Basic Information | |
---|---|
Family ID | F086438 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 110 |
Average Sequence Length | 45 residues |
Representative Sequence | VTKYKLVIPIKGIMILVFWEKSFKSMEADYSNHLASPLVASCGEI |
Number of Associated Samples | 68 |
Number of Associated Scaffolds | 110 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 7.14 % |
% of genes near scaffold ends (potentially truncated) | 12.73 % |
% of genes from short scaffolds (< 2000 bps) | 12.73 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.091 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (71.818 % of family members) |
Environment Ontology (ENVO) | Unclassified (94.545 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (90.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.29% β-sheet: 24.66% Coil/Unstructured: 52.05% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 110 Family Scaffolds |
---|---|---|
PF04195 | Transposase_28 | 2.73 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.09 % |
All Organisms | root | All Organisms | 0.91 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005618|Ga0068864_102179448 | Not Available | 561 | Open in IMG/M |
3300009992|Ga0105120_1023713 | Not Available | 692 | Open in IMG/M |
3300015315|Ga0182120_1089961 | Not Available | 597 | Open in IMG/M |
3300015328|Ga0182153_1135851 | Not Available | 527 | Open in IMG/M |
3300015331|Ga0182131_1081609 | Not Available | 651 | Open in IMG/M |
3300015332|Ga0182117_1166179 | Not Available | 507 | Open in IMG/M |
3300015348|Ga0182115_1104642 | Not Available | 891 | Open in IMG/M |
3300015349|Ga0182185_1234407 | Not Available | 558 | Open in IMG/M |
3300015354|Ga0182167_1073773 | Not Available | 1217 | Open in IMG/M |
3300015354|Ga0182167_1119741 | Not Available | 969 | Open in IMG/M |
3300028050|Ga0268328_1017369 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 817 | Open in IMG/M |
3300028053|Ga0268346_1039194 | Not Available | 524 | Open in IMG/M |
3300028154|Ga0268341_1029134 | Not Available | 518 | Open in IMG/M |
3300028526|Ga0268339_1019291 | Not Available | 518 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 71.82% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 13.64% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 8.18% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.91% |
Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.91% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017692 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028143 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028262 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028526 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070667_1009892291 | 3300005367 | Switchgrass Rhizosphere | QSINLLFPSKGIMILVSWEKSFKNLEADYNNHLASPLVASCREISLSP* |
Ga0068864_1021794482 | 3300005618 | Switchgrass Rhizosphere | IPISGIKIFVFREISYKSMEADYSNHLASPLVASCREISLSP* |
Ga0105137_1085761 | 3300009972 | Switchgrass Associated | LVIPIRGIMILVFWEKSFKSIEADYSNHLASPLVASCGKISLSP* |
Ga0105129_1072731 | 3300009975 | Switchgrass Associated | VTKYKLVIPIKGIMILVFWEKSFKGMDADYSNHLASSLLASFAGKDYTNFR |
Ga0105128_1055512 | 3300009976 | Switchgrass Associated | MTKYKLVIPIKGIMILVFGEKNFKSLEADYSNRLARSLVASYKEISSSP* |
Ga0105128_1108472 | 3300009976 | Switchgrass Associated | MIKYKLVIPIKGIMILVFWEKSFKSKEADYSKHLASPLLAS* |
Ga0105128_1108792 | 3300009976 | Switchgrass Associated | IKGIMILVFWEESFKSSEADYSNHLASPLVASCGEISPSP* |
Ga0105133_1043102 | 3300009981 | Switchgrass Associated | MTKYKLVIPIKGIMIHVLWEESFKSLEADYSNHLASPLV |
Ga0105132_1034712 | 3300009990 | Switchgrass Associated | PMTKYKLVIPIEGIMILVFWEKSFKSLEADYSNHLASPLVASSGETSPSPRIRL* |
Ga0105132_1377031 | 3300009990 | Switchgrass Associated | DRPEAVTKYKLVIPTKGIMILLFWEKNFKSKEAYYSNRLARSLVASCKGISPSP* |
Ga0105120_10237132 | 3300009992 | Switchgrass Associated | PEAVTKYKLIILIKGIMILVLWEKNFKSMEADYSNRLASPLIASCGEISPSL* |
Ga0134125_117345622 | 3300010371 | Terrestrial Soil | MTKYKLVIPIKGIMILIFWEKSFKSLEADYSNRLARSLVASCGEIS |
Ga0134127_124139981 | 3300010399 | Terrestrial Soil | VTKNKLVIPIKGIMILVFWEKSFKSMEADYSNHLASPLVASSGET |
Ga0134122_119322171 | 3300010400 | Terrestrial Soil | MTKYKLVIPTKGIIILVFWEKSFKSLEADYSNCLARSLVAS |
Ga0153798_102940091 | 3300012949 | Switchgrass Degrading | VTKYKLVISIKGIMIHVSWEKIFKSMEADYNNHLASPLVASSGETS |
Ga0157380_128206921 | 3300014326 | Switchgrass Rhizosphere | TKYKLIIPVKGIMILVFWEKSFKRLEADYSNRLARSLVASCRRISHSP* |
Ga0182183_10296291 | 3300015270 | Switchgrass Phyllosphere | IKGIMILIFWEKSFKSLEADYSNRLARSLVASCGEISPSP* |
Ga0182183_10535831 | 3300015270 | Switchgrass Phyllosphere | VTRYKLVIPIKGIMILGFWEKIFKSMEADYSNHLANP |
Ga0182101_10293472 | 3300015284 | Switchgrass Phyllosphere | VTKYKLVIPIKGIMIPILWEKDFKSLEADYSNHLARSLVASCGEISPSP* |
Ga0182103_10439181 | 3300015293 | Switchgrass Phyllosphere | VTKYKLVIPIKGIMILVLWEKSFKSMEVDYSNHLASPLVASSGETSPS |
Ga0182104_10883231 | 3300015297 | Switchgrass Phyllosphere | VTKYKLVILIKGIMILVFWEKSFKSMKADYSNHLTSTLVASSGETSPS |
Ga0182184_10811281 | 3300015301 | Switchgrass Phyllosphere | GIMILIFWEKSFKSLEADYSNHLARSLVASCGEISPSP* |
Ga0182180_10568182 | 3300015306 | Switchgrass Phyllosphere | VTKYKIVIPTKGIMIFVFWEKSFKSKEVDYSKHIARSLVASYKGIS |
Ga0182098_10789261 | 3300015309 | Switchgrass Phyllosphere | RPEAITKYKHVIPIKGIMILIFWEKSFKSLEADYSNRLARSLVAFCGEISPSP* |
Ga0182162_10827191 | 3300015310 | Switchgrass Phyllosphere | ISGIKIFVFREISYKSMEADYSNHLASLLVASCREISPSP* |
Ga0182182_10743421 | 3300015311 | Switchgrass Phyllosphere | KLVIPISGIKIFVFWEISYKSMEPDYSNHLANPLVASCR* |
Ga0182164_10441382 | 3300015313 | Switchgrass Phyllosphere | RPEAITKYKHVIPIKGIMILIFWEKSFKSLEADYSNRLARSLVASCGEISPSP* |
Ga0182164_11231381 | 3300015313 | Switchgrass Phyllosphere | TKYKLVIPMKEIMILVFWEKGFKSKEADYSNRLARSLVASCKGISPSP* |
Ga0182164_11251121 | 3300015313 | Switchgrass Phyllosphere | VTKYKLVIPIKGIMILVFWEKSFKSMEADYSNHLASPLVAS |
Ga0182120_10411361 | 3300015315 | Switchgrass Phyllosphere | MIKYKLLIPIKGIMILVLWEKSFKSLEADYNNRLARSL |
Ga0182120_10899611 | 3300015315 | Switchgrass Phyllosphere | MTKYKLIIPIKGIMILVFWEKSFKSLEADYSNRLARSLLESCKGISPSP* |
Ga0182121_10517272 | 3300015316 | Switchgrass Phyllosphere | GLRPLQSSKLIIPTKEIMIVVFWEKSFKSKEADYSKCLASPLLAS* |
Ga0182136_10697431 | 3300015317 | Switchgrass Phyllosphere | VTKYKLVISIKGIMILVFWEKSFKSMEADYSNHLASPLISSCREISP |
Ga0182136_10717611 | 3300015317 | Switchgrass Phyllosphere | MTKYKHVIPTKGIMILILWEESFKSFEADYSNHLASPLIASCGEISP |
Ga0182136_11310662 | 3300015317 | Switchgrass Phyllosphere | YKLVIPIRGIMILVFWEKDFKRLEADYSNHLARSLVASCREISPSP* |
Ga0182130_11340701 | 3300015319 | Switchgrass Phyllosphere | VTKDKLVIPIERIMILVFWEKSSNSKEADYSKRLSTP |
Ga0182134_10437631 | 3300015324 | Switchgrass Phyllosphere | MTKYKLVIPIKRIMILIFWEKKFKSLEVDYSNRLARSLVASYREVSPSP* |
Ga0182148_11473591 | 3300015325 | Switchgrass Phyllosphere | MYKLVIPTKGIMILIFWEKSARSKEADYSKRLVRPLL |
Ga0182153_11358512 | 3300015328 | Switchgrass Phyllosphere | TKYKLVIPTKGIMILVFWEKSFKSKEAYYSNHLARSLVASCIEISPSL* |
Ga0182135_10497741 | 3300015329 | Switchgrass Phyllosphere | VTKYKLDIPIKGIMILIFWEKSFKSMEVDYSNRLASPLVAS |
Ga0182152_10211131 | 3300015330 | Switchgrass Phyllosphere | KLVIPTKGIMIFISWDKSFKSKEADYSKCLASPLLAS* |
Ga0182152_10561121 | 3300015330 | Switchgrass Phyllosphere | MIKYKLFIPIKGIMILVFWEESFKSMEADYSNRPVSPLV |
Ga0182152_10721542 | 3300015330 | Switchgrass Phyllosphere | MTKYKLVIPTKGIMILVFWEKSFKSMEADYSNHLASSLVASSGETSPSSRI* |
Ga0182152_10951301 | 3300015330 | Switchgrass Phyllosphere | LDRPEAVTKYKLVIPIKGIMLLIFWEKSFKSMEADYSNHLA |
Ga0182152_11422181 | 3300015330 | Switchgrass Phyllosphere | VTKYKLVISIQGIMILVFWEKSFKSMEADYSNHLASPL |
Ga0182131_10816091 | 3300015331 | Switchgrass Phyllosphere | KLVIPTKGIMILIFWEKSFKSKEANYSNRLARSLVASCIGISPSL* |
Ga0182131_11155801 | 3300015331 | Switchgrass Phyllosphere | LVIPIKGIMILVFWEKSFKSLEVDYSNRLARSLVASCGEISPSP* |
Ga0182131_11244921 | 3300015331 | Switchgrass Phyllosphere | YKLVIPIKGIMILIFWEKSFKSKETDYSNRLARSIVASCKRISPSP* |
Ga0182117_11661791 | 3300015332 | Switchgrass Phyllosphere | KLVIPIKGIMILVFWEKSFKSLEADYSNHLASSLVASYGEISPSP* |
Ga0182132_10164301 | 3300015334 | Switchgrass Phyllosphere | VTKYKLVIPIKGIMIPILWEKDFKSLEADYSNHLARSLVASCGEI |
Ga0182132_10603991 | 3300015334 | Switchgrass Phyllosphere | AMTKYKLVIPTKGIMILVFWEKSFKSLEAYYSNHLTRSLVASCKGISPSP* |
Ga0182132_11067221 | 3300015334 | Switchgrass Phyllosphere | MSKYKLVIPTKGIMILVLWEKSFKSLEADYSNHLASPLVASCGEIS |
Ga0182116_10594851 | 3300015335 | Switchgrass Phyllosphere | KYKLVIPIKGIMILVFWEKSFKSLEADYSNRLARSLVASCREISPSP* |
Ga0182116_10667691 | 3300015335 | Switchgrass Phyllosphere | YKASKLVIPRLGTTIFVLWEKSFKSKQADYSTRLASPLLAA* |
Ga0182116_11460011 | 3300015335 | Switchgrass Phyllosphere | IPIKGIMILVFWEKSFKSLEADYSNRLARSLVASCGEISPSP* |
Ga0182150_11441671 | 3300015336 | Switchgrass Phyllosphere | VTKYKLVIPTKGIKILVLWEKTLKSMKADYSNRLASPLVAPRI |
Ga0182151_10639161 | 3300015337 | Switchgrass Phyllosphere | QLDRPEAVTKYKHVIPIKGIMILVFWEKSFKSKEADYSNCLARSLVASCKGISPSP* |
Ga0182151_11217431 | 3300015337 | Switchgrass Phyllosphere | MTKYKLVIPIKGIMILVFLEKSFRSLEADYSNHLASP |
Ga0182133_10859701 | 3300015340 | Switchgrass Phyllosphere | MIEYKLVIPIKGIMILVFWEKSLKSLETDYSNHLARSVVASCGEIS |
Ga0182133_11201811 | 3300015340 | Switchgrass Phyllosphere | MTKYKLAIPIKGIMILVFWEKSFNSLDVDYSNHLERSLVAS |
Ga0182115_11046421 | 3300015348 | Switchgrass Phyllosphere | AMTKYKLVIPIKGIMILIFWEKSFKSLEEDYSNRLARSLVASCGEISPSPLIHCDKIKSPY* |
Ga0182115_11852491 | 3300015348 | Switchgrass Phyllosphere | KYKLVIPIKGIMILIFWEKSFKSKETDYSNRLARSIVASCKRISPSP* |
Ga0182185_11095791 | 3300015349 | Switchgrass Phyllosphere | KYKFVIPTKGVKILAFWEKSFKSKEVDYSKHIARSLVASYKGISPSP* |
Ga0182185_11905812 | 3300015349 | Switchgrass Phyllosphere | KLIIPIKGIMILVFWEKSFKSKEADYSKCLASPLLAS* |
Ga0182185_12344071 | 3300015349 | Switchgrass Phyllosphere | MIKYKLVIPIKGIMIFVFWEKSFKSLEADYSNHLASSLVASCGEISPSPRIRCDKIKSPT |
Ga0182185_12707772 | 3300015349 | Switchgrass Phyllosphere | IPIKGIMILVFWEKSFKSLEADYSSHLARSLVASCGEISPSP* |
Ga0182163_11742522 | 3300015350 | Switchgrass Phyllosphere | MTKYKLVIPIKGIIIFVFWEKRFKSLEADYSNCLARSLVASCGEISPSP* |
Ga0182169_11665881 | 3300015352 | Switchgrass Phyllosphere | IPIKGIMILVFWEKSFKSLEADYSNHLVSPLVASCGEISPSL* |
Ga0182169_12266831 | 3300015352 | Switchgrass Phyllosphere | RPEAVTKYKLVIPIKGIMITIFWEKSFKSLDADYSNRLARSRIASYGEISSQDATRGLAR |
Ga0182169_12325141 | 3300015352 | Switchgrass Phyllosphere | RLKAMTKYKLVIPTKGIMILVFWEKSFKSLEAYYSNHLTRSLVASCKGISPSP* |
Ga0182169_12397841 | 3300015352 | Switchgrass Phyllosphere | PEAVTKYKLVIPIKGIMILVFWEKSFKSLEADYTNHLSSPLVASFGEIFPSP* |
Ga0182169_13017171 | 3300015352 | Switchgrass Phyllosphere | VTKYKLVIPIKGIMILVSWEKSFKSMEADYSNHLASTLVASSGETSPSP |
Ga0182179_10588641 | 3300015353 | Switchgrass Phyllosphere | VTKYKLVIPTKEIMILILWEKSFKSMEADYSNHLASPFVASS |
Ga0182179_11663271 | 3300015353 | Switchgrass Phyllosphere | MTKYKLVIPIKGIMILVFWEKSFKSMEADYSNHLASP |
Ga0182179_13047351 | 3300015353 | Switchgrass Phyllosphere | MTKYKFVIPTKGIMILVLWEESFKSLEADYSNHLAS |
Ga0182167_10737731 | 3300015354 | Switchgrass Phyllosphere | PEAVTKYKLVIPIKGIMILVFWEKSFKIKEADYSNRLARSLVASCKVISPSP* |
Ga0182167_11197412 | 3300015354 | Switchgrass Phyllosphere | TKYKLVIPIKGIMILVFWEKRFKSLEVGYSNRLARSLVASCIEISPSL* |
Ga0182167_11658641 | 3300015354 | Switchgrass Phyllosphere | MSKYKLIIPISGIKIFIFREISYKSMEADYNNHLASPL |
Ga0182167_13485091 | 3300015354 | Switchgrass Phyllosphere | MTKYKLVIPTKGIMIHVSWEKSYRNMKADYSNHLASTLVASSGET |
Ga0182167_13554581 | 3300015354 | Switchgrass Phyllosphere | MTKYKLVIPTKGIMILVLWEESFKSLEADYSNHLASPLVASCGEISPSP |
Ga0182199_11023141 | 3300017412 | Switchgrass Phyllosphere | VTKYKLVISIKGIMITIFWEKSFKSLEADYSNRLARSLVASCGEIS |
Ga0182199_11692711 | 3300017412 | Switchgrass Phyllosphere | KGIMILIFWEKSFKSLEADYSNRLARSLVASCGEISPSP |
Ga0182195_11738601 | 3300017414 | Switchgrass Phyllosphere | MTKYKLVIPTKGIMILVLWEESFKSLEADYSNHLASPLV |
Ga0182194_10884922 | 3300017435 | Switchgrass Phyllosphere | MTKYKLVIPTKGIMILVFWEKSFKSMEADYSNHLASSLVASSGETSPSSRI |
Ga0182214_11141862 | 3300017440 | Switchgrass Phyllosphere | MQLDQPEVVTKYKLVIPIKGIMILVFWEKRFKSLEADYSNRLARSL |
Ga0182215_11110871 | 3300017447 | Switchgrass Phyllosphere | VTKYKLVIPIKGIMILAFCEKSFKSMEADYSNCLASPLVA |
Ga0182210_11000141 | 3300017692 | Switchgrass Phyllosphere | MTKYKLIIPTKGTMILVLWEESFKSLEEDYSNHLAS |
Ga0182216_10493442 | 3300017693 | Switchgrass Phyllosphere | AVTKYKLVIPTKGIMIFVFWEKSFNSKEADYSNRLARSLL |
Ga0182216_10524371 | 3300017693 | Switchgrass Phyllosphere | AVTKYKIVIPTKGIMIFVFWEKSFKSKEVDYSNHIARSLVASYKGISPSP |
Ga0182216_10778092 | 3300017693 | Switchgrass Phyllosphere | MTKYKFVIPTKGIMILVFWEKSLKSMEADYSNHLASPLVASS |
Ga0182118_1032591 | 3300020223 | Switchgrass Phyllosphere | VTKYKLVIPIKGIMILVFWEKSFKSMEADYSNHLASPLVASCGEI |
Ga0268328_10173693 | 3300028050 | Phyllosphere | QRLLQLDRPEAITKYKHVIPIKGIMILVFWEESFKSLETDYSNRLARSLVASYGEISPSP |
Ga0268328_10245121 | 3300028050 | Phyllosphere | VIKYKLVIPIKGIMILVLWEKIFKSMEADYSNHLASPLVASSG |
Ga0268328_10301862 | 3300028050 | Phyllosphere | SGIKIFVFRKISYKSMEANYSNHLASPLVASCREISLSP |
Ga0268346_10391942 | 3300028053 | Phyllosphere | VIPISGIKVFVFREISYKSMEADYSNHLASPLVASCREISPSP |
Ga0268332_10192011 | 3300028058 | Phyllosphere | MTKYKLVIPISGIKIFVFREISYKSMEADYSNHLASPLVASC |
Ga0268350_10491721 | 3300028063 | Phyllosphere | MTKYKLVIPTKGIMILVLWEKSFKSMEADYSNHLASPL |
Ga0268340_10685041 | 3300028064 | Phyllosphere | MTKYKLVIPTKGIMILVPWEKSFKSMEADYSNLLASCNTLI |
Ga0268348_10098742 | 3300028143 | Phyllosphere | IKGIKIFVFREISYKSMEADYSNHLASPLVASCREISLSP |
Ga0268343_10133401 | 3300028150 | Phyllosphere | AVTKYKLVIPIKGIMILVFWEKDFKRLEADYSNHLARSLVAS |
Ga0268341_10291341 | 3300028154 | Phyllosphere | IPISGIKIFIFREISYKSMEADYSNHLASPLVASCREISLSP |
Ga0268310_10392311 | 3300028262 | Phyllosphere | VIKYKLFIPISGIKIFVFWEISYKSMEADYSNHLTSPLVASCREIS |
Ga0268315_10149951 | 3300028472 | Phyllosphere | MTKYKLVIPIKGIIIFVFWEKRFKSLEADYSNCLARS |
Ga0268339_10192912 | 3300028526 | Phyllosphere | DRPEAITKYKHVIPIKGIMILIFWEKSFKSLEADYSNRLARSLVASCGEISPSP |
Ga0268335_10047872 | 3300028527 | Phyllosphere | QLDRLEAMTKYKLVIPIKGIMILVFWEKSFKSLEVDYSNHLARSLVASCGEISPSP |
Ga0268335_10098421 | 3300028527 | Phyllosphere | GIKIFVFREISYKSMEADYSNHLASPLVASCREISPSP |
Ga0214492_10947231 | 3300032464 | Switchgrass Phyllosphere | MTKYKLVIPIKGIMILVLWEKSFKSMEADYSNRLASPLVASSGETS |
Ga0214490_10483781 | 3300032502 | Switchgrass Phyllosphere | EAVAKYKFVIPIKRIIILVFREKSFKSLEADYSNCLARSLVASCGEISPSP |
Ga0214490_11098501 | 3300032502 | Switchgrass Phyllosphere | MTKYKLVIPIKGIMILVFWKKSFKSLEADYSNHLASPLVASCGEIS |
Ga0214501_11663112 | 3300032625 | Switchgrass Phyllosphere | IIPISGIMIFVFREISYKSMEADYSNHLANPLVASCREISLSP |
⦗Top⦘ |