NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086461

Metagenome / Metatranscriptome Family F086461

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086461
Family Type Metagenome / Metatranscriptome
Number of Sequences 110
Average Sequence Length 89 residues
Representative Sequence MNYRHLALHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYSLDNVLPGLSAGSYEEQDAEFLRSIGVQV
Number of Associated Samples 73
Number of Associated Scaffolds 110

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 76.15 %
% of genes near scaffold ends (potentially truncated) 29.09 %
% of genes from short scaffolds (< 2000 bps) 73.64 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.182 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(26.364 % of family members)
Environment Ontology (ENVO) Unclassified
(60.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(44.545 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 17.80%    β-sheet: 16.95%    Coil/Unstructured: 65.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 110 Family Scaffolds
PF16363GDP_Man_Dehyd 20.00
PF14437MafB19-deam 9.09
PF13183Fer4_8 4.55
PF12704MacB_PCD 4.55
PF14559TPR_19 3.64
PF03960ArsC 2.73
PF01381HTH_3 1.82
PF03781FGE-sulfatase 1.82
PF07690MFS_1 0.91
PF03460NIR_SIR_ferr 0.91
PF13560HTH_31 0.91
PF04264YceI 0.91
PF02728Cu_amine_oxidN3 0.91
PF02142MGS 0.91
PF15902Sortilin-Vps10 0.91

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 110 Family Scaffolds
COG1393Arsenate reductase or related protein, glutaredoxin familyInorganic ion transport and metabolism [P] 2.73
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 1.82
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.91
COG3733Cu2+-containing amine oxidaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.91


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.18 %
UnclassifiedrootN/A1.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004092|Ga0062389_102050092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3748Open in IMG/M
3300009628|Ga0116125_1043705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1132Open in IMG/M
3300009638|Ga0116113_1200643All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3516Open in IMG/M
3300009643|Ga0116110_1088111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_51065Open in IMG/M
3300009839|Ga0116223_10488169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3718Open in IMG/M
3300010379|Ga0136449_100087337All Organisms → cellular organisms → Bacteria → Acidobacteria6520Open in IMG/M
3300010379|Ga0136449_101370093All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31095Open in IMG/M
3300014156|Ga0181518_10111847All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300014156|Ga0181518_10242880All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3918Open in IMG/M
3300014158|Ga0181521_10002728All Organisms → cellular organisms → Bacteria → Acidobacteria21153Open in IMG/M
3300014158|Ga0181521_10528357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3561Open in IMG/M
3300014160|Ga0181517_10184659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31150Open in IMG/M
3300014160|Ga0181517_10500358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3615Open in IMG/M
3300014161|Ga0181529_10027527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4463Open in IMG/M
3300014161|Ga0181529_10187168All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300014161|Ga0181529_10549413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3607Open in IMG/M
3300014164|Ga0181532_10011893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6717Open in IMG/M
3300014165|Ga0181523_10589684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3611Open in IMG/M
3300014167|Ga0181528_10014459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4661Open in IMG/M
3300014167|Ga0181528_10477725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3684Open in IMG/M
3300014167|Ga0181528_10604077All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3608Open in IMG/M
3300014168|Ga0181534_10279410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_1_40CM_3_55_5894Open in IMG/M
3300014169|Ga0181531_10172600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31310Open in IMG/M
3300014199|Ga0181535_10107853All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31787Open in IMG/M
3300014199|Ga0181535_10755087All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3552Open in IMG/M
3300014200|Ga0181526_10102923All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1824Open in IMG/M
3300014489|Ga0182018_10029001All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3538Open in IMG/M
3300014491|Ga0182014_10062119All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2467Open in IMG/M
3300014491|Ga0182014_10098131All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300014492|Ga0182013_10013966All Organisms → cellular organisms → Bacteria7898Open in IMG/M
3300014492|Ga0182013_10523482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3614Open in IMG/M
3300014492|Ga0182013_10708498All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3503Open in IMG/M
3300014493|Ga0182016_10138781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31653Open in IMG/M
3300014493|Ga0182016_10188193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31346Open in IMG/M
3300014501|Ga0182024_10116823All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3830Open in IMG/M
3300014501|Ga0182024_12678138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3534Open in IMG/M
3300014655|Ga0181516_10196679All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31023Open in IMG/M
3300014658|Ga0181519_10176654All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31353Open in IMG/M
3300014658|Ga0181519_10227475All Organisms → cellular organisms → Bacteria1169Open in IMG/M
3300014658|Ga0181519_10806307All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3580Open in IMG/M
3300014838|Ga0182030_10034681All Organisms → cellular organisms → Bacteria8706Open in IMG/M
3300014839|Ga0182027_10085483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3834Open in IMG/M
3300016701|Ga0181509_1305046All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae682Open in IMG/M
3300016705|Ga0181507_1008158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3529Open in IMG/M
3300017946|Ga0187879_10301929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3889Open in IMG/M
3300017946|Ga0187879_10581152All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3622Open in IMG/M
3300017948|Ga0187847_10093261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31665Open in IMG/M
3300017988|Ga0181520_10193526All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300017988|Ga0181520_10363273All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31061Open in IMG/M
3300017988|Ga0181520_10654445All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3723Open in IMG/M
3300017988|Ga0181520_10699204All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3693Open in IMG/M
3300017988|Ga0181520_10824487All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3624Open in IMG/M
3300018016|Ga0187880_1458258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3527Open in IMG/M
3300018030|Ga0187869_10567518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3538Open in IMG/M
3300018034|Ga0187863_10049975All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32396Open in IMG/M
3300018034|Ga0187863_10480624All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3695Open in IMG/M
3300018034|Ga0187863_10727579All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3561Open in IMG/M
3300018035|Ga0187875_10689909All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3537Open in IMG/M
3300018038|Ga0187855_10629613All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3625Open in IMG/M
3300018038|Ga0187855_10825234All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3541Open in IMG/M
3300018043|Ga0187887_10485829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3728Open in IMG/M
3300018043|Ga0187887_10520903All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3701Open in IMG/M
3300018044|Ga0187890_10787052All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3538Open in IMG/M
3300021404|Ga0210389_10342311All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300021405|Ga0210387_11427092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3595Open in IMG/M
3300022881|Ga0224545_1005767All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2010Open in IMG/M
3300023068|Ga0224554_1100589All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3666Open in IMG/M
3300023101|Ga0224557_1023936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter3231Open in IMG/M
3300023101|Ga0224557_1039565All Organisms → cellular organisms → Bacteria2285Open in IMG/M
3300025507|Ga0208188_1061218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3918Open in IMG/M
3300027825|Ga0209039_10272739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3671Open in IMG/M
3300027854|Ga0209517_10185610All Organisms → cellular organisms → Bacteria → Acidobacteria1297Open in IMG/M
3300028800|Ga0265338_10491594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3865Open in IMG/M
3300028800|Ga0265338_10614758All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3756Open in IMG/M
3300028867|Ga0302146_10294912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus628Open in IMG/M
3300029910|Ga0311369_11484606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3509Open in IMG/M
3300029911|Ga0311361_10315730All Organisms → cellular organisms → Bacteria1737Open in IMG/M
3300029922|Ga0311363_11022843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3721Open in IMG/M
3300029999|Ga0311339_10627931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31065Open in IMG/M
3300029999|Ga0311339_10793171Not Available913Open in IMG/M
3300030580|Ga0311355_11362649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3619Open in IMG/M
3300030580|Ga0311355_11662706All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3546Open in IMG/M
3300031234|Ga0302325_10061198All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus7384Open in IMG/M
3300031236|Ga0302324_100157911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3703Open in IMG/M
3300031249|Ga0265339_10266829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3824Open in IMG/M
3300031250|Ga0265331_10048547All Organisms → cellular organisms → Bacteria2040Open in IMG/M
3300031711|Ga0265314_10715405All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3505Open in IMG/M
3300031726|Ga0302321_102102077All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3657Open in IMG/M
3300032160|Ga0311301_10366776All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32236Open in IMG/M
3300032160|Ga0311301_11508172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3827Open in IMG/M
3300032770|Ga0335085_11223827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3797Open in IMG/M
3300032783|Ga0335079_10109292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter3127Open in IMG/M
3300032783|Ga0335079_10168234All Organisms → cellular organisms → Bacteria2450Open in IMG/M
3300032783|Ga0335079_10267243All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1876Open in IMG/M
3300032805|Ga0335078_10021719All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus9556Open in IMG/M
3300032805|Ga0335078_12463863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3538Open in IMG/M
3300032828|Ga0335080_10571543All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31192Open in IMG/M
3300032828|Ga0335080_12313517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3514Open in IMG/M
3300032897|Ga0335071_11480583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3623Open in IMG/M
3300032898|Ga0335072_10020911All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia9208Open in IMG/M
3300032898|Ga0335072_10138385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3015Open in IMG/M
3300033134|Ga0335073_10135158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3144Open in IMG/M
3300033158|Ga0335077_10061349All Organisms → cellular organisms → Bacteria4527Open in IMG/M
3300033402|Ga0326728_10000587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus140728Open in IMG/M
3300033402|Ga0326728_10065430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4940Open in IMG/M
3300033405|Ga0326727_11176912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3537Open in IMG/M
3300033888|Ga0334792_114353All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3727Open in IMG/M
3300033977|Ga0314861_0313485All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3704Open in IMG/M
3300034065|Ga0334827_044509All Organisms → cellular organisms → Bacteria1668Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog26.36%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil11.82%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog7.27%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.36%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.45%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil5.45%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.55%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.64%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.73%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.82%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.82%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.82%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.82%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.91%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.91%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.91%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009638Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300022881Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062389_10205009213300004092Bog Forest SoilMNYRHLSLHCQCGEVPDRLAEVGFTDDHNLVIHWWCTKCQKVVYVAKPLTECWRECPSPNHSLDIVLPGLNAGSYEDHDAEFLRSIGVQV*
Ga0116125_104370513300009628PeatlandMNYRHLPLRCQCGETPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVSKPLTDCWRDCPSPSQSLDNVLPALAADSYEGEDADFLRSIGVQV*
Ga0116113_120064313300009638PeatlandMNYRHLALHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYSLDNVLPGLSAGSYEEQDAEFLRSIGVQV*
Ga0116110_108811113300009643PeatlandMNYRHLSLHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV*
Ga0116223_1048816913300009839Peatlands SoilMNYRHLSLHCHCGEIPDRIAEVGFTDDHCLVIHWWCTRCQKVVYDAKPLTDCWRECPSAQQSLERVLPGVSDDTYRDQDADFLRSIGVQV*
Ga0136449_10008733773300010379Peatlands SoilMNYRHLSLRCQCGEIPDRIAEVGLTDDHNLVIHWWCTRCQKVVYVSKPLTDCWRECPSAQQSLERVLPGVSDDTYRDQDADFLRSIGVQV*
Ga0136449_10137009313300010379Peatlands SoilMNYRHLPLHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV*
Ga0181518_1011184723300014156BogMNYRHLSLHCQCGEVPDRIAEVGFTDDHCLVIHWWCTNCQKVVFATKSLTDCWRECPSPNSSLDRVLPALTAGSCEEEDAEFLRSIGVQA*
Ga0181518_1024288013300014156BogLHCHCGEIPDRIAEVGFTDDHNLVIHWWCTRCQKVVYVAKSLADCWRECPSPDYSLERVLPRVSADAFQEEDAVFLRSIGVQV*
Ga0181521_1000272843300014158BogMNYRHLSLHCQCGEVPDRIAEVGFTDDHCLVIHWWCTNCQKVVYVTKSLTDCWRECPNPNYSLDRVLPALSNGSYEEEDTEFLRSIGVQA*
Ga0181521_1052835713300014158BogMNYRHLSLRCQCGEIPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVAKSLTDCWRECPSPSYSLDSVLPGLNAHSYEDQDAEFLRSIGVQV*
Ga0181517_1018465913300014160BogMNYRHLALHCHCGEIPDRIAEVGFTDDHNLVIHWWCTRCQKVVYVAKSLADCWRECPSPDYSLERVLPRVSADAFQEEDAVFLRSIGVQV*
Ga0181517_1050035823300014160BogMSYRHLSLQCHCGRTPERIAEVGFTDDHCLVIHWWCTQCQEVVHVAKSLADCWRDCPSPGNFRDRVLPDLSAQGYLEEDAEFLRRIGVQV*
Ga0181529_1002752723300014161BogMSYRHLSLQCHCGRTPDRIAEVGFTDDHCLVIHWWCTHCHEVVHVAKSLADCWRDCPSPGNSQDRVLPNLSAKGYLEEDAEFLRSIGVQV*
Ga0181529_1018716823300014161BogMNYRHLSLQCHCGEIPDRIAEVGFTDDHNLVIHWWCTQCQKVVYVAKSLTDCWRECPSPDHSLDRVLNTLDTDTFLEQDAEFLRSIGVQA*
Ga0181529_1054941323300014161BogMNYRHLTLHCHCGEIPDRIAEVGFTDDHNLVIHWWCTQCQKVVYVAKSLTECWRECPSPDYALESVLPRLSADAFQENDAQFLRSIGVQV*
Ga0181532_1001189343300014164BogMNYRHLSLHCQCGDVPDQIAEIGFTDDHSLVIHWWCAKCQKVVYVTKSLTDCWRECPSPDYSLDNVLPGLRAGSYEEQDAEFLRSIGVQV*
Ga0181523_1025161113300014165BogMNYRHLSLHCDCGEVPERLAEVGFSEDHQLIVHWWCEQCQRVVYISKPLTECWLECPGKDHSLDRVLAD
Ga0181523_1058968423300014165BogMNYRHLSLHCQCGDVPDRIAEIGFTDDHSLVIHWWCSKCQKVVYVTKPLTDCWRECPSPDYSLDNVLPGLSAGSY
Ga0181528_1001445933300014167BogMSYRHLSLQCHCGRTPQHIAEVGFSDDHCLVVNWWCAECQEVVQVAISLADCWRDCPSPANFPDRVLPDLSAKGCLEDDAEFLRSIGVQV*
Ga0181528_1047772523300014167BogMNYRHLSLHCQCGETPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVSKSLTDCWRECPSPNYSLDRVLPAVSTDSYEEDDAEFLRSIGVQVEAPAASNPRK*
Ga0181528_1060407723300014167BogSLHCHCGEIPERIAEVGFTDDHNLVIHWWCTQCQKVVYVAKSLTDCWRECPSPNYSLDSILNVLPKPAGDIYEEEDAEFLRSIGVQA*
Ga0181534_1027941013300014168BogTPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVSKSLTDCWRECPSPNYSLDNVLPALSASSYEDQDAEFLRSIGVQV*
Ga0181531_1017260023300014169BogMNYRHLPLNCQCGDVPDRIAEIGFTDDHSLVIHWWCSKCQKVVYVTKPLTDCWRECPSPDYSLDNVLSGLSAGSYLEQDAEFLRSIGVQV*
Ga0181535_1010785313300014199BogMNYRHLPLNCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV*
Ga0181535_1075508713300014199BogMNYRHLSLQCQCGEIPDRIAEIGFTDDHSLVIHWWCSKCQKVVYVAKPLTDCWRECPSPSYSLDSVLPGLDAHSYEDQDAEFLRSIGVQV*
Ga0181526_1010292313300014200BogMNYRHLSLHCQCGEIPDKIAEVGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV*
Ga0182018_1002900113300014489PalsaMNYRHLALHCECGEVPDRIAEVGFTDDHSLVIHWWCTKCQKVVYVTKSLTDCWRECPSPNYSLDKVLPGLSAGSYEEQDANFLRSIGVQV*
Ga0182014_1006211923300014491BogMNYRHLSLHCQCGEIPDRIVEVGFTDDHKLVIHWWCTKCQKVVYVSKSLTECWRECPSPSIALDRVLAKASDDVYEGQDAEFLRSIGVQV*
Ga0182014_1009813143300014491BogMNYRHLSLHCQCGEIPDRIAEVGFTDDHNLVVHWWCPQCQKVVYVAKSLTDCWRECPSPSASLDRALPKLNCDAYEQQDAEFLRSIGVQV*
Ga0182013_1001396643300014492BogMNYRHLSLHCQCGQIPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVSKPLTDCWRECPSPNYSLDNVLPTVSAESYAEQDAEFLRSIGVQV*
Ga0182013_1052348223300014492BogLSLHCQCGEIPDRIAEVGFTDDHNLVVHWWCPQCQKVVYVAKSLTDCWRECPSPSASLDRALPKLNCDAYEQQDAEFLRSIGVQV*
Ga0182013_1070849823300014492BogMNYRHLSLHCHCGEIPDRIAEVGFSDDHHLVIHWWCTNCQKVVYVAKSLTECWRECPSPEASLDVILPKLSLDAIHDEDAEFLRSIGVQV*
Ga0182016_1013878123300014493BogMNYRHLSLHCHCGEIPERIAEVGFTDDHNLVIHWWCTQCQKVVNVAKSLTDCWRECPSPDYSLDSVLNVLPKPAGDIYEEEDAEFLRSIGVQA*
Ga0182016_1018819313300014493BogLMNYRHLSLHCQCGQIPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVTKPLTDCWRECPSPNYSLDNVLPTVSAESYAEQDAEFLRSIGVQV*
Ga0182024_1011682343300014501PermafrostMNYRHLSLRCHCGQIPDRIARIGFTEDHSLVIHWWCTQCHKVVCVAKSLSDCWRDCPTPGHSLDSALPELADGAYREEDAEFLRSIGVRA*
Ga0182024_1267813813300014501PermafrostMNYRHLSLHCQCGETPDRIAEVGFTDDHNLVIHWWCAGCQKVVYVSKSLTDCWRECPSPNYSLDRVLPGLGADSYEEEDAEFLRSIGVQV*
Ga0181516_1019667913300014655BogMNYRHLSLHCQCGEVPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVTKPLTDCWRECPSPNYSLDNLLPTVSAESYEEQDAEFLRSIGVQV*
Ga0181519_1017665413300014658BogKMNYRHLSLHCQCGEVPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVTKPLTDCWRECPSPNYSLDNLLPTVSAESYEEQDAEFLRSIGVQV*
Ga0181519_1022747523300014658BogMSYRHLSLQCHCGRTPQHIAEVGFSDDHCLVVNWWCAECQEVVQVAISLADCWRDCPSPANFPDRVLPDLSAKGCLEDDAEFLRSIGVQA*
Ga0181519_1080630713300014658BogMNYRHLSLRCQCGEVPDRIAEIGFTDDHNLVIHWWCSKCQKVVYVMKPLTDCWRECPSPRLTQDSALPSAKPACFDDRDVEFLRCMGVLAEAPAAYSPRK*
Ga0182030_1003468113300014838BogVPDRIAEVGFTDDHSLVIHWWCTKCQKVVYVTKSLTDCWRECPSPNYSLDKVLPGLSAGSYEEQDANFLRSIGVQV*
Ga0182027_1008548353300014839FenMNYRHLSLHCQCGEIPDRIAEVGFTDDHSLVIHWWCTTCQKVVYIAKSLTNCWRECPSPSYSLDSVLPGLDGDSYEDQDAVFLRSIGVQV*
Ga0181509_130504613300016701PeatlandMIYQQLALNCPCGEIPEHIAEVGFTGDHSLVIHWWCKQCQKVVCIAKPLADCWRECPSSNSASDRVRPTRNARGDVEEDTEFLRSIGVRI
Ga0181507_100815823300016705PeatlandEHFALQCHCGRTPERIAEVGFTDDHCLVIHWWCTHCHEVVHVAKSLADCWRECPSPEHSLDHVLPDVSAEDYLEEDAEFLRSIGVQV
Ga0187879_1030192913300017946PeatlandMNYRHLSLRCQCGEIPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVAKSLTDCWRECPSPSYSLDSVLPGLNAHSYEDQDAEFLRSIGVQV
Ga0187879_1058115223300017946PeatlandMNYRHLPLHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV
Ga0187847_1009326133300017948PeatlandMNYRHLALHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYSLDNVLSGLSAGSYLEQDAEFLRSIGVQV
Ga0181520_1019352623300017988BogMSYRHLSLQCHCGRTPQHIAEVGFSDDHCLVVNWWCAECQEVVQVAISLADCWRDCPSPANFPDRVLPDLSAKGCLEDDAEFLRSIGVQV
Ga0181520_1036327333300017988BogMNYRHLALRCQCGEIPDRIAEVGFSEDHNLVIHWWCTQCQKVVYVSKPLTDCWRECPSPNHSLENVLPGLAADSYEEHDAEFLRSIGVQV
Ga0181520_1065444513300017988BogMNYRHLALHCHCGEIPDRIAEVGFTDDHNLVIHWWCTRCQKVVYVAKSLADCWRECPSPDYSLERVLPRVSADAFQEEDAVFLRSIGVQV
Ga0181520_1069920413300017988BogMNYRHLTLHCHCGEIPDRIAEVGFTDDHNLVIHWWCTQCQKVVYVAKSLTECWRECPSPDYALESVLPRLSADAFQEN
Ga0181520_1082448723300017988BogMNYRHLSLHCQCGEIPDRIAEVGFTDDHNLVIHWWCTKCQKVVYASKPLTECWRECPSPSLALDRVLPQVSAPATVREDAFQEEDADFLRSIGVRVDFDCQDAAARPRK
Ga0187880_145825813300018016PeatlandMNYRHLSLHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV
Ga0187869_1056751813300018030PeatlandMNYRHLSLRCQCGEIPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVAKSLTDCWRECPSPSYSLDSVLPGLNAHSYE
Ga0187863_1004997523300018034PeatlandMNYRHLALHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYSLDNVLPGLSAGSYEEQDAEFLRSIGVQV
Ga0187863_1048062413300018034PeatlandVEPKMNYRHLSLHCQCGEVPDRIAEVGFTDDHCMVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYSLDNALSDLSGSPYEEQDAEFLRSIGVQV
Ga0187863_1072757923300018034PeatlandPTVPRWHAWHWSPGAITLDNRDVRTTTKMNYRHLSLHCQCGEVPEQIAEVGFTDDHSLVVHWWCTECQKVVYVSKPLTDCWRECPSPSHCIERVVPESFTGYQQEDADFLRSIGVQA
Ga0187875_1068990913300018035PeatlandMNYRHLSLRCQCGEIPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVAKSLTDCWRECPSPSYSLDSVLPGLNAH
Ga0187855_1062961313300018038PeatlandKMNYRHLPLHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYSLDNVLPGLSAGSYEEQDAEFLRSIGVQV
Ga0187855_1082523413300018038PeatlandMNYRHLSLHCQCGEVPDSLAEVGFTDDHSLVIHWWCNKCQKVVYVAKALTDCWRECPSPDHSLDRVLPGLSAD
Ga0187887_1048582913300018043PeatlandMNYRHLSLHCQCGEVPDSLAEVGFTDDHSLVIHWWCNKCQKVVYVAKALTDCWRECPSPDHSLDRVLPGLSADSYEEQDADFLRSIGVQV
Ga0187887_1052090323300018043PeatlandMNYRHLPLNCQCGDVPDRIAEIGFTDDHSLVIHWWCSKCQKVVYVTKPLTDCWRECPSPDYSLDNVLSGLSAGSYLEQDAEFLRSIGVQV
Ga0187890_1078705223300018044PeatlandMNYRHLALHCQCGEIPDRIAEVGFTDDHNLVVHWWCPQCQKVVYVAKSLTDCWRECPSPSASLDRALPKLNCDAYEQQDAEFLRSIGVQV
Ga0210389_1034231133300021404SoilMNYRHLSLHCHCGEVPAHIAEVGFTDDHNLVIHWWCSQCQKVVYVSKPLTDCWRECPSPSLSLDNLLPTISPEAYEDQDAEFLRSIGVQV
Ga0210387_1142709223300021405SoilMNYRHLSLRCQCGDVPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVSKPLTECWRECPSASQSLDHVLPKVSNEFYQEQDAEFLRSIGVQV
Ga0224545_100576713300022881SoilMNYRHLSLRCHCGQIPDRIARIGFTEDHSLVIHWWCTQCHKVVCVAKSLSDCWRDCPTPGHSLDSALPELADGAYREEDAEFLRSIGVRA
Ga0224554_110058913300023068SoilMNYRHLSLHCHCGEIPDRIAEVGFTDDHNLVIHWWCARCQKVVYVAKPLTDCWRECPSPSHSLDRVLPQLSPDAHQEPDAHQEEDAQFLRSIGVQV
Ga0224557_102393613300023101SoilCECGEVPDRIAEVGFTDDHSLVIHWWCTKCQKVVYVTKSLTDCWRECPSPNYSLDKVLPGLSAGSYEEQDANFLRSIGVQV
Ga0224557_103956513300023101SoilMNYRHLSLHCQCGEIPDRIAEVGFTDDHNLVVHWWCPQCQKVVYVAKSLTDCWRECPSPSASLDRALPKLNCDAYEQQDAEFLRS
Ga0208188_106121813300025507PeatlandLHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV
Ga0209039_1027273913300027825Bog Forest SoilMNYRHLSLHCQCGEVPDRIAEVGFTDDHCLVIHWWCTNCQKVVHVTKSLTDCWRECPSPNCSLDRALPALTAGSYEEEDAEFLRSIGVQA
Ga0209517_1018561023300027854Peatlands SoilMNYRHLALHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSAGSYEEQDAEFLRSIGVQV
Ga0265338_1049159423300028800RhizosphereMNYRHLSLQCQCGEVPDRIAEVGFTDDHNLVIHWWCTKCQKVVYVTKSLTDCWREFPSPHYSLDTVLPTVSVEAFERQDAEFLRSIGVAV
Ga0265338_1061475823300028800RhizosphereMSYRHLSLQCHCGQTPERIAEVGFTDDHCLVIQWWCIQCQEIVHVTKPLADCWRDCPSPGNSQDGVFPNRSGKGYLEEDAEFLRSIGVQV
Ga0302146_1029491213300028867BogHCQCGEIPDRIVEVGFTDDHKLVIHWWCTKCQKVVYVSKSLTECWRECPSPSIALDRVLAKASDDVYEGQDAEFLRSIGVQV
Ga0311369_1148460613300029910PalsaMNYRHLSLHCNCGEIPDRIAEVGFTDDHNLVIHWWCTHCQKVVFIAKSLTDCWRDCPSENQSLDIVLPKLDLDAMADEDANFLRSIGV
Ga0311361_1031573033300029911BogMNYRHLSLHCHCGEIPERIAEVGFTDDHNLVIHWWCTQCQKVVNVAKSLTDCWRECPSPDYSLDSVLNVLPKPAGDIYEEEDAEFLRSIGVQA
Ga0311363_1102284313300029922FenDHNMNYRHLSLHCHCGEIPDHIAEVGFSDDHHLVIHWWCTNCQKVVYVAKSLTECWRECPNPEASLDVILPKLGLDAIHDEDANFLRSIGVQV
Ga0311339_1062793113300029999PalsaMNYRHLSLRCQCGDVPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVSKPLTECWRECPSANQSLDSVLPAASTEFYQEQDAEFLRSIGVQV
Ga0311339_1079317123300029999PalsaIAEVGFTDDHNLVIHWWCTHCQKVVFIAKSLTDCWRDCPSENQSLDIVLPKLDLDAMADEDANFLRSIGVRV
Ga0311355_1136264923300030580PalsaMNYRHLSLHCQCGEIPDRIAEVGFTDDHSMVIHWWCSKCQKVVYVSKPLTDCWRECPSPSSSLDTVLRGLNADSYEDQDAIFLRSIGVQV
Ga0311355_1166270613300030580PalsaLSLHCQCGEVPDRIAEVGFTDDHSLVVHWWCSKCQKVVYVTKPLTECWRECPNPEYSLDNVLPNLCAESHEDQDAEFLRSIGVQV
Ga0302325_1006119823300031234PalsaMNYRHLSLHCNCGEIPDRIAEVGFTDDHNLVIHWWCTHCQKVVFIAKSLTDCWRDCPSENQSLDIVLPKLDLDAMADEDANFLRSIGVRV
Ga0302324_10015791133300031236PalsaMNYRHLSLHCQCGEVPDRIAEVGFTDDHSLVVHWWCSKCQKVVYVTKPLTECWRECPNPEYSLDNVLPNLWAESHEDQDAEFLRSIGVQV
Ga0265339_1026682913300031249RhizosphereMNYRHLSLQCQCGEVPDRIAEVGFTDDHNLVIHWWCTKCQKVVYVTKSLTDCWRECPSPHYSLDTVLPTVSVEAFERQDAEFLRSIGVAV
Ga0265331_1004854723300031250RhizosphereMNYRHLPLYCQCGEAPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVTKPLTDCWRECPSPNYSLDNVLPAVSPESYEEQDAEFLRSIGVQV
Ga0265314_1071540513300031711RhizosphereMNYRHLSLRCHCGEVPERIAEVGFSEDHSLVIHWWCTQCQKVVYVTKPLTDCWRECPSSEHSLDRVLPKADPDGLLEQDADFLRSCGVQA
Ga0302321_10210207723300031726FenMNYRHLSLHCHCGEVPDRIAEVGFSDDHNLVIHWWCTSCQKVVYVTKPLTDCWRECPSSDHALERVLPKAVPDTFVEQDAEFLRSIGVQV
Ga0311301_1036677623300032160Peatlands SoilMNYRHLALHCQCGDVPDRIAEIGFTDDHSLVIHWWCTKCQKVVYVTKPLTDCWRECPSPDYALDNVLAGLSVGSYEEQDAEFLRSIGVQV
Ga0311301_1150817213300032160Peatlands SoilMNYRHLSLRCQCGEIPDRIAEVGLTDDHNLVIHWWCTRCQKVVYVSKPLTDCWRECPSAQQSLERVLPGVSDDTYRDQDADFLRSIGVQV
Ga0335085_1122382713300032770SoilMNYRHLSLHCQCGEIPDHIAEVGFTDDHSLVIHWWCTNCQKVVYVTKPLTDCWRECPSPNYSLDRVLPSLNNSFEEEDADFLRSIGVQA
Ga0335079_1010929213300032783SoilMNYRHLALHCNCGEIPEHIAEVGFTEDHQLVVHWWCTQCQKLVYISKPLTDCWRECPTREQSLEYALPRATGGTYEKEDAAFLRSIGVRV
Ga0335079_1016823423300032783SoilMNYRHLSLHCQCGEIPEHIGEVGFTDDHNLVIHWWCNQCHKVVYVTKSLTECWRECPSPQYSLERVLPALSAESHEAEDAEFLRSIGVQV
Ga0335079_1026724333300032783SoilMNYRHLALHCNCGEIPEHIAEVGFTEDHQLVVHWWCGQCQKLVYISKPLTDCWRECPTREQSLEYALPRATGGAYEKEDADFLRSIGVRV
Ga0335078_1002171933300032805SoilMNYRHLSLHCQCGEVPDRIAEVGFTDDHSLVIHWWCSNCQKVVYVTKPLTDCWRECPSPDYSLDRVLPALKNGSFDEGRYEEEDAAFLRSIGVQA
Ga0335078_1246386323300032805SoilYRHIPLQCQCGEIPEHIAEVGLTDDRCLVVHWWCAGCQKVVYLAKPLTDCWRECPSPAFALDRVLPQAGRDAYAEQDAEFLRRIGVRAS
Ga0335080_1057154323300032828SoilMSGKGPVTYMNYRHLALHCNCGEIPEHIAEVGFTEDHQLVVHWWCGQCQKLVYISKPLTDCWRECPTREQSLEYALPRATGGAYEKEDADFLRSIGVRV
Ga0335080_1231351723300032828SoilIPDHIAEVGFTDDHSLVIHWWCTNCQKVVYVTKPLTDCWRECPSPNYSLDRVLPSLNNSFEEEDADFLRSIGVQA
Ga0335071_1148058323300032897SoilMNYRHLSLHCQCGEVPDHIAEVGFTDDHNLVIHWWCSNCQKVVYVTKSLTDCWRECPSPSTSLDRVLPELANGYEEEDADFLRSIGVKV
Ga0335072_1002091143300032898SoilMNYRHLSLHCQCGEVPDHIAEVGFTDDHSLVIHWWCTNCQKVVYVTKPLTDCWRECPSANYSLDRVLPALKNTFEEEDADFLRSIGVQA
Ga0335072_1013838533300032898SoilMNYRHLALHCQCGETPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVNKPLTECWRECPSTAYSLDRVLPTLSAESYEAQDAEFLRSIGVQA
Ga0335073_1013515853300033134SoilMNYRHLALHCQCGETPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVNKPLTECWRECPSTAYSLDRVLPNLSAESYEAQDAEFLRSIGVQA
Ga0335077_1006134953300033158SoilVTYMNYRHLALHCNCGEIPEHIAEVGFTEDHQLVVHWWCGQCQKLVYISKPLTDCWRECPTREQSLEYALPRATGGAYEKEDADFLRSIGVRV
Ga0326728_10000587973300033402Peat SoilMNYRHLSLRCQCGEIPDRIAEVGFTDDHSMVIHWWCTGCQKVVYVAKPLTDCWRECPSPDHSLDRVLPSLSADSYEDQDALFLRSIGVQV
Ga0326728_1006543033300033402Peat SoilMNYRHLSLHCQCGDVPDRIAEIGFTDDHSLVIHWWCSKCQKVVYVTKPLTDCWRECPSPDYSLDNALSGLSAGSYEEQDAEFLRSIGVQV
Ga0326727_1117691223300033405Peat SoilMNYRHLSLLCQCGEVPDRIAEIGFTDEHNLVIHWWCTSCQKVVYVTKPLTDCWRECPSPDYSLDRVLPTVIADSYEEQDAEFLRSIGVQV
Ga0334792_114353_123_3953300033888SoilMNYRHLSLHCQCGEIPDRIAEVGFTDDHNLVIHWWCPQCQKVVYVAKSLTDCWRECPSPSASLDRALPKLNRDAYEQQDAEFLRSIGVQV
Ga0314861_0313485_480_7043300033977PeatlandDQIAEVGFTDDHSLVIHWWCTKCQKVVYVTKPLTECWRECPSPDYSLDRVLPSLSAESYEEQDAEFLRSIGVQV
Ga0334827_044509_863_11353300034065SoilMNYRHLSLHCQCGQIPDRIAEVGFTDDHNLVIHWWCAKCQKVVYVTKPLTDCWRECPSPNYSLDNVLPTVSAESYAEQDAEFLRSIGVQV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.