NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086505

Metagenome / Metatranscriptome Family F086505

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086505
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 162 residues
Representative Sequence VSMAPQTTAITPEVTQYMTGSWNSYVPLADSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Number of Associated Samples 72
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.82 %
% of genes near scaffold ends (potentially truncated) 97.27 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 66
AlphaFold2 3D model prediction Yes
3D model pTM-score0.66

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(67.273 % of family members)
Environment Ontology (ENVO) Unclassified
(45.455 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(95.455 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 21.88%    β-sheet: 10.94%    Coil/Unstructured: 67.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.66
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009411|Ga0115017_1357490All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum528Open in IMG/M
3300010200|Ga0127507_1329043All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum507Open in IMG/M
3300011120|Ga0150983_11849650All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum506Open in IMG/M
3300012212|Ga0150985_120065510All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum502Open in IMG/M
3300019040|Ga0192857_10314642All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum538Open in IMG/M
3300030528|Ga0210277_10666988All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum562Open in IMG/M
3300030535|Ga0210285_1096201All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum597Open in IMG/M
3300030543|Ga0210289_1546661All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum547Open in IMG/M
3300030545|Ga0210271_10242047All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum500Open in IMG/M
3300030548|Ga0210252_11124448All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum614Open in IMG/M
3300030549|Ga0210257_10731496All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum591Open in IMG/M
3300030551|Ga0247638_1164512All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum546Open in IMG/M
3300030564|Ga0210256_10789654All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum530Open in IMG/M
3300030572|Ga0210258_10123472All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum533Open in IMG/M
3300030572|Ga0210258_10702651All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum558Open in IMG/M
3300030579|Ga0247633_10177202All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum611Open in IMG/M
3300030582|Ga0210261_1216078All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum511Open in IMG/M
3300030583|Ga0210262_1248674All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum519Open in IMG/M
3300030588|Ga0210283_1382171All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum631Open in IMG/M
3300030589|Ga0210255_10079111All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum542Open in IMG/M
3300030589|Ga0210255_11073702All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum531Open in IMG/M
3300030590|Ga0247643_1144603All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum561Open in IMG/M
3300030594|Ga0210280_1151177All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum557Open in IMG/M
3300030599|Ga0247630_1221238All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum513Open in IMG/M
3300030602|Ga0210254_10248716All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum516Open in IMG/M
3300030609|Ga0247634_10364507All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum597Open in IMG/M
3300030612|Ga0257196_1266523All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum613Open in IMG/M
3300030614|Ga0247657_10300118All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum507Open in IMG/M
3300030623|Ga0265392_1123354All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum634Open in IMG/M
3300030625|Ga0210259_11677759All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum518Open in IMG/M
3300030626|Ga0210291_11305789All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum546Open in IMG/M
3300030627|Ga0210269_10256756All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum593Open in IMG/M
3300030635|Ga0247627_10250176All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum571Open in IMG/M
3300030738|Ga0265462_11609338All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum611Open in IMG/M
3300030738|Ga0265462_12530130All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum512Open in IMG/M
3300030740|Ga0265460_11991894All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum603Open in IMG/M
3300030740|Ga0265460_12252044All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum574Open in IMG/M
3300030740|Ga0265460_12253872All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum574Open in IMG/M
3300030740|Ga0265460_12935742All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum513Open in IMG/M
3300030743|Ga0265461_12398490All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum618Open in IMG/M
3300030743|Ga0265461_12439569All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum614Open in IMG/M
3300030743|Ga0265461_13281187All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum546Open in IMG/M
3300030743|Ga0265461_13351157All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum541Open in IMG/M
3300030743|Ga0265461_13544264All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum529Open in IMG/M
3300030754|Ga0074008_10833180All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum568Open in IMG/M
3300030754|Ga0074008_10867082All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum669Open in IMG/M
3300030775|Ga0074021_1767161All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum750Open in IMG/M
3300030778|Ga0075398_11551977All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum635Open in IMG/M
3300030778|Ga0075398_11706635All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum547Open in IMG/M
3300030804|Ga0102769_10920747All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum517Open in IMG/M
3300030842|Ga0075404_11391137All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum590Open in IMG/M
3300030847|Ga0075405_11646346All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum675Open in IMG/M
3300030849|Ga0075393_10807344All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum504Open in IMG/M
3300030852|Ga0075389_11449139All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum623Open in IMG/M
3300030854|Ga0075385_11404713All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum519Open in IMG/M
3300030909|Ga0074033_10944119All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum644Open in IMG/M
3300030923|Ga0138296_1079920All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum551Open in IMG/M
3300030923|Ga0138296_1765753All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum533Open in IMG/M
3300030934|Ga0075391_10948524All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum513Open in IMG/M
3300030935|Ga0075401_11378252All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum622Open in IMG/M
3300030937|Ga0138302_1173220All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum531Open in IMG/M
3300030945|Ga0075373_10259948All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum610Open in IMG/M
3300030945|Ga0075373_11316243All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum603Open in IMG/M
3300030947|Ga0075390_10516889All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum559Open in IMG/M
3300030949|Ga0074031_1736714All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum534Open in IMG/M
3300030962|Ga0138297_1791630All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum522Open in IMG/M
3300030968|Ga0075376_10509975All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum527Open in IMG/M
3300030974|Ga0075371_11054755All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum506Open in IMG/M
3300030999|Ga0074019_10915327All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum604Open in IMG/M
3300031002|Ga0074014_1853521All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum624Open in IMG/M
3300031014|Ga0102756_1412362All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum511Open in IMG/M
3300031015|Ga0138298_1108838All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum640Open in IMG/M
3300031015|Ga0138298_1461307All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum501Open in IMG/M
3300031015|Ga0138298_1703522All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum602Open in IMG/M
3300031029|Ga0074012_11595729All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum629Open in IMG/M
3300031030|Ga0074030_10628430All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum503Open in IMG/M
3300031034|Ga0074041_10660045All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum500Open in IMG/M
3300031057|Ga0170834_104213481All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum504Open in IMG/M
3300031057|Ga0170834_105429407All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum609Open in IMG/M
3300031057|Ga0170834_106724726All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum674Open in IMG/M
3300031057|Ga0170834_106862004All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum506Open in IMG/M
3300031057|Ga0170834_112831329All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum527Open in IMG/M
3300031064|Ga0102767_10350523All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum604Open in IMG/M
3300031122|Ga0170822_13693890All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum562Open in IMG/M
3300031122|Ga0170822_14191910All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum576Open in IMG/M
3300031122|Ga0170822_14786071All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum519Open in IMG/M
3300031122|Ga0170822_16888366All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum525Open in IMG/M
3300031128|Ga0170823_11053254All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum586Open in IMG/M
3300031128|Ga0170823_16646332All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum543Open in IMG/M
3300031231|Ga0170824_105929938All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum683Open in IMG/M
3300031231|Ga0170824_110518541All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum616Open in IMG/M
3300031231|Ga0170824_121620242All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum514Open in IMG/M
3300031231|Ga0170824_123190538All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum569Open in IMG/M
3300031411|Ga0102761_11069400All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum536Open in IMG/M
3300031446|Ga0170820_13386031All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum508Open in IMG/M
3300031446|Ga0170820_16857811All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum572Open in IMG/M
3300031446|Ga0170820_17272777All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum510Open in IMG/M
3300031469|Ga0170819_14322723All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum575Open in IMG/M
3300031469|Ga0170819_16483706All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum587Open in IMG/M
3300031474|Ga0170818_101292656All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum616Open in IMG/M
3300031474|Ga0170818_102704031All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum543Open in IMG/M
3300031474|Ga0170818_106794877All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum507Open in IMG/M
3300031474|Ga0170818_107343461All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum519Open in IMG/M
3300031474|Ga0170818_108418670All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum503Open in IMG/M
3300031474|Ga0170818_112729012All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum556Open in IMG/M
3300032756|Ga0315742_11881913All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum661Open in IMG/M
3300032756|Ga0315742_12256652All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum615Open in IMG/M
3300032756|Ga0315742_13058954All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum539Open in IMG/M
3300032756|Ga0315742_13384333All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum515Open in IMG/M
3300034396|Ga0326777_037929All Organisms → cellular organisms → Eukaryota → Amoebozoa → Evosea → Eumycetozoa → Myxogastria → Myxogastromycetidae → Physariida → Physaraceae → Physarum → Physarum polycephalum632Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil67.27%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil27.27%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.91%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.91%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.91%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.91%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300009411Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010200Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300030528Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO135-VCO084SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030543Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE107SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030545Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO033SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030548Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR016SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030549Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR102SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030572Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO137-ANR103SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030579Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030582Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE022SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030583Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO145-ARE023SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030588Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO740-VDE011SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030590Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030599Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030602Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030609Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030612Metatranscriptome of decayed wood fungal communities from Pinus contorta in Tenderfoot Creek Experimental Forest, Montana, United States - TCEF2-1 (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300030614Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Dnb10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030623Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE043SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030626Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030627Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE095SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030754Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030775Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030778Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030804Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 4B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030842Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030849Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030909Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Mineral N2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030934Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030935Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030937Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030947Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030949Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030968Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030999Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031002Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031014Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031029Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Wood TCEFA (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031030Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031034Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Litter C1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031064Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031411Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PO 1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300034396Metatranscriptome of soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - S39 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0115017_135749013300009411SoilPEVSLYAAGSWNSYVPLADTNIIQYVDIVAVQLYNNAVPYNNIVSYAQSLESGFGVTGCPSCPGLTCKVGIPAKKIAFGYPAGPGAAPSGCPGLPGGCPYGSSLSSLYNGSPVLTNTTGVMTWSIEWDQASNWQFVAAATKINFH*
Ga0127507_132904313300010200Host-AssociatedPGSWNSYVPLADTSIMDYVDIVAVQLYNNAVPFNNVEQYGQSLYNGFNVTGCPCGASCQVKISNKKITFGYPSGPGAAPSGCPGLPGGCPYGSALSNLYDSSSFLKSTGGLMTWSIEWDEFYNWNFVKAATSIQFTS*
Ga0150983_1184965013300011120Forest SoilTAITPEVTQYMTGSWNSYVPLSDTSILQNVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLPSKKIAFGYPSGQGAAPAGCPGQPGGCPYGSSLTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL*
Ga0150985_12006551013300012212Avena Fatua RhizosphereLMHNGGYTVSMAPQTTAITPEVAIYQTGSWNSYVPLADTNIIQYVNILAVQLYNNAVPGNTPEAYAKTLEAGFNITSCPSCPSTTCKIQIPAKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALSSEYNGSPTLQGTGGVMTWAVEWDEFWNWQFINAAMQIKFT*
Ga0192857_1031464213300019040MarinePLVDSSIIASVDIVAVQLYNNAVPFSSADKYCASLTGGFSVTNCPSCDGITCKIQIPKKKIAFGYPAGPGAAPSGCPGISGGCPYGSKLTSLYNGSPNLKSTGGVMTWSVGWDEASGWEFINGAMGIHWN
Ga0210277_1066698823300030528SoilYVPLADTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTTGFSVTSCPPCSSISCKIQIANKKIAFGFPAGPGAAPSGCPGQPGGCPYGPALSSEYNGSPTLLATGGVMTWAVEWDEYSGWQFIAAANQIKFS
Ga0210285_109620113300030535SoilYIVSMAPQTTAITPEVTHYMTGAWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0210289_154666113300030543SoilYFISMAPQTTAITPEVTLYAPGSWNSYVPLADTNIIPSVDIVAVQLYNNAVPFNDISKYAQSLEGGFGVTGCPSCPGLTCKVGMSAKKIAFGYPAGPGAAPSGCPGLSGGCPYGSSLSSLYNGSPVLTNTTGVMTWSIEWDQFFNWQFVSAATKINFH
Ga0210271_1024204713300030545SoilQYMTGSWNSYVPLSDTSILQNVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLPSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0210252_1112444813300030548SoilGLRSFFQLMHSGGYVVSMAPQTTAITPEVTIYETGSWNSYVPLADTSILQNVDIVAVQMYNNAVPGNSVEGYAKTLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGNGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAANNIKFSFFANETLPYANETSV
Ga0210257_1073149613300030549SoilGDQIECGLRTFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLSDTSILQNVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLPSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIIFSYFLNETSL
Ga0247638_116451213300030551SoilQTGSWNSYVPLMDTGIIDSVDIVAVQLYNNAVPGNDVGNYANKLTGGFKITGCPSCPGSTCEVRIPSHKIAFGFPAGPGAAPSGCPGQSGGCPYGSRLSSLYNGNALLLTTGGVMTWSVEWDAASNWQFISAADSIKFH
Ga0210256_1078965413300030564SoilIDIDLENAWGGTPNDVICGLRKFFQLMHDAKYVISMAPQTTAMTPEVSVYQPGSWNSYVPLADTSIIQYVDIIAVQLYNNAVPSNSPATYASSLINGFQVGGVPNCPTANGGTGAIKIPAKKISFGYPAGNGAAPSGCPGLPGGCPYGSALTSLYGNSVLSSTGGVMTWSVEWDEA
Ga0210258_1012347213300030572SoilGDQIECGLRTFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGAWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFS
Ga0210258_1070265113300030572SoilCGLRKFFALMHNSSYFISMAPQTTAITPEVTLYAPGSWNSYVPLADTNIIQYVDIVAVQLYNNAVPFNDISKYAQSLEGGFGVTGCPSCPGLTCKVGMSAKKIAFGYPAGPGAAPSGCPGLSGGCPYGSSLSSLYNGSPVLTNTTGVMTWSIEWDQFFNWQFVSAATKINFH
Ga0247633_1017720213300030579SoilIDLENAWGGTGDQVECGLRSFFQLMHNAGYAVSMAPQTTALTPEVTVYQTGSWNSYVPLADTSILQYVDIVAVQLYNNAVPGSTPEAYAKSLEQGWSVTSCPNCPSTSCQVKIPAKKIAFGFPSGNGAAPSGCPGQPGGCPYGSALTSEYNQSPTLQGTGGVMTWAVEWDESWNWQFIGNATQIKFT
Ga0210261_121607813300030582SoilFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGAWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLPSKKIAFGYPSGQGAAPAGCPGQPGGCPYGSSLTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYF
Ga0210262_124867413300030583SoilTTAITPEVTQYMTGAWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLPSKKIAFGYPSGQGAAPAGCPGQPGGCPYGSSLTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0210283_138217113300030588SoilDGIDIDLENAWGGTGDQIECGLRTFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLSDTSILQNVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPAGCPGQPGGCPYGSSLTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0210255_1007911113300030589SoilVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0210255_1107370213300030589SoilPQTTAITPEVTQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLPGKKIAFGYPSGQGAAPAGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIKFSFLMNETLS
Ga0247643_114460313300030590SoilMAPQTTAITPEVTVYSSGSWNSYVPLADTSMIQYVDIVAVQCYNNAVPFNSPPQYAQSLESGFSVTGCPSCSNTSCSVKMGATKIAFGWPSGPGAAPSGCPGLSGGCPYGSALTSMYNGNPTLKGTGGVMTWAIEWDEYYNWQFITAARNIQWT
Ga0210280_115117713300030594SoilGGTGDQVECGLRTFFQAMHGGGYIVSMAPKTTAITPEVTQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLPGKKIAFGFPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQYWNWQFINAANNIKFSFLMNE
Ga0247630_122123813300030599SoilSMAPQTTAITPEVTVYSSGSWNSYVPLADTSMIQYVDIVAVQCYNNAVPFNSPPQYAQSLESGFSVTGCPSCSNTSCSVKMSATKIAFGWPSGPGAAPSGCPGLSGGCPYGSALTSMYNGNPTLKGTGGVMTWAIEWDNYYNWQFITAARNIQWG
Ga0210254_1024871613300030602SoilEVTQYMTGSWNSYVPLSDTSILQNVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLPSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0247634_1036450713300030609SoilDGIDIDLENAWGGTAYQVECGLRQFFTLMKQNKYTVSMAPQTTAITPEVTVYSSGSWNSYVPLADTSMIQYVDIVAVQCYNNAVPFNSPPQYAQSLESGFSVTGCPSCSNTSCSVKMSATKIAFGWPSGPGAAPSGCPGLSGGCPYGSSLTSMYNANPTLKGTGGVMTWAIEWDEFYNWQFITAAKNIQWT
Ga0257196_126652313300030612Host-AssociatedGLRTFFKLMHGGGFKVSMAPQTTAVTPEVTVYQAGSWNSYAPLLDTGIIEYVDIIAVQLYNNAVPSNNVETYGKNLISGFKISGCPSCSNVTGLVKIPSSKIAFGFPAGNGAAPSGCPGLSGGCPYGNALTSLYSSSVLKSTGGVMTWAIEWDEVSNWQFITAAKKIW
Ga0247657_1030011813300030614SoilGGFVVSMAPQTTAITPEVTIYQTGSWNSYVPLADTNIIQYVSIVAVQLYNNAVPGSTPEAYAKTLESGFNVTSCPSCSGSTCKIQIPAKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALSNEYNGSPTLLGTGGVMTWAVEWDEFWNWQFITAAMNIKFT
Ga0265392_112335413300030623SoilIECGLRTFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLSDTSILQNVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLPSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0210259_1167775913300030625SoilFQLMHNAGYVVSMAPQTTAITPEVTIYQTGSWNSYVPLADTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTTGFSVTSCPPCSSISCKIQIANKKIAFGFPAGPGAAPSGCPGQPGGCPYGPALSSEHNGSPTLLATGGVMTWAV
Ga0210291_1130578913300030626SoilGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFGVTGCPACSGISCKVQLPSKKIAFGYPAGQGAAPAGCPGQPGGCPYGSSLTSVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSLYANETSL
Ga0210269_1025675613300030627SoilPQTTAITPEVTQYMTGAWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPAGCPGQPGGCPYGSSLTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0247627_1025017613300030635SoilLRSFFQMLKRGGFVVSMAPQTTAITPEVSVYSTGSWNSYVPLADTAVIDYVDILAVQLYNNAVPGNSVEGYANALINGFQVSGCPKCTLATSCTVRVPAKKIAFGFPAGVGAAPGGCPGLPGGCPYGSALTSLYNGSPRLKSTAGVMTWAVEWDEVSRWQFVAAATAIQFG
Ga0265462_1160933813300030738SoilGGTPNTVECGLRKFFALMHNSSYFISMAPQTTAITPEVTLYAPGSWNSYVPLADTNIIQYVDIVAVQLYNNAVPFNDISKYAQSLEGGFGVTGCPSCPGLTCKVGMSAKKIAFGYPAGPGAAPSGCPGLSGGCPYGSSLSSLYNGSPVLTNTTGVMTWSIEWDQFFNWQFVSAATKINFH
Ga0265462_1253013013300030738SoilHAITPEVTQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFGVTGCPACSGISCKVQLPSKKIAFGYPAGQGAAPAGCPGQPGGCPYGSSLTSVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSLYANETSL
Ga0265460_1199189413300030740SoilGGYAVSMAPQTTAITPEVTQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFGVTGCPACSGISCKVQLPSKKIAFGYPAGQGAAPAGCPGQPGGCPYGSSLTSVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSLYANETSL
Ga0265460_1225204413300030740SoilQAMHGGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLPGKKIAFGFPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQYWNWQFINAANNIKFSFLMNETLS
Ga0265460_1225387213300030740SoilPEVTVYQAGSWNSYVPLADTSILGYADILAVQLYNNAVPYNSPETYAQSLEKGFPITGCPACSNISCNVMVPGKKIDFGYPAGPGAAPSGCPGIAGGCPYGASLTSLYNGSPTLEGTGGVMTWSVEWDEYYNWQFVTAAMNINFQ
Ga0265460_1293574213300030740SoilPQTTAITPEVTQYMTGSWNSYVPLSDSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVTGCPACSGISCKVQLPGKKIAFGYPSGQGAAPAGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIKFSFLMNETLS
Ga0265461_1239849013300030743SoilPTLTIPFELWAENMYASFLALRSELAFDGIDIDLENTWGGTPKELECGLRIFFSLMKGGGYLVSMAPQTTAITPEVPIYQDGAWNSYVPLADSGIIEFVDIVAVQLYNNAVPYNDPTRYAEALINGFQISGCPPCDEITCLVELPPKKIAFGYPAGPGAAPAGCPGLPGGCPYGSDLRDMYNESPTHLSTLGVMTWSVEWDEFHNW
Ga0265461_1243956913300030743SoilGTGDQIECGLRTFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLSDSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVTGCPACSGISCKVQLPGKKIAFGYPSGQGAAPAGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIKFSFLMNETLS
Ga0265461_1328118713300030743SoilLSDSSILGSVDIVAVQLYNNAVPGNTPEAYAKSLESGFSVSGCPCGASCKVQLPGKKIAFGFPAGQGAAPSGCPGQPGGCPYGSALTNVYQASPTLLATGGVMTWAVEWDEFWNWQFITAAKNIKFSFFTNETQYYNETNS
Ga0265461_1335115713300030743SoilPQTTAITPEVTLYAPGSWNSYVPLADTNIIQYVDIVAVQLYNNAVPFNDISKYAQSLEGGFGVTGCPSCPGLTCKVGMSAKKIAFGYPAGPGAAPSGCPGLSGGCPYGSSLSSLYNGSPVLTNTTGVMTWSIEWDQFFNWQFVSAATKINFH
Ga0265461_1354426413300030743SoilIECGLRSFFQKMHGSGYTVSMAPQTTALTPEVTQYMAGAWNSYVPLCDTSAAANVNIVAVQLYNNAVPFNNATQYAQSLESGFSVTGCPSCSSLTCSVKLAGSKLAFGWPAGQGAAPSGCPGLPGGCPYGAALTSLYNGSPTLLGTGGVMTWSVEWDEYWNWQFINAATQIKFTT
Ga0074008_1083318013300030754SoilPLLDTGIIEYVDIVAVQLYNNAVPSNNVETYGKNLISGFKISGCPSCANVTGLVKIPSDKIAFGFPAGNGAAPSGCPGLPGGCPYGNALTSLYSSSVLKSTGGVMTWAIEWDEASNWQFITAAKKIW
Ga0074008_1086708223300030754SoilHGGGFKVSMAPQTTAVTPEVTVYQAGSWNSYAPLLDTGIIEYVDIIAVQLYNNAVPSNNVETYGKNLISGFKISGCPSCSNVTGLVKIPSSKIAFGFPAGNGAAPSGCPGLSGGCPYGNALTSLYSSSVLKSTGGVMTWAIEWDEVSNWQFITAAKKIW
Ga0074021_176716113300030775SoilMAPQTTAITPEVTIYETGSWNSYVPLADTSILQNVDIVAVQMYNNAVPGNSVEGYAKTLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGTGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAANNIKFSFFANETLPYANETSV
Ga0075398_1155197713300030778SoilSIECGLRAFFSLMHSSGYIVSMAPQTTAITPEVSLYSAGSWNSYVPLADTNIDQSVDIVAVQLYNNAVPSNSPETYAKNLEAGFSVSNCPSCPSISCKIQLSAKKIAFGYPSGPGAAPSGCPGQSGGCPYGTALTNLYNGSPTLKGTGGVMTWAVEWDEFYNWQFINAATKISFSFLNETFSD
Ga0075398_1170663513300030778SoilWNSYVPLADTSVIQYVDIVAVQCYNNAVPYNSPPQYAQSLESGFSVTGCPACTNISCSVKLPATKIAFGWPSGPGAAPSGCPGLPGGCPYGSSLTSMYNGNPTLKATGGVMTWAIEWDEYYNWQFITAARNIQWG
Ga0102769_1092074713300030804SoilALTPEVSVYQPGSWNSYAPLADTGIIDYVDIVAVQLYNNAVPFNSPESYAKALENGFQVGSVPKCSSTSVTGMVKIPAKKIAFGYPAGNGAAPSGCPGLPGGCPYGNALVNLYNSATLSGTGGVMTWSVEWDQVSNWQFVTAAPKIGFK
Ga0075404_1139113713300030842SoilFFQLMKQNKYVVSMAPQTTAITPEVTVYSQGSWNSYVPLADTSMIQYVDIVAVQCYNNAVPYNSPPQYAQSLESGFSVTGCPACTNISCSVKLPATKIAFGWPSGPGAAPSGCPGLPGGCPYGSSLTSMYNGNPTLKATGGVMTWAIEWDEYYNWQFITAARNIQWG
Ga0075405_1164634613300030847SoilGTGDQVECGLRSFFQQMKSGGYVVSMAPQTTAITPEVTTYQTGSWNSYVPLADTSILQNVDIVAVQLYNNAVPSNSPETYAKNLEAGFAVSNCPACPSISCKIQLSAKKIAFGYPSGPGAAPSGCPGQSGGCPYGTALTNLYNGSPTLKGTGGVMTWAVEWDEFYNWQFINAATKISFSFLNETFSD
Ga0075393_1080734413300030849SoilPQTTAITPEVTVYSSGSWNSYVPLADTSEIQYVGIVAVQCYNNAVPFNSPPQYAQSLESGFSVTGCPACTNTSCNVKIPATKIAFGWPAGPGAAPSGCPGLSGGCPYGSALTTMYNGNSVLKGTGGVMTWSIEWDQYYNWQFITAATSIQWG
Ga0075389_1144913913300030852SoilWGGTGDQIVCGLRSFFQLMHNGGYVVSMAPQTTAMTPEVTIYETGSWNSYVPLADTSILQNVDIVAVQMYNNAVPGNSVEGYAKNLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGNGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAAKNIKFSFFANETLPYANETSV
Ga0075385_1140471313300030854SoilTPEVLQYQTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLPSKKIAFGYPAGQGAAPSGCPGQPGGCPYGSALTSVYQSSPTLLSTGGVMTWAVEWDQYWNWQFINAANNIRFSYFMNETSA
Ga0074033_1094411913300030909SoilGTGDQIVCGLRSFFQLMHNGGYVVSMAPQTTAMTPEVTIYETGSWNSYVPLADTSILQNVDIVAVQMYNNAVPGNSVEGYAKNLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGNGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAAKNIKFSFFANETLPYANETSV
Ga0138296_107992013300030923SoilQAMHGGGYIVSMAPQTTAITPEVTLYMTGSWNSYVPLADSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0138296_176575313300030923SoilQLMHNGGYIVSMAPQTNAITPEVTVYQTGSWNSYVPLVDTSILQYVDIVAVQLYNNAVPGNTPDAYAKTLEAGFSVSGCPGCSGTSCKVQIAGKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALTNVYQSSSTLLATGGVMTWAVEWDEYWQWQFINAAKNIKFTGFTNETSFFNET
Ga0075391_1094852413300030934SoilVSMAPQTTAITPEVTQYMTGSWNSYVPLADSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNETSL
Ga0075401_1137825213300030935SoilDQIECGLRTFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLADSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIRFSYFLNRRS
Ga0138302_117322013300030937SoilWNSYVPLADTSILQYVDIVAVQLYNNAVPGNSVDGYAKSLEAGFSVSGCPSCSNTSCKLQISGKKIAFGYPAGNGAAPSGCPGLPGGCPYGSALTSLYSSSSTLLATGGVMTWAVEWDEFWQWQFINAAKNIKFSFLANSTSF
Ga0075373_1025994813300030945SoilIDIDLENAWGGTGDQVECGLRTFFQLMHQNGFVVSMAPQTTAVTPEVSIYQTGSWNSYVPLLDTSILQYVDIVAAQLYNNAVPGNTPENYAKSLTSGFSCSGCPSCSNISCKVQISSKKIAFGYPSGNGAAPSGCPGQPGGCPYGSALSSEYNGSPTLLSTGGVMTWAVEWDEYYNWQFINAAVNIKFS
Ga0075373_1131624313300030945SoilITPEVLQYQTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLPSKKIAFGYPAGQGAAPSGCPGQPGGCPYGSALTSVYQSSPTLLSTGGVMTWAVEWDQYWNWQFINAANNIRFSYFMNEHIFILVVIIKNYPDA
Ga0075390_1051688913300030947SoilTVSMAPQTTAITPEVTVYSQGSWNSYVPLADTSVIQYVDIVAVQCYNNAVPYNSPPQYAQSLESGFSVTGCPACTNISCSVKLPATKIAFGWPSGPGAAPSGCPGLPGGCPYGSSLTSMYNGNPTLKATGGVMTWAIEWDEYYNWQFITAARNIQWG
Ga0074031_173671413300030949SoilSILQNVDIVAVQMYNNAVPGNSVEGYAKTLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGTGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAANNIKFSFFANETLPYANETSV
Ga0138297_179163013300030962SoilAPQTTAITPEVTIYQTGSWNSYVPLADTNILQYVDIVAVQLYNNAVPGNTPEAYAKTLEQGFNVTSCPSCQGITCQVKIPAKKIAFGFPSGNGAAPSGCPGQPGGCPYGSALSTEYNQSPTLLGTGGVMTWAVEWDEFWNWQFITAATQIKFT
Ga0075376_1050997513300030968SoilENAWGGTGDQIECGLRTFFQLMHGGGYIVSMAPQTTAITPEVLQYQTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLPSKKIAFGYPAGQGAAPSGCPGQPGGCPYGSALTSVYQSSPTLLSTGGVMTWAVEWDQYWNWQFI
Ga0075371_1105475513300030974SoilLRTFFQAMHGGGYIVSMAPQTTAITPEVTQYMTGSWNSYVPLADSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFAVSGCPACSGISCKVQLSSKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIR
Ga0074019_1091532713300030999SoilQIVCGLRSFFQLMHSGGYVVSMAPQTTAITPEVTIYETGSWNSYVPLADTSILQNVDIVAVQMYNNAVPGNSVEGYAKTLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGTGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAANNIKFSFFRERNLTLRE
Ga0074014_185352113300031002SoilPQTTAITPEVSVYQPGSWNSYVPLADTGVIEYVDIVAVQLYNNAVPSNSPEAYAKALTSGFSVTGSPSCPGVTGKIKIPAKKIAFGYPAGPGAAPGGCPGLGGGCPYGSSLTSLYNGSPLLSNTTGVMTWSVEWDEASKWEFIGAATKISFH
Ga0102756_141236213300031014SoilVDTGIIDYVDIVAVQLYNNAVPYNSPESYAKALENGFQVGGVPKCSSTTVTGAVKIPAKKIAFGYPAGNGAAPSGCPGLPGGCPYGTTLATLYNGSVVLGSTGGVMTWSVEWDQASNWQFINAATKINFH
Ga0138298_110883813300031015SoilVDIVAVQLYNNAVPYNSPESYAKSLENGFQVGSVPKCSSTSVTGNVKIPPKKIAFGYPAGPGAAPSGCPGLPGGCPYGNALANLYNNSAVLSGTGGVMTWSVEWDQASNWQFVTAALRIGFK
Ga0138298_146130713300031015SoilPEVSSYSAGSWNSYAPLADSSIMQYVDIVAVQLYNNAVPYNSPDAYAKSLINGFQVSGCPSCSISVSCKVQIPSGKIAFGYPAGNGAAPSGCPGLPGGCPYGGALTSLYNGSPTLKSTGGVMTWSVEWDEASNWQFVGAATRISF
Ga0138298_170352213300031015SoilLHNGGYVVSMAPQTTAMTPEVTIYETGSWNSYVPLGDTSILQNVDIVAIQLYNNAVPGNSVEGYAKSLETGFSVSGCPSCAACKLQLTGKKIAFGYPAGNGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAAKNIKFSFFANETLPYANETSV
Ga0074012_1159572913300031029SoilLENAWGGTPNSIICGLRTFFKLMHNGGFKVSMAPQTTAITNEVPLYQAGSWNSYVPLADTGIIEYVDILAVQLYNNAVPSNNVETYAKALINGFQISGSPSCSNVTGLIKIPSSKIAFGYPAGNGAAPSGCPGLPGGCPYGNALTNLYSSSVLKGTGGVMTWAIEWDEASNWQFITAAKKIW
Ga0074030_1062843013300031030SoilPQTTAITPEVSVYQPGSWNSYVPLADTGIIASVDIIAVQLYNNQVPGNNAEAYAKSLMSGFSVTGSPSCPGVTGKIQIPAKKIAFGYPAGQGAAPSGCPGMTGGCPYGSALSSLYNNSPVLANTTGVMTWSVEWDEASNWQFVSAATKIAFH
Ga0074041_1066004513300031034SoilSVYQAGSWNSYVPLVDTSIIQYVDIMAVQLYNNAVPGNNVAAYAQSLESGFGVSGCPSCPGLTCKVSIPAKKIAFGFPAGPGAAPSGCPGLPGGCPYGSQLTSLYNGNSILTNTSGVMTWSIEWDMASNWEFVSAATKISFR
Ga0170834_10421348113300031057Forest SoilGFDGIDIDLENAWGGTGDQVACGLRSFFQLMHNGGYVVSMAPQTTAITPEVPIYQTGSWNSYVPLSDSSILGSVDIVAVQLYNNAVPGNTPEAYAKSLESGFSVSGCPCGASCKVQLSGKKIAFGFPAGQGAAPSGCPGQPGGCPYGSALTNVYQASPTLLATGGVMT
Ga0170834_10542940713300031057Forest SoilGLRSFFQQMKSGGYVVSMAPQTTAITPEVTTYQTGSWNSYVPLADTSILQNVDIVAVQLYNNAVPSNSPETYAKNLEAGFSVSNCPACPSISCKIQLSAKKIAFGYPSGPGAAPSGCPGQSGGCPYGAALTNLYNGSPTLKGTGGVMTWAVEWDEFYSLQFISAATKISFSFLNETFSD
Ga0170834_10672472613300031057Forest SoilMHGGGYAVSMAPQTTAITPQVTSYQTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFGVTGCPACSGISCKIQLPSKKIAFGYPAGQGAAPAGCPGQPGGCPYGSSLTSVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIKFAFFANETSLV
Ga0170834_10686200413300031057Forest SoilEVTLYMTGSWNSYVPLSDSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVTGCPACSGISCKVQLPGKKIAFGYPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIKFSFLTNETLS
Ga0170834_11283132913300031057Forest SoilAPQTTAITPEVTVYQSGSWNSYVPLADTSMMNYVDIVAVQLYNNAVPFNSADQYAQALESGWSVTGCPACSSISCQVKVPSTKISFGWPSGPGAAPSGCPGLPGGCPYGSSLTTLYNGSPTLSGTAGVMTWSVEWDEFYNWQFITAATKINFH
Ga0102767_1035052313300031064SoilSNNGHDTXSEIYETGSWNSYVPLGDTSILQNVDIVAIQLYNNAVPGNSVEGYAKSLEAGFSVSGCPSCAACKLQLTGKKIAFGYPAGNGAAPSGCPGLPGGCQYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAAKNIKFSFFANETLPYANETSV
Ga0170822_1369389013300031122Forest SoilLVDTSILQFVDIVAVQLYNNAVPGNSPEVYAKSLQSGFKVSGCPACANITCSVSMDGPKIAFGFPAGPGAAPSGCPGQSGGCPYGPKLAALYNGSPLLLRTGGVMTWSIEWDEVSNWQFISAAVSIQFGP
Ga0170822_1419191013300031122Forest SoilECGLRTFFQLMHNGGFAVSMAPQTTAVTPEVTIYQTGSWNSYVPLVDTNILQYVDIVAAQLYNNAVPGNTPEAYAKSLEQGFNVTGCPSCQGITCQVKIPAKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALSNEYNQSPTLQGTGGVMTWAVEWDEYWNWQFITAATQIRFT
Ga0170822_1478607113300031122Forest SoilVPLADTSIIGYVDILAVQLYNNAVPYNSPDSYAQALEKGFQITGCPSCTNISCNVMVPNKKISFGYPAGPGAAPSGCPGMPGGCPYGSALTTLYNGSPTLAGTGGVMTWSVEWDEYYNWQFVTAATGIRWS
Ga0170822_1688836613300031122Forest SoilVSMAPQTTAITPEVTVYSQGSWNSYVPLADTSVIQYVDIVAVQCYNNAVPYNSPPQYAQSLESGFSVTGCPACTNISCSVKLPATKIAFGWPSGPGAAPSGCPGLPGGCPYGSSLTSMYNGNPTLKATGGVMTWAIEWDEYYNWQFITAARNIQWG
Ga0170823_1105325413300031128Forest SoilTGDQVECGLRSFFELMHNGGFVVSMAPQTTAITPEVTIYQTGSWNSYVPLADTNIIQYVSIVAVQLYNNAVPGSTPEAYAKTLESGFNVTSCPSCSGSTCKIQLPAKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALSNEYNGSPTLLGTGGVMTWAVEWDEFWNWQFITAAMNIKFT
Ga0170823_1664633213300031128Forest SoilHSKYIVSMAPQTTAITPEVTVYQSGSWNSYVPLADTSMMNYVDIVAVQLYNNAVPFNSADQYAQALESGWSVTGCPACSSISCQVKVPSTKISFGWPSGPGAAPSGCPGLPGGCPYGSSLTTLYNGSPTLSGTAGVMTWSVEWDEFYNWQFITAATKINFH
Ga0170824_10592993813300031231Forest SoilAWGGTGDQVECGLRTFFQLMHNGGFAVSMAPQTTAVTPEVTIYQTGSWNSYVPLVDTNILQYVDIVAAQLYNNAVPGNTPEAYAKSLEQGFNVTGCPSCQGITCQVKIPAKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALSNEYNQSPTLQGTGGVMTWAVEWDEYWNWQFITAATQIRFT
Ga0170824_11051854113300031231Forest SoilWGGTGDQVECGLRTFFQLMHTGGYAVSMAPQTTAITPEVKQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGSTPEAYAKSLTGGFSVTGCPACSGISCSIKLPSKKIAFGYPAGQGAAPSGCPGQPGGCPYGSALTSVYQSSPTLLSTGGVMTWAVEWDQFWNWQFINAANNIKFAFFENETS
Ga0170824_12162024213300031231Forest SoilSLGFDGIDIDLENAWGGTGDQIVCGLRTFFQLMHNGGYVVSMAPQTTAVTPEVQIYQTGSWNSYAPLCDSSILGSVDIVAVQLYNNAVPGNTPEAYAKTLESGFSVSGCPCGAGCKVQIPAKKIAFGFPSGQGAAPSGCPGQPGGCPYGSALTSVYQASPTLLATGGVMT
Ga0170824_12319053813300031231Forest SoilPGSWNSYVPLCDTGIIDQVDIFAVQLYNNAVPSNSPSAYASILENGFGVSGCPNCANSTCKVQIPAKKISFGYPAGPGAAPSGCPGQSGGCPYGPALSSLYNGSPTLQGTGGVMTWSVEWDEASNWQFITYATQIKFT
Ga0102761_1106940013300031411SoilQTTAITPEVSVYSPGSWNSYAPLADSSIIEYVDIVAVQLYNNAVPFNNPESYAKSLESGFQVNGCPNKCSLPTTGLVKIPPRKIAFGYPAGNGAAPSGCPGLPGGCPYGSKLTSLYQSSVLSGTGGVMTWSIEWDQASNWQFVAAATQIKF
Ga0170820_1338603113300031446Forest SoilQTTAITPEVTQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFGVTGCPACSGISCKIQLPSKKIAFGYPAGQGAAPAGCPGQPGGCPYGSSLTSVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIKFSLYTNETSF
Ga0170820_1685781113300031446Forest SoilDQVECGLRSFFQLMHNGGFVVSMAPQTTAITPEVTIYQTGSWNSYVPLADTNIIQYVSILAVQLYNNAVPGSTPEAYAKTLESGFNVTNCPGCSGSTCKIQIPAKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALSNEYNGSPTLLGTGGVMTWAVEWDEFWNWQFITAAMNIKFT
Ga0170820_1727277713300031446Forest SoilITPEVKQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGSTPEAYAKSLTGGFSVTGCPACSGISCSIKLPSKKIAFGYPAGQGAAPSGCPGQPGGCPYGSALTSVYQSSPTLLSTGGVMTWAVEWDQFWNWQFINAANNIKFAFFANETSLV
Ga0170819_1432272313300031469Forest SoilGIDIDLENAWGGTGDQVECGLRSFFELMHNGGFVVSMAPQTTAITPEVTIYQTGSWNSYVPLADTNIIQYVSILAVQLYNNAVPGSTPEAYAKTLESGFNVTNCPSCSGSTCKIQIPAKKIAFGFPAGNGAAPSGCPGQPGGCPYGSALSNEYNGSPTLLGTGGVMTWAVEWDEFWNWQFITAAMNIKFT
Ga0170819_1648370613300031469Forest SoilVVVQLYNNVVPGNTPEAYAKSLELGFFVSGCPSCLGITCKVGIGAKKIAFGYPVGNGAAFFGCSGQLGGCFYGPVLTNLYQSSPTLLATGGVMTWAVEWDEFWNWQFINAAKNIKFTSF
Ga0170818_10129265613300031474Forest SoilWGGTGDQVECGLRTFFQLMHTGGYAVSMAPQTTAITPEVKQYMTGSWNSYVPLSDTSILQYVDIVAVQLYNNAVPGSTPEAYAKSLTGGFSVTGCPACSGISCSIKLPSKKIAFGYPAGQGAAPSGCPGQPGGCPYASALTSVYQSSPTLLSTGGVMTWAVEWDQFWNWQFINAANNIKFAFFENETS
Ga0170818_10270403113300031474Forest SoilLLADTSILQNVDIVAVQLYNNAVPSNSPETYAKNLEAGFSVSNCPSCPSISCKIQLSAKKIAFGYPSGPGAAPSGCPGQSGGCPYGTALTNLYNGSPTLKGTGGVMTWAVEWDEFYNWQFINAATKISFSFLNETFSD
Ga0170818_10679487713300031474Forest SoilFQLMHNGGYVVSMAPQTTALTPEVTTYQTGSWNSYAPLADTSIIQYVDILAVQLYNNAVPGNSATAYAQDLEKGFKVTNCPCGAGCQVTVPAKKIAFGWPAGNGAAPSGCPGQAGGCPYGSALTAQYNGSPTLLGTGGVMTWAVEWDESFNWQFIGNATQIKF
Ga0170818_10734346113300031474Forest SoilSMAPQTTAMTPEVSIYQTGSWNSYVPLADTSILQYVDIVAVQLYNNAVPGNSPATYATSLESGFPVTGCPCSASCQMKLTAKKIAFGYPAGPGAAPSGCPGQSGGCPYGSALTSLYNGNPTLKGTGGVMTWAVEWDEFYSWQFINAATKISFGFMNETLPLSD
Ga0170818_10841867013300031474Forest SoilPQTTAITPEVALYQTGSWNSYVPLVDSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLESGFSVTGCPSCSGISCKVGIGAKKIAFGYPAGNGAAPSGCPGQPGGCPYGSALTNLYQSSPTLLATGGVMTWAVEWDEFWNWQFINAAKNIKFTSFSVNDTILEA
Ga0170818_11272901213300031474Forest SoilLENAWGGTGDQVECGLRSFFQLMHNGGFVVSMAPQTTAITPEVTIYQTGSWNSYVPLADTNIIQYVDILAVQLYNNAVPGNTPEAYAKTLEAGFNVTSCPNCQGTTCNIKIPAKKIAFGFPSGNGAAPSGCPGQPGGCPYGSALSSEYNGSPTLQGTGGVMTRAVEWDEYWNWQFITAAMQIKF
Ga0315742_1188191313300032756Forest SoilFFQLMHNGGYVVSMAPQTTAMTPEVTIYETGSWNSYVPLADTSILQNVDIVAVQMYNNAVPGNSVEGYAKNLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGNGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATGGVMTWAVEWDEFWQWQFINAANNIKFSFFANETLPYANETSV
Ga0315742_1225665213300032756Forest SoilGIDIDLENAWGGTGDQIECGLRTFFQAMHGGGYFVSMAPQTTAITPEVTLYMTGSWNSYVPLSDSSILQYVDIVAVQLYNNAVPGNTPEAYAKSLTGGFSVSGCPACSGISCKVQLPGKKIAFGFPSGQGAAPSGCPGQPGGCPYGSALTNVYQSSPTLLATGGVMTWAVEWDQFWNWQFINAANNIKFSFLTNETLS
Ga0315742_1305895413300032756Forest SoilMAPQTTAITPEVTIYETGSWNSYVPLADTSILQNVDIVAVQMYNNAVPGNSVEGYAKTLEAGFSVTGCPSCAACKLQLTGKKIAFGYPAGTGAAPSGCPGLPGGCPYGSALTSLYQSSSTLLATG
Ga0315742_1338433313300032756Forest SoilAITPEVSVYSPGSWNSYAPLADTGIIKYVNYVAVQLYNNAVPSNNIAQYANSLINGFQVSSCPACSNVTGTVRIPASKITFGYPAGVGAAPSGCPGLSGGCPYGAALSSLYSSNAVLRGTGGVMTWSIEWDQASNWQFVSAATKIFH
Ga0326777_037929_1_5463300034396SoilGGTPDQIECGLRQFFSLMKSAGYTVSQAPQTTAITPEVTVYQSGSWNSYVPLADTGIIGSVDILAVQLYNNAVPYNSPDSYAQSLEKGFQISGCPSCSNSTCNVVIPNKKISFGYPAGPGAAPSGCPGMPGGCPYGAALTSLYNGSPTLSGTGGVMTWSVEWDEYYAWQFVNAARGINWH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.