643 | Open in IMG/M |
| 3300010361|Ga0126378_10858478 | Not Available | 1015 | Open in IMG/M |
| 3300010361|Ga0126378_11521969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 759 | Open in IMG/M |
| 3300010361|Ga0126378_11543144 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 753 | Open in IMG/M |
| 3300010361|Ga0126378_12872690 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 550 | Open in IMG/M |
| 3300010376|Ga0126381_100312253 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2157 | Open in IMG/M |
| 3300010376|Ga0126381_100832040 | Not Available | 1326 | Open in IMG/M |
| 3300010376|Ga0126381_101090318 | Not Available | 1153 | Open in IMG/M |
| 3300010376|Ga0126381_101504278 | Not Available | 973 | Open in IMG/M |
| 3300010376|Ga0126381_103473106 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 619 | Open in IMG/M |
| 3300010376|Ga0126381_105022052 | Not Available | 507 | Open in IMG/M |
| 3300010398|Ga0126383_11009152 | Not Available | 921 | Open in IMG/M |
| 3300012971|Ga0126369_11104213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 882 | Open in IMG/M |
| 3300016270|Ga0182036_10408847 | Not Available | 1059 | Open in IMG/M |
| 3300016270|Ga0182036_10764967 | Not Available | 785 | Open in IMG/M |
| 3300016294|Ga0182041_10138042 | Not Available | 1860 | Open in IMG/M |
| 3300016294|Ga0182041_10175962 | Not Available | 1680 | Open in IMG/M |
| 3300016357|Ga0182032_10589995 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 923 | Open in IMG/M |
| 3300016357|Ga0182032_11574812 | Not Available | 571 | Open in IMG/M |
| 3300016357|Ga0182032_11733425 | Not Available | 545 | Open in IMG/M |
| 3300016371|Ga0182034_11251202 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 646 | Open in IMG/M |
| 3300016404|Ga0182037_10570839 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 957 | Open in IMG/M |
| 3300016422|Ga0182039_10009825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5500 | Open in IMG/M |
| 3300016422|Ga0182039_10698741 | Not Available | 894 | Open in IMG/M |
| 3300016422|Ga0182039_11785640 | Not Available | 563 | Open in IMG/M |
| 3300020579|Ga0210407_10960083 | Not Available | 653 | Open in IMG/M |
| 3300020579|Ga0210407_11385285 | Not Available | 522 | Open in IMG/M |
| 3300020580|Ga0210403_10157028 | Not Available | 1861 | Open in IMG/M |
| 3300020580|Ga0210403_11477876 | Not Available | 512 | Open in IMG/M |
| 3300021168|Ga0210406_11316121 | Not Available | 520 | Open in IMG/M |
| 3300021178|Ga0210408_10658152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → unclassified Undibacterium → Undibacterium sp. KW1 | 827 | Open in IMG/M |
| 3300021405|Ga0210387_10241557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → unclassified Undibacterium → Undibacterium sp. KW1 | 1578 | Open in IMG/M |
| 3300021476|Ga0187846_10000073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 58100 | Open in IMG/M |
| 3300021560|Ga0126371_10381294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1549 | Open in IMG/M |
| 3300021560|Ga0126371_10725559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1141 | Open in IMG/M |
| 3300021560|Ga0126371_11093854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Polynucleobacter → Polynucleobacter paneuropaeus | 936 | Open in IMG/M |
| 3300021560|Ga0126371_11212521 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 891 | Open in IMG/M |
| 3300031057|Ga0170834_106565743 | Not Available | 671 | Open in IMG/M |
| 3300031057|Ga0170834_107719290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → unclassified Undibacterium → Undibacterium sp. KW1 | 647 | Open in IMG/M |
| 3300031128|Ga0170823_12419960 | Not Available | 530 | Open in IMG/M |
| 3300031231|Ga0170824_112306328 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 789 | Open in IMG/M |
| 3300031543|Ga0318516_10023950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3156 | Open in IMG/M |
| 3300031543|Ga0318516_10234538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1061 | Open in IMG/M |
| 3300031543|Ga0318516_10596425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| 3300031543|Ga0318516_10844485 | Not Available | 516 | Open in IMG/M |
| 3300031545|Ga0318541_10008054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 4604 | Open in IMG/M |
| 3300031545|Ga0318541_10132377 | Not Available | 1360 | Open in IMG/M |
| 3300031545|Ga0318541_10180565 | Not Available | 1165 | Open in IMG/M |
| 3300031561|Ga0318528_10171123 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1160 | Open in IMG/M |
| 3300031572|Ga0318515_10215926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300031680|Ga0318574_10397289 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 805 | Open in IMG/M |
| 3300031680|Ga0318574_10434265 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 768 | Open in IMG/M |
| 3300031682|Ga0318560_10503958 | Not Available | 656 | Open in IMG/M |
| 3300031713|Ga0318496_10159100 | Not Available | 1235 | Open in IMG/M |
| 3300031713|Ga0318496_10208519 | Not Available | 1075 | Open in IMG/M |
| 3300031719|Ga0306917_10232566 | Not Available | 1407 | Open in IMG/M |
| 3300031719|Ga0306917_11208060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300031736|Ga0318501_10149580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Undibacterium → unclassified Undibacterium → Undibacterium sp. KW1 | 1200 | Open in IMG/M |
| 3300031736|Ga0318501_10691330 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 562 | Open in IMG/M |
| 3300031747|Ga0318502_10130799 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1418 | Open in IMG/M |
| 3300031768|Ga0318509_10249324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 991 | Open in IMG/M |
| 3300031770|Ga0318521_10776997 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300031771|Ga0318546_10299387 | Not Available | 1113 | Open in IMG/M |
| 3300031795|Ga0318557_10250728 | Not Available | 811 | Open in IMG/M |
| 3300031805|Ga0318497_10428846 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 740 | Open in IMG/M |
| 3300031821|Ga0318567_10396606 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 782 | Open in IMG/M |
| 3300031890|Ga0306925_11295685 | Not Available | 724 | Open in IMG/M |
| 3300031910|Ga0306923_10757341 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1076 | Open in IMG/M |
| 3300031910|Ga0306923_12329127 | Not Available | 533 | Open in IMG/M |
| 3300031912|Ga0306921_11141415 | Not Available | 871 | Open in IMG/M |
| 3300031912|Ga0306921_12046656 | Not Available | 608 | Open in IMG/M |
| 3300031941|Ga0310912_10030466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3660 | Open in IMG/M |
| 3300031941|Ga0310912_10894251 | Not Available | 684 | Open in IMG/M |
| 3300031942|Ga0310916_10774512 | Not Available | 809 | Open in IMG/M |
| 3300031942|Ga0310916_10895856 | Not Available | 744 | Open in IMG/M |
| 3300031942|Ga0310916_11322004 | Not Available | 593 | Open in IMG/M |
| 3300031959|Ga0318530_10149470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 948 | Open in IMG/M |
| 3300032039|Ga0318559_10476156 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 583 | Open in IMG/M |
| 3300032041|Ga0318549_10552721 | Not Available | 517 | Open in IMG/M |
| 3300032043|Ga0318556_10320793 | Not Available | 810 | Open in IMG/M |
| 3300032044|Ga0318558_10382486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 700 | Open in IMG/M |
| 3300032051|Ga0318532_10124470 | Not Available | 913 | Open in IMG/M |
| 3300032054|Ga0318570_10492616 | Not Available | 559 | Open in IMG/M |
| 3300032059|Ga0318533_10039051 | Not Available | 3117 | Open in IMG/M |
| 3300032059|Ga0318533_10485844 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300032063|Ga0318504_10293567 | Not Available | 769 | Open in IMG/M |
| 3300032076|Ga0306924_10297274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1853 | Open in IMG/M |
| 3300032180|Ga0307471_104206472 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 508 | Open in IMG/M |
| 3300032261|Ga0306920_102620513 | Not Available | 691 | Open in IMG/M |
| 3300033289|Ga0310914_11718881 | Not Available | 531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 41.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 22.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 19.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.27% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.64% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.91% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.91% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.91% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2040502001 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2+ | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCE_5953800 | 2040502001 | Soil | VFWRVLDALDYWFTLTRLRILDALCGAAVEITADE |
| Ga0066388_1026374071 | 3300005332 | Tropical Forest Soil | MADGFLALVFWRVLDALDYWLALTQLRILDALCGAELETPADE* |
| Ga0066388_1028057781 | 3300005332 | Tropical Forest Soil | RKARRSMMADGLLVLVFWRVLDALDYRLTLTRLRILDALW* |
| Ga0066388_1028447202 | 3300005332 | Tropical Forest Soil | MMADRFLGLVFWRVLDALDYWLTLTRLRILDALCGEGVEITADE* |
| Ga0066388_1057093381 | 3300005332 | Tropical Forest Soil | DRPLGLVFWRVLDALDCWLTLTRLRILDALCGEGVEVTFRE* |
| Ga0070711_1015426411 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMMADRPLGLVFWRVLDALDYWLTLTRLRILDGLCGAELMTPADE* |
| Ga0070711_1019211181 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MMAGRPLGLVFWRVLDALGYWLTLARLRILDALCGDGVEIIGDD* |
| Ga0066903_1007633973 | 3300005764 | Tropical Forest Soil | MPNRSLGLVFWRVLDALDYWITLTRLRILDALCGEGVEITSGE* |
| Ga0066903_1008746402 | 3300005764 | Tropical Forest Soil | MMAVRIVLWRVLDALDYWLTVTRLRILDALCGEGLEVTFRE* |
| Ga0066903_1013201343 | 3300005764 | Tropical Forest Soil | MMADRPFGLIFWRVLDALDYWLTLMRLRTLDALCGAELRTPADE* |
| Ga0066903_1055034812 | 3300005764 | Tropical Forest Soil | MMADRSLGLVFWRVLDALDYWLTLTRLRILDALCREGVGITADE* |
| Ga0105245_110916891 | 3300009098 | Miscanthus Rhizosphere | MMTDRPFGLVFWRVLDALDYWLTLTRLRILDALCGEGVEITADE* |
| Ga0126384_103207702 | 3300010046 | Tropical Forest Soil | MPNRSLGLVFWRVLDALDYWLTLTRLRILDALCGEGVEITADE* |
| Ga0126384_112560082 | 3300010046 | Tropical Forest Soil | MMADRPLGLVFWRMLDAFDYWLTLTRLRILDALCGEALEITAGD* |
| Ga0126384_118229442 | 3300010046 | Tropical Forest Soil | MMAVKSLGLVFWRVLDVLDYWLTLTRLRILDALYGEGVEITARD* |
| Ga0126373_120459592 | 3300010048 | Tropical Forest Soil | MMANRPLGLVFWRVLDALDYWLTLTQLRILDALCGEGVEIITDE* |
| Ga0126373_128731591 | 3300010048 | Tropical Forest Soil | MMADRHLGLIFWRVLDALDYRLTLMRLRTLDALCGAELRKPADE* |
| Ga0126373_132873361 | 3300010048 | Tropical Forest Soil | MMADRFLGLVFWRVLDALDYWLTLTRLRILDALCGEGVDIIADE* |
| Ga0126370_106653213 | 3300010358 | Tropical Forest Soil | LVFWRVLDALDYWLTLTRLRILDGLCGAELMTPADE* |
| Ga0126376_114433691 | 3300010359 | Tropical Forest Soil | MMADKFLRLVFWRVLDALDYWLTLTQLRILDALCGEGVEITTDE* |
| Ga0126372_118827811 | 3300010360 | Tropical Forest Soil | LGLVFWRVLDALNHWLTLTRLRILDALCGEGVEITSGE* |
| Ga0126378_108584783 | 3300010361 | Tropical Forest Soil | MMANRSLGLVFWWVLDALDYWLTLTQLRILDALCGERVEITTDE* |
| Ga0126378_115219692 | 3300010361 | Tropical Forest Soil | MMANRPLGLVFWRVLDALDYWLTLTQLRILDALCGGDNY* |
| Ga0126378_115431441 | 3300010361 | Tropical Forest Soil | MMADRPLGLLFWRVLDALEYWQTLTQLRILDALCGEGVEITTDE* |
| Ga0126378_128726901 | 3300010361 | Tropical Forest Soil | MMADRSLGLVFWRVLDALDYWFTLTRLRILDALCGEGVEIKSGE* |
| Ga0126381_1003122531 | 3300010376 | Tropical Forest Soil | MMADKPLELVFWRVLDAPDYWLTLTRLRILDALCGEGVEITANE* |
| Ga0126381_1008320402 | 3300010376 | Tropical Forest Soil | MMADRPLRLVFWRVLDALEYWFILTQLRILDALCGEGIEIITDE* |
| Ga0126381_1010903183 | 3300010376 | Tropical Forest Soil | MMADRPFGLVFWRVLDALDYWLTLTRLRILDGLCGAELMTPADE* |
| Ga0126381_1015042782 | 3300010376 | Tropical Forest Soil | MMADKPLGLVFWQLLDALDYWLTLTRLRILDAPCGERLEITAGD* |
| Ga0126381_1034731061 | 3300010376 | Tropical Forest Soil | MMADRPLGLLFWRVLDALEYWLTLTQLRILDALCGEGVEITTDE* |
| Ga0126381_1050220521 | 3300010376 | Tropical Forest Soil | MMADKPLGLVFWRVLDALDYWLTLTRLRIQDALCREGVGITADE* |
| Ga0126383_110091521 | 3300010398 | Tropical Forest Soil | MMADRPFGLIFWRVLDALDYWLTLMRLRTLDALCG |
| Ga0126369_111042133 | 3300012971 | Tropical Forest Soil | MMADRSLGLVFWRVLDALDYWLTLTRLRILDALCGEGVEITADE* |
| Ga0182036_104088471 | 3300016270 | Soil | MADRSLSLRLVFWRVLDALDYWLTLTQLRILDALCVEELKITADE |
| Ga0182036_107649671 | 3300016270 | Soil | MMDDKSRRLVFWWVLDALDYWFTLTRLRILDALCCEG |
| Ga0182041_101380421 | 3300016294 | Soil | MMDDKFRGLVFWRVLDALDYWLTVTRLRILDALCGEGAEIKTDE |
| Ga0182041_101759621 | 3300016294 | Soil | MMADKSLGLVCWRVRDALDYWLTLTQLRILDALCGEG |
| Ga0182032_105899952 | 3300016357 | Soil | MIANRSLGLVFWRVLVDYWLTLTQLRILDALCGEGIEITPDE |
| Ga0182032_115748122 | 3300016357 | Soil | MMADRPFGLVFWRVLDALDYWLTLTRLRILDGLCGEKLMTPADE |
| Ga0182032_117334251 | 3300016357 | Soil | MMDDKSRGLVFWRVLDALDYWLTLTQLRILDTLCGERVEITTDD |
| Ga0182034_112512022 | 3300016371 | Soil | MMAVRIVLWRVLDALDYWLTLTRLRILDALCGEGVEITFRE |
| Ga0182037_105708392 | 3300016404 | Soil | MMADKSLGLVFWRVLDALDYWLTLAQLRILDALCDEGIEMTTDE |
| Ga0182039_100098251 | 3300016422 | Soil | MMADKSLGLVFWRVLDSLDYWLTLTQLRILDALCGEG |
| Ga0182039_106987412 | 3300016422 | Soil | VSNPPLQRLPSMMADKSLRLVFWRVIDALDYWLTLAQLRILDALCGDGVEITTDD |
| Ga0182039_117856401 | 3300016422 | Soil | NRSLGLVFWRVLDALDFWFTLAQLRMLDALCGEGLEITADD |
| Ga0210407_109600831 | 3300020579 | Soil | MMADRPLGLVFWRVFDALDYWLTLTRLRILDALCGEGVEITADE |
| Ga0210407_113852851 | 3300020579 | Soil | MMAHRPLGLVFWRVLDALDYWFTLTRLRILDALCGAAVQITADE |
| Ga0210403_101570284 | 3300020580 | Soil | MMADRPLGLVFWRVLDALDYWLTLTRLRILDALCGEAVEINAD |
| Ga0210403_114778762 | 3300020580 | Soil | MMADRPLWLGFWQVLDALDYWLTLTRLRLLDPLCAEGLEITADE |
| Ga0210406_113161212 | 3300021168 | Soil | MMADRPLGFVFWRVLDALDYWLTLTRLRVLDALCGEGIEITADG |
| Ga0210408_106581521 | 3300021178 | Soil | MMADGSLGRIFWRVLDVLDYWLTLTRLRILDALCGTELQTPGD |
| Ga0210387_102415574 | 3300021405 | Soil | MMADRPLGLVFWRVLDALDYWLTLTRLRILDALCGAELQTPADE |
| Ga0187846_1000007332 | 3300021476 | Biofilm | MMADRSLGLVFWRVLDALDYWLTLTRLRILDALCGAELHTPADE |
| Ga0126371_103812942 | 3300021560 | Tropical Forest Soil | MMADGALGIVFWRVLDALDYWLTLTQLRILDALCGKGVEITTGD |
| Ga0126371_107255594 | 3300021560 | Tropical Forest Soil | MMADRFLGLVSWRVLDALDYWLTLTRLRILDALCG |
| Ga0126371_110938541 | 3300021560 | Tropical Forest Soil | LGLVLWRVLDALDYWLILTRLRVLDALCGEGVEIIADD |
| Ga0126371_112125211 | 3300021560 | Tropical Forest Soil | MMAVRIVLWRVLDALDYWLTVTRLRILDALGGEGLEVTFRE |
| Ga0170834_1065657431 | 3300031057 | Forest Soil | SMMANESIGLIFWRVLDVLDYWLTLTRLRILDALCGTELPGDE |
| Ga0170834_1077192902 | 3300031057 | Forest Soil | MMADRPLGLVFWRVLDALDYWLTLTRLRILDALCGEGVEINADE |
| Ga0170823_124199601 | 3300031128 | Forest Soil | LMMADGSLGLIFWRVLDVLDYWLTLTRLRILDALCGAELPTPADE |
| Ga0170824_1123063282 | 3300031231 | Forest Soil | MMADRPLGLVFWRVLDALDYWLTLTRLRILDALCGEGVEVTADE |
| Ga0318516_100239501 | 3300031543 | Soil | MADKSLGLVCWRVRDALDYWLTLTQLRILDALCGEGVEITTDE |
| Ga0318516_102345382 | 3300031543 | Soil | MMDDKFRGLVFWRVLDALDYWLTVTRLRILDALCGEGVEIKTDE |
| Ga0318516_105964252 | 3300031543 | Soil | MMADKSLGLVFWRVLDALDCWLTLTRLRILDAICGAELETPADD |
| Ga0318516_108444852 | 3300031543 | Soil | MMADRPLGLVFWRVLDALDYWLTLTQLRILDVLCGEGVEITADE |
| Ga0318541_100080543 | 3300031545 | Soil | MMADKSLGLVFWRVLDSLDYWLTLTQLRILDALCGEGVEITTDE |
| Ga0318541_101323772 | 3300031545 | Soil | MMADKSLGLVCWRVRDALDYWLTLTQLRILDALCGEGVEITTD |
| Ga0318541_101805653 | 3300031545 | Soil | MMDDKSRRLVFWWVLDALDYWFTLTRLRILDALCCEGV |
| Ga0318528_101711232 | 3300031561 | Soil | MMDDKSRGLVFWRVLDALDYWLTLTQLRILDALCGRGVEITTDE |
| Ga0318515_102159261 | 3300031572 | Soil | QSSTNSARSMTDDKSLGLVFWRVLDALDYWLTLTQLRILDALCGEGVEITTD |
| Ga0318574_103972893 | 3300031680 | Soil | MMADKSLGLVFWRVLDALDCWLTLTGLRILDAICGAELET |
| Ga0318574_104342651 | 3300031680 | Soil | MMDDKSRRLVFWWVLDALDYWFTLTRLRILDALCCEGVEITTDE |
| Ga0318560_105039582 | 3300031682 | Soil | MMDDKSRGLVFWRVLDALDYWLTLTQLRILDALCGRGVE |
| Ga0318496_101591002 | 3300031713 | Soil | MMADKSLGLVFWRVLDSLDYWLTLTQLRILDALCGEGVEITTD |
| Ga0318496_102085191 | 3300031713 | Soil | MMDDKSRGLVFWRVLDALDYWLTLTQLRILDALCGRGVEI |
| Ga0306917_102325662 | 3300031719 | Soil | MMADKSLGLVFWRVLDALDYWLTLAQLRILDALCDEGIEMT |
| Ga0306917_112080602 | 3300031719 | Soil | MMADRSLRLVFWRVLDALDYWLTLTQLRILDALCGEGVGITADE |
| Ga0318501_101495803 | 3300031736 | Soil | MMADKSLGLVCWRVRDALDYWLTLTQLRILDALCGEGVEITTDE |
| Ga0318501_106913301 | 3300031736 | Soil | LVFWWVLDALDYWFTLTRLRILDALCCEGVEITTDE |
| Ga0318502_101307992 | 3300031747 | Soil | MMADKSLGLVFWRVLDALDCWLTLTGLRILDAICGAELETPADD |
| Ga0318509_102493244 | 3300031768 | Soil | RRLVFWWVLDALDYWFTLTRLRILDALCCEGVEITTDE |
| Ga0318521_107769972 | 3300031770 | Soil | MMAVRIVLWRVLDYWLTLTRLRILDALCGEGVEITFRE |
| Ga0318546_102993873 | 3300031771 | Soil | MMADRPLGLVFWRVLDALDYWLTLTQLRILDVLCGEGVE |
| Ga0318557_102507283 | 3300031795 | Soil | VFWRVLDSLDYWLTLTQLRILDALCGEGVEITTDE |
| Ga0318497_104288463 | 3300031805 | Soil | VLWRVLDALDYWLTLTRLRILDALCGEGVEITFRE |
| Ga0318567_103966062 | 3300031821 | Soil | SMMDDKFRGLVFWRVLDALDYWLTVTRLRILDALCGEGVEIKTDE |
| Ga0306925_112956852 | 3300031890 | Soil | MADRSLSLRLVFWRVLDALDYWLTLTRLRILDALCGAELQTPADE |
| Ga0306923_107573413 | 3300031910 | Soil | MIAVWIVLWRVLDALDYWLTLTRLRILDALCGEGVEITFRE |
| Ga0306923_123291271 | 3300031910 | Soil | MMADKSLRLVFWRVIDALDYWLTLAQLRILDALCGDGVEITTDD |
| Ga0306921_111414151 | 3300031912 | Soil | MMADRSLRLVFWRVLDALDYWLTLTQLRILDALCGAGVGITADE |
| Ga0306921_120466561 | 3300031912 | Soil | MMVDKSLGLVFWRVLDALDYWLTLTQLRILDTLCGERVEITTDD |
| Ga0310912_100304663 | 3300031941 | Soil | MADKSLGLVFWRVLDALDCWLTLTRLRILDAICGAELETPADD |
| Ga0310912_108942512 | 3300031941 | Soil | MIANRSLGLVFWRVLVDYWLTLTQLRILDALCGEGLEITT |
| Ga0310916_107745121 | 3300031942 | Soil | MADKSLGLVFWRVLDALDYWLTLAQLRILDALCDEGIEM |
| Ga0310916_108958561 | 3300031942 | Soil | MMADRSLRLVFWRVLDALDYWLTLTQLRILDALCGEGVG |
| Ga0310916_113220041 | 3300031942 | Soil | MIANRSLGLVFWRVLVDYWLTLTQLRILDALCGEGLE |
| Ga0318530_101494703 | 3300031959 | Soil | PSMMADKSLGLVFWRVLDSLDYWLTLTQLRILDALCGEGVEITTDE |
| Ga0318559_104761561 | 3300032039 | Soil | FRGLVFWRVLDALDYWLTVTRLRILDALCGEGVEIKTDE |
| Ga0318549_105527212 | 3300032041 | Soil | MMTYRSPELVFWRVLDALDYWLTLTRLRILDVLCGAG |
| Ga0318556_103207931 | 3300032043 | Soil | MADKSLGLVFWRVLDSLDYWLTLTQLRILDALCGEGVEITTD |
| Ga0318558_103824861 | 3300032044 | Soil | DKSLGLVFWRVLDALDYWLTLTQLRILDALCVEELKITADE |
| Ga0318532_101244703 | 3300032051 | Soil | LLPRRVLTPSLRRLPSMMADKSLGLVFWRVLDSLDYWLTLTQLRILDALCGEGVEITTDE |
| Ga0318570_104926161 | 3300032054 | Soil | SARSMTDDKSLGLVFWRVLDALDYWLTLTQLRILDALCVEELKITADE |
| Ga0318533_100390516 | 3300032059 | Soil | MADRPLGLVFWRVLDALDYWLTLTQLRILDVLCGEGVEITADE |
| Ga0318533_104858441 | 3300032059 | Soil | MIANRSLGLVFWRVLVDYWLTLTQLRILDALCGEGIEITTDE |
| Ga0318504_102935671 | 3300032063 | Soil | MADKSLGLVCWRVRDALDYWLTLTQLRILDALCGEGVEITTD |
| Ga0306924_102972745 | 3300032076 | Soil | LIDMADRSLSLRLVFWRVLDALDYWLTLTRLRILDALCGAELQTPADE |
| Ga0307471_1042064721 | 3300032180 | Hardwood Forest Soil | MMANCPFGLVFWRVLDALDYWFTLTRLRILDALCGEGLEITADQ |
| Ga0306920_1026205132 | 3300032261 | Soil | MMADKSLRLVFWWVIDALDYWLTLAQLRILDALCGDGVEITTDD |
| Ga0310914_117188811 | 3300033289 | Soil | MIANRSLGLVFWRVLVDYWLTLTQLRILDALCGEGME |
| ⦗Top⦘ |