Metagenome / Metatranscriptome Family F086417

Overview

Basic Information

• Family ID: F086417
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 110
• Average Sequence Length: 39 residues
• Representative Sequence: VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTD
• Number of Associated Samples: 69
• Number of Associated Scaffolds: 110

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 77.27 %
• % of genes near scaffold ends (potentially truncated): 100.00 %
• % of genes from short scaffolds (< 2000 bps): 98.18 %
• Associated GOLD sequencing projects: 69
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (99.091 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (45.454 % of family members)
• Environment Ontology (ENVO): Unclassified (83.636 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (80.909 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 0.00%
  β-sheet: 39.71%
  Coil/Unstructured: 60.29%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
All Organisms	root	All Organisms	0.91 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
cellular organisms	root	All Organisms → cellular organisms	0.91 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.91 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.91 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.91 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.91 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.91 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.91 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.91 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.91 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.91 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.91 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.91 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.91 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.91 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.91 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.91 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	0.91 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	0.91 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	0.91 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	0.91 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	0.91 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	99.09 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	0.91 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005330|Ga0070690_101710677	Not Available	512
3300005335|Ga0070666_10486755	Not Available	893
3300005617|Ga0068859_102551493	Not Available	562
3300005618|Ga0068864_101980527	Not Available	588
3300005618|Ga0068864_102383716	Not Available	535
3300005841|Ga0068863_101721709	Not Available	636
3300005841|Ga0068863_101904606	Not Available	604
3300005841|Ga0068863_102326783	Not Available	545
3300005842|Ga0068858_102310151	Not Available	531
3300005843|Ga0068860_101902821	Not Available	616
3300005843|Ga0068860_102365518	Not Available	551
3300005843|Ga0068860_102433761	Not Available	543
3300010371|Ga0134125_12717850	Not Available	538
3300010399|Ga0134127_11395407	Not Available	771
3300014325|Ga0163163_11993143	Not Available	640
3300015280|Ga0182100_1081605	Not Available	541
3300015284|Ga0182101_1072424	Not Available	564
3300015310|Ga0182162_1071779	Not Available	627
3300015310|Ga0182162_1096768	Not Available	562
3300015310|Ga0182162_1102507	Not Available	550
3300015310|Ga0182162_1116587	Not Available	524
3300015310|Ga0182162_1120831	Not Available	517
3300015311|Ga0182182_1038712	Not Available	750
3300015311|Ga0182182_1087429	Not Available	569
3300015311|Ga0182182_1121686	Not Available	504
3300015315|Ga0182120_1107855	Not Available	557
3300015316|Ga0182121_1128047	Not Available	531
3300015317|Ga0182136_1070833	Not Available	654
3300015318|Ga0182181_1100587	Not Available	529
3300015327|Ga0182114_1131765	Not Available	549
3300015327|Ga0182114_1137022	Not Available	540
3300015329|Ga0182135_1126834	Not Available	546
3300015332|Ga0182117_1007188	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1508
3300015332|Ga0182117_1151600	Not Available	528
3300015334|Ga0182132_1068949	Not Available	724
3300015334|Ga0182132_1169788	Not Available	502
3300015336|Ga0182150_1144742	Not Available	533
3300015337|Ga0182151_1139135	Not Available	542
3300015338|Ga0182137_1077414	Not Available	716
3300015340|Ga0182133_1131941	Not Available	592
3300015340|Ga0182133_1176044	Not Available	522
3300015348|Ga0182115_1195432	Not Available	648
3300015348|Ga0182115_1239925	Not Available	578
3300015349|Ga0182185_1199102	Not Available	606
3300015349|Ga0182185_1231153	Not Available	562
3300015352|Ga0182169_1204770	Not Available	645
3300015353|Ga0182179_1110051	Not Available	832
3300015353|Ga0182179_1199259	Not Available	637
3300015353|Ga0182179_1305211	Not Available	518
3300015354|Ga0182167_1310147	Not Available	558
3300015354|Ga0182167_1367679	Not Available	500
3300017414|Ga0182195_1159238	Not Available	576
3300017422|Ga0182201_1055101	Not Available	700
3300017435|Ga0182194_1024456	Not Available	988
3300017435|Ga0182194_1107274	Not Available	577
3300017439|Ga0182200_1078592	Not Available	652
3300017439|Ga0182200_1144459	Not Available	526
3300017439|Ga0182200_1156616	Not Available	511
3300017691|Ga0182212_1068423	Not Available	786
3300017692|Ga0182210_1137515	Not Available	539
3300017693|Ga0182216_1130946	Not Available	624
3300017694|Ga0182211_1046472	Not Available	991
3300025930|Ga0207701_10994388	Not Available	699
3300025931|Ga0207644_10901111	Not Available	741
3300028049|Ga0268322_1008897	Not Available	893
3300028049|Ga0268322_1010344	Not Available	858
3300028054|Ga0268306_1000194	Not Available	2341
3300028054|Ga0268306_1005444	Not Available	887
3300028054|Ga0268306_1024444	Not Available	567
3300028056|Ga0268330_1017778	Not Available	776
3300028056|Ga0268330_1029244	Not Available	660
3300028056|Ga0268330_1037663	Not Available	605
3300028056|Ga0268330_1038173	Not Available	602
3300028056|Ga0268330_1042391	Not Available	580
3300028056|Ga0268330_1061425	Not Available	506
3300028057|Ga0268352_1041048	Not Available	517
3300028057|Ga0268352_1041611	Not Available	514
3300028058|Ga0268332_1050395	Not Available	596
3300028058|Ga0268332_1063187	Not Available	548
3300028058|Ga0268332_1072276	Not Available	520
3300028064|Ga0268340_1037066	Not Available	683
3300028139|Ga0268355_1003991	Not Available	803
3300028141|Ga0268326_1008570	Not Available	585
3300028142|Ga0268347_1019342	Not Available	604
3300028142|Ga0268347_1027933	Not Available	540
3300028142|Ga0268347_1031357	Not Available	520
3300028143|Ga0268348_1007686	Not Available	734
3300028151|Ga0268308_1026856	Not Available	543
3300028154|Ga0268341_1007962	Not Available	765
3300028253|Ga0268316_1023240	Not Available	514
3300028256|Ga0268304_1000204	Not Available	2177
3300028256|Ga0268304_1000343	Not Available	1796
3300028262|Ga0268310_1008417	Not Available	901
3300028262|Ga0268310_1009227	Not Available	876
3300028262|Ga0268310_1010904	Not Available	833
3300028262|Ga0268310_1016522	Not Available	735
3300028379|Ga0268266_10996810	Not Available	811
3300028467|Ga0268333_1010141	Not Available	558
3300028469|Ga0268337_1010524	Not Available	607
3300028470|Ga0268307_1009830	Not Available	668
3300028470|Ga0268307_1018869	Not Available	548
3300028472|Ga0268315_1010611	Not Available	676
3300028523|Ga0268313_1000617	Not Available	1360
3300028525|Ga0268305_103566	Not Available	735
3300028526|Ga0268339_1015363	Not Available	553
3300028527|Ga0268335_1017450	Not Available	515
3300028529|Ga0268311_1026340	Not Available	523
3300032464|Ga0214492_1032026	Not Available	1007
3300032689|Ga0214497_1101501	Not Available	623
3300033530|Ga0314760_1186356	Not Available	502

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	96.36%
Environmental	Environmental	3.64%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	96.36%
Terrestrial	Environmental → Terrestrial	3.64%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	83.64%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.09%
Soil	Environmental → Terrestrial → Soil	3.64%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.73%
Roots	Host-Associated → Plants → Roots	0.91%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	83.64%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.09%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	2.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.73%
Loam	Environmental → Terrestrial → Soil → Loam	0.91%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.91%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	83.64%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.09%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.73%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.82%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.91%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.91%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.91%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	45.45%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	38.18%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	9.09%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.73%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.82%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.91%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.91%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028467	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1	Host-Associated
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated
3300028525	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1	Host-Associated
3300028526	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_07AUG2017_LD1	Host-Associated
3300028527	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1	Host-Associated
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated
3300032464	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated
3300033530	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070690_1017106772	3300005330	Switchgrass Rhizosphere	MHPILIFTMGQVRQQNGVKPPETRVLEVKYVVRNQRDVVEH
Ga0070666_104867551	3300005335	Switchgrass Rhizosphere	HLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH*
Ga0068859_1025514931	3300005617	Switchgrass Rhizosphere	VHLMHPILIFTMGQVGQRNGVKPPETRVLDVKYVVRNQTDI
Ga0068864_1019805271	3300005618	Switchgrass Rhizosphere	MYLMHPILNFRMGQVRQRNGVKPLETRVLDIKYVVRNQTDVLEH
Ga0068864_1023837162	3300005618	Switchgrass Rhizosphere	MHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRN
Ga0068863_1017217092	3300005841	Switchgrass Rhizosphere	LHLMHPILNFRMGQVRQRNGVKPPETRVLDIKYVVRN
Ga0068863_1019046062	3300005841	Switchgrass Rhizosphere	VHMMHPILIFTMGQVRQRNGVKPPETRVLDVKYMV
Ga0068863_1023267831	3300005841	Switchgrass Rhizosphere	VHLMHSILIFTMGQVRQRNGVKPPETRVLDIKYVV
Ga0068858_1023101511	3300005842	Switchgrass Rhizosphere	VHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQ
Ga0068860_1019028212	3300005843	Switchgrass Rhizosphere	VHLMHPILIFTMGQVQQRNGVKPPETRVLDVKYVVRNQ
Ga0068860_1023655182	3300005843	Switchgrass Rhizosphere	VHLMHPILIFTMGQVRQRNGMKPPETRVLDIKYVVRNQPD
Ga0068860_1024337611	3300005843	Switchgrass Rhizosphere	VHSMHPILIFTMGQVWQRNGMKPPETRVLDVKYVVRNQTDI
Ga0134125_127178501	3300010371	Terrestrial Soil	VHLIYPILIFTMGQVQQRNGVKPPETRVLDVKYVV
Ga0134127_113954071	3300010399	Terrestrial Soil	HPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH*
Ga0163163_119931431	3300014325	Switchgrass Rhizosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTD
Ga0182100_10816051	3300015280	Switchgrass Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPKTRVFDLKLWIGH
Ga0182101_10724241	3300015284	Switchgrass Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPHKTRVLNVKYVVRNQ
Ga0182162_10717792	3300015310	Switchgrass Phyllosphere	MHPILIFTMGHVRQRNGVKPPETRVLEVKYVVRNQRDVVEHRNGV
Ga0182162_10967681	3300015310	Switchgrass Phyllosphere	MHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH
Ga0182162_11025071	3300015310	Switchgrass Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLEIKYVVRNQSD
Ga0182162_11165871	3300015310	Switchgrass Phyllosphere	VHLMYPILIFTMGQVWQRNGVKPPETRVLDVKYVVRNQTD
Ga0182162_11208311	3300015310	Switchgrass Phyllosphere	MHLMHPILNFRMGQVRQRNGVKPPETRVSDIKYVVRNQTD
Ga0182182_10387122	3300015311	Switchgrass Phyllosphere	RHKLVHLMHLILIFTMGQVRQRNGVKPPETRVLDVKYVMRNQTDV*
Ga0182182_10874291	3300015311	Switchgrass Phyllosphere	VHLMRPILIFTMGQVRQLNGVKPPETRVLDVKYVVRNQTD
Ga0182182_11216861	3300015311	Switchgrass Phyllosphere	VHLKHPILIFTMGQVRQRSGVKPLETRVLDVKYVVR
Ga0182120_11078551	3300015315	Switchgrass Phyllosphere	MHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDVV
Ga0182121_11280472	3300015316	Switchgrass Phyllosphere	VHLMHPILIFKMGQVRQRNGVKPPETRVLDIKYVVRN
Ga0182136_10708332	3300015317	Switchgrass Phyllosphere	MHPILIFTMGHVRQRNGVKPPETRVLEVKYVVRNQRDVVEHR
Ga0182181_11005871	3300015318	Switchgrass Phyllosphere	MHLMHPILIFTMGQVRQRNSVKPPETRDLDVKYVV
Ga0182114_11317651	3300015327	Switchgrass Phyllosphere	VHLMHSILIFTMGQVRQRNGVKPPETRVLEVKYAVRNQRNV
Ga0182114_11370221	3300015327	Switchgrass Phyllosphere	MYLMHPILNFRMGQVRQRNGVKPLETRVLDIKYVVRNQT
Ga0182135_11268343	3300015329	Switchgrass Phyllosphere	VHLMHPILIFTMGQVQQRNGMKPPETRVLDVKYVVRNQTDVLE
Ga0182117_10071882	3300015332	Switchgrass Phyllosphere	VHLMQPILIFTMAQVRQRNGMKLPETRVLDVKYVV*
Ga0182117_11516001	3300015332	Switchgrass Phyllosphere	VHLMHPILNFRMGQVRQRNGVKPPETRVLDIKYVVRNQTDV
Ga0182132_10689492	3300015334	Switchgrass Phyllosphere	MHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNH
Ga0182132_11697882	3300015334	Switchgrass Phyllosphere	VHLMHSILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLE
Ga0182150_11447421	3300015336	Switchgrass Phyllosphere	VHSMHPILIFTMGQVWQRNGMKPPETRVLDVKYVVR
Ga0182151_11391351	3300015337	Switchgrass Phyllosphere	MHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQT
Ga0182137_10774141	3300015338	Switchgrass Phyllosphere	MHPILIFTMGQVRQRNGVKPPKTRILDVKYVVRNQTNVV
Ga0182133_11319411	3300015340	Switchgrass Phyllosphere	VHLMHPILIFTMGQVQQRNGVKPPETRVLDVKYVV
Ga0182133_11760441	3300015340	Switchgrass Phyllosphere	VHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDV
Ga0182115_11954321	3300015348	Switchgrass Phyllosphere	MHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQPDVLEH*
Ga0182115_12399251	3300015348	Switchgrass Phyllosphere	IFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH*
Ga0182185_11991021	3300015349	Switchgrass Phyllosphere	VHLMHPIFIFTMGQVRQRNGVKPPETRVIDVKYVVRNQTDVLEH
Ga0182185_12311531	3300015349	Switchgrass Phyllosphere	MRPILIFTMGQVRQRNGVKQPETRVLEVKYVVRNQRDVVEH
Ga0182169_12047702	3300015352	Switchgrass Phyllosphere	MHPMLIFTMGQVRQRNGVKPLETRVLDIKYVVQNQMDILE
Ga0182179_11100512	3300015353	Switchgrass Phyllosphere	MHLMHPILIFTMGQVRQRNGVKPPETRILDVNYVVRN
Ga0182179_11992591	3300015353	Switchgrass Phyllosphere	VHLMHPILIFTMGQVWQRNGVKPPETRVLDIKYVVRNQTDVLEHRN
Ga0182179_13052111	3300015353	Switchgrass Phyllosphere	MHLMHPILIFTMGQVRQRNGVKPPETRVLEVKYVVRNQRDV
Ga0182167_13101471	3300015354	Switchgrass Phyllosphere	VHLMHPILIFIMGQVWQRNGVKPPETRVLDIKYVVRNQTDVVEQ
Ga0182167_13676791	3300015354	Switchgrass Phyllosphere	MRLMHPILIFTMGQVRQRNGVKPPETRVLDVKYGVRNQM
Ga0182195_11592381	3300017414	Switchgrass Phyllosphere	VHLMHLILIFTMGQVRQRNGVKPPETRVLDVKYVV
Ga0182201_10551011	3300017422	Switchgrass Phyllosphere	MHPILIFTLGQVRQRNGVKPPETQVLDVKYVVRNQMNVV
Ga0182194_10244561	3300017435	Switchgrass Phyllosphere	VHLMHPILIFTMGHVRQRNGVKPPETRVLDIKYVVRNQPDVLEH
Ga0182194_11072741	3300017435	Switchgrass Phyllosphere	VHMMHPILIFTMGQVRQRNGVKPPETRVLDVKYMVRNQ
Ga0182200_10785922	3300017439	Switchgrass Phyllosphere	MHPILIFTKGQVRQXNGVKPPETRVLDVKYVVRNQTDILE
Ga0182200_11444591	3300017439	Switchgrass Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPKTRNLDVKYVVRNQTDIV
Ga0182200_11566161	3300017439	Switchgrass Phyllosphere	MYLMHPILNFRMGQVRQRNGVKPLETRVLDIKYVVR
Ga0182212_10684231	3300017691	Switchgrass Phyllosphere	HPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQPDVLEH
Ga0182210_11375151	3300017692	Switchgrass Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDIL
Ga0182216_11309461	3300017693	Switchgrass Phyllosphere	MHLILIFTMGHVRQRNGVKPPKTRVLDVKYVVRNQTDILEHQ
Ga0182211_10464721	3300017694	Switchgrass Phyllosphere	RHKLVHLMNPILIFTMGQVWQRNGMKPPETRVFEVKYVVRNKTDHV
Ga0207701_109943881	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	VHLMHPILIFTMGQVRQRNGVKPPKTRVLDVKYVVRNQTDV
Ga0207644_109011111	3300025931	Switchgrass Rhizosphere	MHLMHPIQIFTMGQVRQRNDMKRPETRILDVKYVVRNQTDV
Ga0268322_10088971	3300028049	Phyllosphere	VHLMHPILIFTMGQVHQQNGMKPPETRVLDVKFVVRNQMGVLEH
Ga0268322_10103442	3300028049	Phyllosphere	IFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDILEH
Ga0268306_10001941	3300028054	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNHMDILE
Ga0268306_10054441	3300028054	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLEVKYVVRNRRDVVE
Ga0268306_10244441	3300028054	Phyllosphere	MHLMHPILIFTMGQVRQRNGVKPPETRILDVNYVVRNQM
Ga0268330_10177781	3300028056	Phyllosphere	LMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH
Ga0268330_10292441	3300028056	Phyllosphere	MHLMHPILIFTMGQVRQRNGVKPPKTRILDIKYVVRNQTDV
Ga0268330_10376631	3300028056	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRN
Ga0268330_10381731	3300028056	Phyllosphere	MHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVL
Ga0268330_10423911	3300028056	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLEAKYVVRNQRD
Ga0268330_10614251	3300028056	Phyllosphere	VHLMHPILIFTMGQVHQQNGMKPPETRVLDVKFVVR
Ga0268352_10410481	3300028057	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDAKYVV
Ga0268352_10416111	3300028057	Phyllosphere	PILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH
Ga0268332_10503951	3300028058	Phyllosphere	VHMMHPILIFTMGQVRQQNSVKPPETRVLEVKYVVRNQRDV
Ga0268332_10631871	3300028058	Phyllosphere	VHLIHPILIFTMGQVRQRNGVKPPETRVLDLKYVVQNQ
Ga0268332_10722761	3300028058	Phyllosphere	VHLMHPILIFTMGQVRQRNAVKPPETRVLDVKYVVRNQTDIV
Ga0268340_10370661	3300028064	Phyllosphere	VHLMRPILIFTMGQVRQLNGVKPPETRVLEVKYVVRNQRDV
Ga0268355_10039911	3300028139	Phyllosphere	MHPILIFTMGQVHQQNGMKPPETRVLDVKFVVRNQMDI
Ga0268326_10085701	3300028141	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDV
Ga0268347_10193421	3300028142	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVQNQTD
Ga0268347_10279331	3300028142	Phyllosphere	MHLMHPILIFTMGQVRQRNGVKPPKTRILDVNYVV
Ga0268347_10313571	3300028142	Phyllosphere	VHLIHPILNFRMGQVRQRNGVKPPETRVLDIKYVVRN
Ga0268348_10076861	3300028143	Phyllosphere	MRLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDVLEHR
Ga0268308_10268561	3300028151	Phyllosphere	PILIFTMGLVRQQNGVKPAETRILDVNYVVRNQTDIVEH
Ga0268341_10079621	3300028154	Phyllosphere	VHLMHPIFIFTMGQVRQRNGVKPPETRVLDVKYVVRNQT
Ga0268316_10232401	3300028253	Phyllosphere	MHLMHPILNFRMGQVRQRNGVKPPETRVSDIKYVVRNQTDIVE
Ga0268304_10002046	3300028256	Phyllosphere	VHLMHLILIFTMGQVRQRNGVKPPETRVLNIKYVVRNQP
Ga0268304_10003432	3300028256	Phyllosphere	VHLMHPLLIFTMGQVRQRNGVKPPETRVLDVKYVVRNQT
Ga0268310_10084171	3300028262	Phyllosphere	VHLMHPILIFTMGHVRQRNGVKQPETRILDVKYVLRNQTDV
Ga0268310_10092271	3300028262	Phyllosphere	VHLMHLILIFTMGQVWQRNGVKPPETRVLDVKYVVQNQTYVVE
Ga0268310_10109042	3300028262	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPHETRVLDVKYVVRNQTDILEH
Ga0268310_10165221	3300028262	Phyllosphere	VHLMHPILNFTMGQVRQRNGVKPPETRVLDIKYVVRNQTDVVDHR
Ga0268266_109968101	3300028379	Switchgrass Rhizosphere	MNPILIFTMGQVWQRNGMKPPETRVFEVKYVVRNKTDH
Ga0268333_10101411	3300028467	Phyllosphere	VHLMHPILIFTMGQVWQRNCVKPPETRVLDVKYVVRNQTDILEHRN
Ga0268337_10105241	3300028469	Phyllosphere	VHLMHLILIFTMGQVRQRNGVKPPETRVLDVKYVMRNQMDV
Ga0268307_10098302	3300028470	Phyllosphere	LMHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEH
Ga0268307_10188692	3300028470	Phyllosphere	VHLMHLILIFTMDQVRQRNGVKPPETRVLDIKYVVRNQ
Ga0268315_10106112	3300028472	Phyllosphere	MHLMHPILNFRMGQVRQGNGVKPSETRVLDIKYVVRNQ
Ga0268313_10006172	3300028523	Phyllosphere	VHLMHPILIFTMGQARQRNGVKPPETRVLDIKYVVRNQPDVLEH
Ga0268305_1035661	3300028525	Phyllosphere	MHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVR
Ga0268339_10153631	3300028526	Phyllosphere	VHLMHPILIFPMGQVRQRSDVKPPETQVLDVKYVV
Ga0268335_10174501	3300028527	Phyllosphere	MRLMHPILIFTMGQVRQRNGVKPPETRVLDVKYGVRNQMDVLE
Ga0268311_10263401	3300028529	Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDVKYVVRNQT
Ga0214492_10320261	3300032464	Switchgrass Phyllosphere	VHLMHPILIFTMGHVRQRNGVKPPETRVLDIKYVVRN
Ga0214497_11015011	3300032689	Switchgrass Phyllosphere	VHLMHPILIFIMGQVRQRNGVKRPETRILDEKFVVR
Ga0314760_11863561	3300033530	Switchgrass Phyllosphere	VHLMHPILIFTMGQVRQRNGVKPPETRVLDIKYVVRNQP