NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086511

Metagenome Family F086511

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086511
Family Type Metagenome
Number of Sequences 110
Average Sequence Length 66 residues
Representative Sequence MKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK
Number of Associated Samples 88
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 53.15 %
% of genes near scaffold ends (potentially truncated) 53.64 %
% of genes from short scaffolds (< 2000 bps) 73.64 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (45.455 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater
(52.727 % of family members)
Environment Ontology (ENVO) Unclassified
(90.909 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(97.273 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.85%    β-sheet: 12.12%    Coil/Unstructured: 53.03%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF07120DUF1376 47.27
PF14549P22_Cro 12.73
PF00145DNA_methylase 9.09
PF04404ERF 5.45
PF01507PAPS_reduct 3.64
PF16786RecA_dep_nuc 1.82
PF13392HNH_3 1.82
PF01555N6_N4_Mtase 0.91
PF01242PTPS 0.91
PF09374PG_binding_3 0.91
PF15943YdaS_antitoxin 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG3756Uncharacterized conserved protein YdaU, DUF1376 familyFunction unknown [S] 47.27
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 9.09
COG07206-pyruvoyl-tetrahydropterin synthaseCoenzyme transport and metabolism [H] 0.91
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.91
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.91
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.82 %
UnclassifiedrootN/A18.18 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000162|TB03JUN2009H_c016797All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage884Open in IMG/M
3300000162|TB03JUN2009H_c020287All Organisms → cellular organisms → Bacteria → Proteobacteria753Open in IMG/M
3300000176|TB03JUN2009E_c028930All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300000203|TB18AUG2009E_c008889All Organisms → cellular organisms → Bacteria → Proteobacteria1308Open in IMG/M
3300002091|JGI24028J26656_1007120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1549Open in IMG/M
3300002092|JGI24218J26658_1011893All Organisms → cellular organisms → Bacteria → Proteobacteria1391Open in IMG/M
3300002098|JGI24219J26650_1005751All Organisms → cellular organisms → Bacteria → Proteobacteria2476Open in IMG/M
3300002098|JGI24219J26650_1018091Not Available990Open in IMG/M
3300002307|JGI24890J29729_1006269Not Available3629Open in IMG/M
3300002933|G310J44882_10014722Not Available2169Open in IMG/M
3300002933|G310J44882_10015098All Organisms → cellular organisms → Bacteria2129Open in IMG/M
3300003375|JGI26470J50227_1034451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage981Open in IMG/M
3300003375|JGI26470J50227_1039230All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria888Open in IMG/M
3300003785|Ga0007851_101595Not Available1394Open in IMG/M
3300003785|Ga0007851_105236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300003789|Ga0007835_1000536Not Available5302Open in IMG/M
3300003796|Ga0007865_1018550Not Available654Open in IMG/M
3300003797|Ga0007846_1003247All Organisms → cellular organisms → Bacteria2068Open in IMG/M
3300003803|Ga0007849_1001902All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1318Open in IMG/M
3300003804|Ga0007817_1008590All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia gladioli704Open in IMG/M
3300003805|Ga0007838_1000002All Organisms → cellular organisms → Bacteria → Proteobacteria25379Open in IMG/M
3300003809|Ga0007869_1002618All Organisms → cellular organisms → Bacteria → Proteobacteria2411Open in IMG/M
3300003813|Ga0007879_1003153All Organisms → cellular organisms → Bacteria2540Open in IMG/M
3300003814|Ga0007877_1004598All Organisms → cellular organisms → Bacteria → Proteobacteria1997Open in IMG/M
3300003819|Ga0007878_1004472All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1633Open in IMG/M
3300003819|Ga0007878_1023448All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus519Open in IMG/M
3300003824|Ga0007874_1008404Not Available926Open in IMG/M
3300003828|Ga0007868_1005076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1093Open in IMG/M
3300004694|Ga0065170_1016768All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage981Open in IMG/M
3300004777|Ga0007827_10007090Not Available2939Open in IMG/M
3300004806|Ga0007854_10153126All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1010Open in IMG/M
3300004807|Ga0007809_10018396Not Available2472Open in IMG/M
3300006072|Ga0007881_1036225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1316Open in IMG/M
3300006072|Ga0007881_1043854All Organisms → cellular organisms → Bacteria → Proteobacteria1177Open in IMG/M
3300006100|Ga0007806_1009940All Organisms → cellular organisms → Bacteria → Proteobacteria2245Open in IMG/M
3300006104|Ga0007882_10165092All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300006105|Ga0007819_1050786All Organisms → cellular organisms → Bacteria → Proteobacteria890Open in IMG/M
3300006106|Ga0007833_1028539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1059Open in IMG/M
3300006108|Ga0007862_1028401Not Available1211Open in IMG/M
3300006110|Ga0007871_1006671All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2426Open in IMG/M
3300006114|Ga0007815_1023958All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1384Open in IMG/M
3300006120|Ga0007867_1041534All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1015Open in IMG/M
3300006124|Ga0007873_1024236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1010Open in IMG/M
3300009175|Ga0073936_10013958Not Available9384Open in IMG/M
3300009502|Ga0114951_10109994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1557Open in IMG/M
3300009502|Ga0114951_10201239All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1066Open in IMG/M
3300009502|Ga0114951_10233122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage971Open in IMG/M
3300009502|Ga0114951_10401670All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage683Open in IMG/M
3300013093|Ga0164296_1088007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1332Open in IMG/M
3300013094|Ga0164297_10051954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1992Open in IMG/M
3300020681|Ga0214253_117306Not Available551Open in IMG/M
3300020683|Ga0214234_105165All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium1399Open in IMG/M
3300020685|Ga0214256_101250All Organisms → cellular organisms → Bacteria → Proteobacteria3189Open in IMG/M
3300020686|Ga0214194_101250All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2968Open in IMG/M
3300020686|Ga0214194_103843All Organisms → cellular organisms → Bacteria → Proteobacteria1469Open in IMG/M
3300020689|Ga0214210_1019046Not Available571Open in IMG/M
3300020694|Ga0214197_1015562All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage731Open in IMG/M
3300020695|Ga0214190_1006115All Organisms → cellular organisms → Bacteria → Proteobacteria1577Open in IMG/M
3300020707|Ga0214238_1021116All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage741Open in IMG/M
3300020721|Ga0214236_1012675All Organisms → cellular organisms → Bacteria → Proteobacteria1266Open in IMG/M
3300020725|Ga0214200_1038888All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage759Open in IMG/M
3300020726|Ga0214220_1000426Not Available15182Open in IMG/M
3300020730|Ga0214216_1001637Not Available5863Open in IMG/M
3300020731|Ga0214170_1016498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1327Open in IMG/M
3300020731|Ga0214170_1020102All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1158Open in IMG/M
3300020735|Ga0214219_1015157Not Available1366Open in IMG/M
3300021115|Ga0214174_102429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1713Open in IMG/M
3300021121|Ga0214173_106349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1318Open in IMG/M
3300021121|Ga0214173_107061Not Available1232Open in IMG/M
3300021121|Ga0214173_110019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1003Open in IMG/M
3300021131|Ga0214206_1005416All Organisms → Viruses → Predicted Viral2159Open in IMG/M
3300022555|Ga0212088_10014802Not Available11415Open in IMG/M
3300022555|Ga0212088_10324259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1094Open in IMG/M
3300022555|Ga0212088_10358345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1012Open in IMG/M
3300022555|Ga0212088_10389891All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300022591|Ga0236341_1025746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1721Open in IMG/M
3300023311|Ga0256681_12368202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1699Open in IMG/M
3300025162|Ga0209083_1030743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2507Open in IMG/M
3300025353|Ga0208255_109165All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage932Open in IMG/M
3300025358|Ga0208504_1017257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage992Open in IMG/M
3300025363|Ga0208385_1009420All Organisms → cellular organisms → Bacteria → Proteobacteria1296Open in IMG/M
3300025365|Ga0208621_1005614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1473Open in IMG/M
3300025366|Ga0208505_1009173All Organisms → cellular organisms → Bacteria → Proteobacteria1458Open in IMG/M
3300025368|Ga0208620_1009373All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1220Open in IMG/M
3300025369|Ga0208382_1000787Not Available9728Open in IMG/M
3300025369|Ga0208382_1008117All Organisms → Viruses → Predicted Viral1795Open in IMG/M
3300025372|Ga0207957_1010536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1274Open in IMG/M
3300025372|Ga0207957_1011001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1238Open in IMG/M
3300025375|Ga0208259_1006693All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1901Open in IMG/M
3300025378|Ga0207960_1001869All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3590Open in IMG/M
3300025381|Ga0208871_1004575All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2674Open in IMG/M
3300025381|Ga0208871_1013772All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1293Open in IMG/M
3300025387|Ga0207959_1038148All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage748Open in IMG/M
3300025392|Ga0208380_1035914All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage760Open in IMG/M
3300025398|Ga0208251_1004818All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2951Open in IMG/M
3300025400|Ga0208387_1006062All Organisms → cellular organisms → Bacteria2568Open in IMG/M
3300025413|Ga0208614_1004074All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3204Open in IMG/M
3300025413|Ga0208614_1013405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1430Open in IMG/M
3300025418|Ga0208253_1006668Not Available2904Open in IMG/M
3300025418|Ga0208253_1021687All Organisms → cellular organisms → Bacteria → Proteobacteria1283Open in IMG/M
3300025420|Ga0208111_1057052All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage613Open in IMG/M
3300025429|Ga0208500_1010264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1413Open in IMG/M
3300025430|Ga0208622_1019705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1407Open in IMG/M
3300025450|Ga0208744_1040449All Organisms → cellular organisms → Bacteria → Proteobacteria952Open in IMG/M
3300025648|Ga0208507_1016433All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2894Open in IMG/M
3300025723|Ga0208741_10057217All Organisms → cellular organisms → Bacteria → Proteobacteria884Open in IMG/M
3300025783|Ga0208258_1006535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1983Open in IMG/M
3300031759|Ga0316219_1099961All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → Burkholderia gladioli1113Open in IMG/M
3300031813|Ga0316217_10091422All Organisms → Viruses → Predicted Viral1430Open in IMG/M
3300032665|Ga0316221_1117267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage955Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater52.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater13.64%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater13.64%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.36%
LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic4.55%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion4.55%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater2.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000162Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300000176Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300000203Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300002091Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenomeEnvironmentalOpen in IMG/M
3300002092Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenomeEnvironmentalOpen in IMG/M
3300002098Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenomeEnvironmentalOpen in IMG/M
3300002307Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7EnvironmentalOpen in IMG/M
3300002933Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USAEnvironmentalOpen in IMG/M
3300003375Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6EnvironmentalOpen in IMG/M
3300003785Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08EnvironmentalOpen in IMG/M
3300003789Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08EnvironmentalOpen in IMG/M
3300003796Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09EnvironmentalOpen in IMG/M
3300003797Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07EnvironmentalOpen in IMG/M
3300003803Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH13Jun08EnvironmentalOpen in IMG/M
3300003804Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09EnvironmentalOpen in IMG/M
3300003805Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun08EnvironmentalOpen in IMG/M
3300003809Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09EnvironmentalOpen in IMG/M
3300003813Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09EnvironmentalOpen in IMG/M
3300003814Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09EnvironmentalOpen in IMG/M
3300003819Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH23Jun09EnvironmentalOpen in IMG/M
3300003824Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08EnvironmentalOpen in IMG/M
3300003828Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29May08EnvironmentalOpen in IMG/M
3300004694Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2)EnvironmentalOpen in IMG/M
3300004777Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Jul07EnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300004807Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07EnvironmentalOpen in IMG/M
3300006072Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09EnvironmentalOpen in IMG/M
3300006100Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09EnvironmentalOpen in IMG/M
3300006104Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1EnvironmentalOpen in IMG/M
3300006105Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09EnvironmentalOpen in IMG/M
3300006106Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Jul07EnvironmentalOpen in IMG/M
3300006108Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07EnvironmentalOpen in IMG/M
3300006110Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09EnvironmentalOpen in IMG/M
3300006114Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09EnvironmentalOpen in IMG/M
3300006120Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08EnvironmentalOpen in IMG/M
3300006124Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08EnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300020681Freshwater microbial communities from Trout Bog Lake, WI - 21JUL2009 hypolimnionEnvironmentalOpen in IMG/M
3300020683Freshwater microbial communities from Trout Bog Lake, WI - 08JUL2008 hypolimnionEnvironmentalOpen in IMG/M
3300020685Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 hypolimnionEnvironmentalOpen in IMG/M
3300020686Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnionEnvironmentalOpen in IMG/M
3300020689Freshwater microbial communities from Trout Bog Lake, WI - 03AUG2009 epilimnionEnvironmentalOpen in IMG/M
3300020694Freshwater microbial communities from Trout Bog Lake, WI - 09SEP2008 epilimnionEnvironmentalOpen in IMG/M
3300020695Freshwater microbial communities from Trout Bog Lake, WI - 15JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300020707Freshwater microbial communities from Trout Bog Lake, WI - 05AUG2008 hypolimnionEnvironmentalOpen in IMG/M
3300020721Freshwater microbial communities from Trout Bog Lake, WI - 28JUL2008 hypolimnionEnvironmentalOpen in IMG/M
3300020725Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 epilimnionEnvironmentalOpen in IMG/M
3300020726Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 hypolimnionEnvironmentalOpen in IMG/M
3300020730Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 hypolimnionEnvironmentalOpen in IMG/M
3300020731Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnionEnvironmentalOpen in IMG/M
3300020735Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 hypolimnionEnvironmentalOpen in IMG/M
3300021115Freshwater microbial communities from Trout Bog Lake, WI - 31JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021121Freshwater microbial communities from Trout Bog Lake, WI - 25JUL2007 epilimnionEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022591Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2EnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025353Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025358Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH05Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025363Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH11Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025365Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025366Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025368Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Jun08 (SPAdes)EnvironmentalOpen in IMG/M
3300025369Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE28Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025372Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025375Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025378Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025381Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025387Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH20Aug07 (SPAdes)EnvironmentalOpen in IMG/M
3300025392Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes)EnvironmentalOpen in IMG/M
3300025398Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025400Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025413Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025418Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (SPAdes)EnvironmentalOpen in IMG/M
3300025420Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025429Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (SPAdes)EnvironmentalOpen in IMG/M
3300025430Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Jul09 (SPAdes)EnvironmentalOpen in IMG/M
3300025450Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 (SPAdes)EnvironmentalOpen in IMG/M
3300025648Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes)EnvironmentalOpen in IMG/M
3300025723Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025783Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300032665Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TB03JUN2009H_01679733300000162FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
TB03JUN2009H_02028723300000162FreshwaterDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
TB03JUN2009E_02893013300000176FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
TB18AUG2009E_00888933300000203FreshwaterANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK*
JGI24028J26656_100712043300002091LenticEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRNKKQK*
JGI24218J26658_101189313300002092LenticSSLWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYXIKPEEAETVIQPKRTKKQK*
JGI24219J26650_100575163300002098LenticSSLWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK*
JGI24219J26650_101809113300002098LenticKLYGSSSLWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRNKKQK*
JGI24890J29729_100626993300002307LenticMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRITPEKDGSPTIARAKAIAQKVLKNRNK*
G310J44882_1001472223300002933FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
G310J44882_1001509883300002933FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
JGI26470J50227_103445133300003375FreshwaterKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAVDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
JGI26470J50227_103923023300003375FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
Ga0007851_10159523300003785FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETIVQPKRTKKQK*
Ga0007851_10523633300003785FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIEPEETEIVVQPKRTKKQK*
Ga0007835_100053633300003789FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK*
Ga0007865_101855023300003796FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVXILTKAIDEXXIKPEEXETVIQPKRTKKQK*
Ga0007846_100324733300003797FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVXILTKAIDEXXIKPEEXETVXQPKRTKKXK*
Ga0007849_100190233300003803FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEXETXXQPKRTKKXK*
Ga0007817_100859013300003804FreshwaterNKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK*
Ga0007838_100000223300003805FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETVVQPKRTKKQK*
Ga0007869_100261813300003809FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRIKPEEAETVIQPKRTKKQK*
Ga0007879_100315333300003813FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVXQPKRTKKXK*
Ga0007877_100459823300003814FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK*
Ga0007878_100447233300003819FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEXRIXPEEAETVIQPKRTKKQK*
Ga0007878_102344823300003819FreshwaterNKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVVQPKRTKKQK*
Ga0007874_100840433300003824FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRTKKQK*
Ga0007868_100507623300003828FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVVQPKRTKKQK*
Ga0065170_101676833300004694FreshwaterNAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK*
Ga0007827_1000709023300004777FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEETENVIQPKRTKKQK*
Ga0007854_1015312613300004806FreshwaterIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETIVQPKRTKKQK*
Ga0007809_1001839613300004807FreshwaterENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK*
Ga0007881_103622513300006072FreshwaterNKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK*
Ga0007881_104385443300006072FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK*
Ga0007806_100994063300006100FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK*
Ga0007882_1016509223300006104FreshwaterGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK*
Ga0007819_105078613300006105FreshwaterIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK*
Ga0007833_102853923300006106FreshwaterMKIDVKIIKENKDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
Ga0007862_102840143300006108FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIEPEETEIAIQSKRTKKQK*
Ga0007871_100667113300006110FreshwaterWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK*
Ga0007815_102395813300006114FreshwaterAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK*
Ga0007867_104153423300006120FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK*
Ga0007873_102423613300006124FreshwaterIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRTKKQK*
Ga0073936_10013958173300009175Freshwater Lake HypolimnionMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRITPEEDGSPTIARAKAVAQKRTKKQK*
Ga0114951_1010999413300009502FreshwaterVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRNKKQK*
Ga0114951_1020123933300009502FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEETETVIQPKRTKKQI*
Ga0114951_1023312223300009502FreshwaterVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK*
Ga0114951_1040167013300009502FreshwaterNAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRNKKQK*
Ga0164296_108800743300013093FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQ
Ga0164297_1005195443300013094FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPIIARAKAVAQKRTKKQK*
Ga0214253_11730633300020681FreshwaterMKISVKIIKENEDGSANAQVDFDKEGIETLVQWGLVALLTKAVDEYRITPEKDGSPTIARAK
Ga0214234_10516553300020683FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAVDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214256_10125013300020685FreshwaterANAQVDFDKEGLETLVQWGLVGILTKAIDEYRITPEKDESPTIARAKAVAQKRTKKQK
Ga0214194_10125013300020686FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAVDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214194_10384343300020686FreshwaterNAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK
Ga0214210_101904633300020689FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214197_101556233300020694FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0214190_100611523300020695FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0214238_102111633300020707FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214236_101267523300020721FreshwaterSLWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAVDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214200_103888833300020725FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDESPTIARAKAV
Ga0214220_1000426243300020726FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214216_1001637143300020730FreshwaterMKIDVKIIKENKDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214170_101649833300020731FreshwaterGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRITPKKDGSPTIARAKAVAQKRTKKQK
Ga0214170_102010213300020731FreshwaterGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0214219_101515713300020735FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0214174_10242923300021115FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0214173_10634933300021121FreshwaterNAQVDFDKEGLETLVQWGLVGILTKAIDEYRITPKKDGSPTIARAKAVAQKRTKKQK
Ga0214173_10706123300021121FreshwaterVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK
Ga0214173_11001923300021121FreshwaterWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0214206_100541613300021131FreshwaterIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0212088_1001480223300022555Freshwater Lake HypolimnionMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRITPEEDGSPTIARAKAVAQKRTKKQK
Ga0212088_1032425913300022555Freshwater Lake HypolimnionDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRNKKQK
Ga0212088_1035834513300022555Freshwater Lake HypolimnionDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK
Ga0212088_1038989113300022555Freshwater Lake HypolimnionNAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRNKKQK
Ga0236341_102574613300022591FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDESPTIARAKAV
Ga0256681_1236820223300023311FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRITPEKDESPTIARAKAVAQKRTKKQK
Ga0209083_103074343300025162FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRNKKQK
Ga0208255_10916523300025353FreshwaterQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETIVQPKRTKKQK
Ga0208504_101725733300025358FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0208385_100942013300025363FreshwaterIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0208621_100561433300025365FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEETETIVQPKRTKKQK
Ga0208505_100917313300025366FreshwaterNKMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK
Ga0208620_100937323300025368FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIEPEETEIVVQPKRTKKQK
Ga0208382_1000787143300025369FreshwaterMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0208382_100811713300025369FreshwaterSVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAEIVIQPKRTKKQK
Ga0207957_101053633300025372FreshwaterDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRIKPEEAETVIQPKRTKKQK
Ga0207957_101100123300025372FreshwaterDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0208259_100669353300025375FreshwaterDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEETEIAIQPKRTKKQK
Ga0207960_100186973300025378FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEETEIAIQPKRTKKQK
Ga0208871_100457563300025381FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK
Ga0208871_101377213300025381FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQ
Ga0207959_103814833300025387FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0208380_103591413300025392FreshwaterRTIKLYGSSSLWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0208251_100481853300025398FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0208387_100606213300025400FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAE
Ga0208614_100407413300025413FreshwaterYGSSSLWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK
Ga0208614_101340513300025413FreshwaterKLYGSSSLWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0208253_100666863300025418FreshwaterNEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0208253_102168723300025418FreshwaterNEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0208111_105705233300025420FreshwaterMKIIVKIIKENEDGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKK
Ga0208500_101026433300025429FreshwaterDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0208622_101970513300025430FreshwaterKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEEAETVIQPKRTKKQK
Ga0208744_104044923300025450FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYKIEPEETETVIQPKRTKKQK
Ga0208507_101643373300025648FreshwaterWGINKMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEETETVVQPKRTKKQK
Ga0208741_1005721723300025723FreshwaterKLYGSSNLWGINKMKISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYRIKPEETENVIQPKRTKKQK
Ga0208258_100653513300025783FreshwaterISVKIIKENEDGSANAQVDFDKEGLETLVQWGLVSILTKAIDEYKIKPEEAETVIQPKRTKKQK
Ga0316219_109996133300031759FreshwaterMKIAVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEETENVIQPKRTKKQK
Ga0316217_1009142223300031813FreshwaterMKIDVKIIKENEDGSANAQVDFDKEGLETLVQWGLVGILTKAIDEYRIKPEETENVIQPKRTKKQK
Ga0316221_111726713300032665FreshwaterGSANAQVDFDKEGLETLVQWGLVALLTKAIDEYRITPEKDGSPTIARAKAVAQKRTKKQK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.