Basic Information | |
---|---|
Family ID | F086289 |
Family Type | Metagenome |
Number of Sequences | 111 |
Average Sequence Length | 44 residues |
Representative Sequence | LRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 111 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 3.60 % |
% of genes near scaffold ends (potentially truncated) | 94.59 % |
% of genes from short scaffolds (< 2000 bps) | 92.79 % |
Associated GOLD sequencing projects | 70 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.61 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (36.937 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (37.838 % of family members) |
Environment Ontology (ENVO) | Unclassified (83.784 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (72.973 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 18.84% Coil/Unstructured: 60.87% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 111 Family Scaffolds |
---|---|---|
PF13539 | Peptidase_M15_4 | 7.21 |
PF11351 | GTA_holin_3TM | 6.31 |
PF05838 | Glyco_hydro_108 | 2.70 |
PF09374 | PG_binding_3 | 1.80 |
PF13469 | Sulfotransfer_3 | 1.80 |
PF16778 | Phage_tail_APC | 0.90 |
PF13385 | Laminin_G_3 | 0.90 |
PF00583 | Acetyltransf_1 | 0.90 |
PF00182 | Glyco_hydro_19 | 0.90 |
PF00685 | Sulfotransfer_1 | 0.90 |
PF06356 | DUF1064 | 0.90 |
COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
---|---|---|---|
COG3926 | Lysozyme family protein | General function prediction only [R] | 2.70 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.90 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.90 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.06 % |
Unclassified | root | N/A | 36.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000121|TDF_OR_ARG04_113mDRAFT_c1022430 | Not Available | 741 | Open in IMG/M |
3300001460|JGI24003J15210_10048383 | All Organisms → Viruses → Predicted Viral | 1431 | Open in IMG/M |
3300004448|Ga0065861_1062315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 984 | Open in IMG/M |
3300004460|Ga0066222_1067983 | Not Available | 761 | Open in IMG/M |
3300005913|Ga0075108_10001041 | All Organisms → cellular organisms → Bacteria | 14513 | Open in IMG/M |
3300006025|Ga0075474_10075251 | Not Available | 1112 | Open in IMG/M |
3300006026|Ga0075478_10069308 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
3300006789|Ga0098054_1179349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 776 | Open in IMG/M |
3300006793|Ga0098055_1060048 | Not Available | 1519 | Open in IMG/M |
3300006802|Ga0070749_10290240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 919 | Open in IMG/M |
3300006802|Ga0070749_10532706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 638 | Open in IMG/M |
3300006802|Ga0070749_10595118 | Not Available | 597 | Open in IMG/M |
3300006802|Ga0070749_10701278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 541 | Open in IMG/M |
3300006803|Ga0075467_10413026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 701 | Open in IMG/M |
3300006803|Ga0075467_10492257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 631 | Open in IMG/M |
3300006810|Ga0070754_10185578 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 976 | Open in IMG/M |
3300006810|Ga0070754_10257232 | Not Available | 795 | Open in IMG/M |
3300006810|Ga0070754_10474417 | Not Available | 540 | Open in IMG/M |
3300006867|Ga0075476_10162959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 827 | Open in IMG/M |
3300006868|Ga0075481_10142478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 875 | Open in IMG/M |
3300006869|Ga0075477_10382501 | Not Available | 549 | Open in IMG/M |
3300006874|Ga0075475_10255884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 733 | Open in IMG/M |
3300006916|Ga0070750_10365959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae | 606 | Open in IMG/M |
3300006919|Ga0070746_10116418 | Not Available | 1323 | Open in IMG/M |
3300006919|Ga0070746_10534554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 510 | Open in IMG/M |
3300007229|Ga0075468_10025704 | Not Available | 2135 | Open in IMG/M |
3300007276|Ga0070747_1116710 | Not Available | 976 | Open in IMG/M |
3300007276|Ga0070747_1241346 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 629 | Open in IMG/M |
3300007276|Ga0070747_1278038 | Not Available | 578 | Open in IMG/M |
3300007692|Ga0102823_1194035 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 542 | Open in IMG/M |
3300008012|Ga0075480_10425885 | Not Available | 650 | Open in IMG/M |
3300009027|Ga0102957_1115571 | Not Available | 941 | Open in IMG/M |
3300009076|Ga0115550_1279286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 540 | Open in IMG/M |
3300009077|Ga0115552_1390176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 550 | Open in IMG/M |
3300009149|Ga0114918_10330653 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300009172|Ga0114995_10217778 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
3300009420|Ga0114994_10304248 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
3300009422|Ga0114998_10141630 | Not Available | 1161 | Open in IMG/M |
3300009442|Ga0115563_1122124 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
3300009445|Ga0115553_1200479 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 796 | Open in IMG/M |
3300009447|Ga0115560_1333667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 575 | Open in IMG/M |
3300009447|Ga0115560_1400186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 520 | Open in IMG/M |
3300009467|Ga0115565_10565184 | Not Available | 509 | Open in IMG/M |
3300009496|Ga0115570_10229577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 827 | Open in IMG/M |
3300009496|Ga0115570_10488137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 515 | Open in IMG/M |
3300010883|Ga0133547_11385867 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
3300013010|Ga0129327_10220700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 961 | Open in IMG/M |
3300017697|Ga0180120_10148604 | Not Available | 994 | Open in IMG/M |
3300017697|Ga0180120_10153114 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
3300017697|Ga0180120_10159133 | Not Available | 953 | Open in IMG/M |
3300017697|Ga0180120_10281974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 668 | Open in IMG/M |
3300017697|Ga0180120_10353515 | Not Available | 581 | Open in IMG/M |
3300017719|Ga0181390_1056485 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
3300017719|Ga0181390_1084042 | Not Available | 874 | Open in IMG/M |
3300017728|Ga0181419_1158337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 540 | Open in IMG/M |
3300017749|Ga0181392_1242266 | Not Available | 509 | Open in IMG/M |
3300017751|Ga0187219_1097908 | Not Available | 894 | Open in IMG/M |
3300017781|Ga0181423_1230217 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 696 | Open in IMG/M |
3300021185|Ga0206682_10107354 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
3300022057|Ga0212025_1093448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 515 | Open in IMG/M |
3300022164|Ga0212022_1027889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 861 | Open in IMG/M |
3300022169|Ga0196903_1002260 | All Organisms → Viruses → Predicted Viral | 2657 | Open in IMG/M |
3300022187|Ga0196899_1161398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 616 | Open in IMG/M |
3300022187|Ga0196899_1162873 | All Organisms → Viruses | 612 | Open in IMG/M |
(restricted) 3300024255|Ga0233438_10362256 | All Organisms → Viruses | 538 | Open in IMG/M |
3300024346|Ga0244775_11440050 | Not Available | 529 | Open in IMG/M |
(restricted) 3300024517|Ga0255049_10529228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 548 | Open in IMG/M |
3300025543|Ga0208303_1010060 | Not Available | 2952 | Open in IMG/M |
3300025543|Ga0208303_1073323 | Not Available | 774 | Open in IMG/M |
3300025590|Ga0209195_1077910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 770 | Open in IMG/M |
3300025626|Ga0209716_1111954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 759 | Open in IMG/M |
3300025652|Ga0208134_1067253 | Not Available | 1077 | Open in IMG/M |
3300025654|Ga0209196_1171142 | All Organisms → Viruses | 583 | Open in IMG/M |
3300025666|Ga0209601_1180617 | All Organisms → Viruses | 572 | Open in IMG/M |
3300025668|Ga0209251_1136854 | All Organisms → Viruses | 653 | Open in IMG/M |
3300025671|Ga0208898_1106956 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 837 | Open in IMG/M |
3300025671|Ga0208898_1147486 | Not Available | 640 | Open in IMG/M |
3300025704|Ga0209602_1207311 | Not Available | 577 | Open in IMG/M |
3300025809|Ga0209199_1144527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
3300025828|Ga0208547_1045852 | All Organisms → Viruses → Predicted Viral | 1543 | Open in IMG/M |
3300025832|Ga0209307_1118059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 832 | Open in IMG/M |
3300025840|Ga0208917_1129650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 895 | Open in IMG/M |
3300025853|Ga0208645_1171732 | All Organisms → Viruses | 799 | Open in IMG/M |
3300025869|Ga0209308_10415139 | Not Available | 533 | Open in IMG/M |
3300027234|Ga0208170_1035884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1043 | Open in IMG/M |
3300027780|Ga0209502_10366601 | Not Available | 600 | Open in IMG/M |
(restricted) 3300028045|Ga0233414_10329883 | Not Available | 703 | Open in IMG/M |
3300028416|Ga0228614_1066129 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 726 | Open in IMG/M |
3300031519|Ga0307488_10521227 | Not Available | 705 | Open in IMG/M |
3300031602|Ga0307993_1128103 | Not Available | 638 | Open in IMG/M |
3300031626|Ga0302121_10065733 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
3300031626|Ga0302121_10086184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 933 | Open in IMG/M |
3300031629|Ga0307985_10002359 | Not Available | 10571 | Open in IMG/M |
3300031629|Ga0307985_10011643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4400 | Open in IMG/M |
3300031659|Ga0307986_10127259 | Not Available | 1206 | Open in IMG/M |
3300031659|Ga0307986_10136645 | Not Available | 1151 | Open in IMG/M |
3300031696|Ga0307995_1005407 | Not Available | 6728 | Open in IMG/M |
3300031696|Ga0307995_1294347 | Not Available | 541 | Open in IMG/M |
3300031700|Ga0302130_1071794 | Not Available | 1118 | Open in IMG/M |
3300032274|Ga0316203_1098753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 823 | Open in IMG/M |
3300032277|Ga0316202_10373604 | All Organisms → Viruses | 666 | Open in IMG/M |
3300032373|Ga0316204_10281552 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
3300032373|Ga0316204_10320650 | Not Available | 1195 | Open in IMG/M |
3300032373|Ga0316204_11311225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 502 | Open in IMG/M |
3300033742|Ga0314858_114767 | Not Available | 687 | Open in IMG/M |
3300034374|Ga0348335_061617 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
3300034374|Ga0348335_123126 | All Organisms → Viruses | 763 | Open in IMG/M |
3300034374|Ga0348335_152023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 631 | Open in IMG/M |
3300034375|Ga0348336_006828 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 7607 | Open in IMG/M |
3300034375|Ga0348336_059651 | All Organisms → Viruses → Predicted Viral | 1502 | Open in IMG/M |
3300034418|Ga0348337_158845 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium | 625 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 37.84% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 15.32% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 9.91% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 6.31% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 5.41% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.41% |
Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 4.50% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.70% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.80% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.80% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.90% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.90% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.90% |
Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.90% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.90% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.90% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 0.90% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.90% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.90% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.90% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006867 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
3300022169 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
3300025626 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes) | Environmental | Open in IMG/M |
3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
3300025654 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 (SPAdes) | Environmental | Open in IMG/M |
3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
3300025828 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025832 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
3300027234 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300031700 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_surface | Environmental | Open in IMG/M |
3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
3300032373 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 | Environmental | Open in IMG/M |
3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
TDF_OR_ARG04_113mDRAFT_10224301 | 3300000121 | Marine | LKLYQNKRGDYVVYDKNGKVVIITHHRHHAIAYAR |
JGI24003J15210_100483831 | 3300001460 | Marine | TVQQWSIALRLYQNKKGDYVVYDKDGKVVIITHHKHYAIAYARSVEDGGKEIGRSVKV* |
Ga0065861_10623151 | 3300004448 | Marine | IALRLYRNKRGDYIVYDEDMRVVIITHHKRYAIEYARSLKK* |
Ga0066222_10679833 | 3300004460 | Marine | LRLYRNKRGDYVVYDKYGKVVIITHHKHHAVAYARSLEDGSEKARRSK* |
Ga0075108_1000104116 | 3300005913 | Saline Lake | RGNYVVYDKHGKVVIITHNKNYAIAYARSLEDGD* |
Ga0075474_100752514 | 3300006025 | Aqueous | KQRCIVLRLYRNKRGDYVVYDKYGKVVIITHHKHRAVAYARSIEDAK* |
Ga0075478_100693084 | 3300006026 | Aqueous | IVLRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLDDGSEEARRSK* |
Ga0098054_11793493 | 3300006789 | Marine | ALRLYQNRKGNYVVYDKDEKVVIITHHKHHAIAYARSLKYAK* |
Ga0098055_10600484 | 3300006793 | Marine | LRLYQNKKGDYVVYDKEGRVVIITHHKHYAINYARSLENDV* |
Ga0070749_102902404 | 3300006802 | Aqueous | LRLYRNKRGDYVVYDKYGKVVIITHHKHRAVAYARSIEDAK* |
Ga0070749_105327063 | 3300006802 | Aqueous | VLRLYRNKRGDYVVYDKDGKVVIITHHKRYAVEYARSLEDAK* |
Ga0070749_105951181 | 3300006802 | Aqueous | RLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLDNGSEEARRSK* |
Ga0070749_107012783 | 3300006802 | Aqueous | VLRLYRNKRGDYVVYDKDGKVVIITHHKRYAVEYARSLEDAE* |
Ga0075467_104130263 | 3300006803 | Aqueous | ALRLYRNKRGDYVVYDKHGKVVIITHHKRYAVEYARSLEDGTHGT* |
Ga0075467_104922573 | 3300006803 | Aqueous | ALRLYRNKRGDYVVYDKHGKVVIITHHKRYAVEYARSLEDAE* |
Ga0070754_101855784 | 3300006810 | Aqueous | ALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDGTHNTG* |
Ga0070754_102572321 | 3300006810 | Aqueous | PPAKQRSIALRLYQNRKGDYVVYDKYGKVVIITHHKHYAIAYARSVKDGGEEVGRSVEV* |
Ga0070754_104744171 | 3300006810 | Aqueous | KQRSIALRLYQNRKGDYVVYDKYGKVVIITHHKHYAIAYARSVKDGGKEVGRSKQV* |
Ga0075476_101629591 | 3300006867 | Aqueous | KQRCIVLRLYRNKRGDYVVYDKDGKVVIITHHKRYAVEYARSLEDAE* |
Ga0075481_101424783 | 3300006868 | Aqueous | RCIVLRLYRNKRGDYVVYDKYGKVVIITHHKHRAVAYARSLEDAK* |
Ga0075477_103825013 | 3300006869 | Aqueous | NKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDGRTTG* |
Ga0075475_102558843 | 3300006874 | Aqueous | RLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE* |
Ga0070750_103659591 | 3300006916 | Aqueous | RGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGTHGT* |
Ga0070746_101164181 | 3300006919 | Aqueous | RCIVLRLYRNKRGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGTNGT* |
Ga0070746_105345542 | 3300006919 | Aqueous | LRLYQNKKGDYVVYDKNGKVVIITHHKSHALEYARSIEDAE* |
Ga0075468_100257047 | 3300007229 | Aqueous | LRLYQNKKGDYVVYDKNGKVVIITHHKSHALKYARSLEDDV* |
Ga0070747_11167101 | 3300007276 | Aqueous | CIALRLYRNKRGDYVVYDKHGKVVIITHHKRYAVEYARSLDDGSEEARRSK* |
Ga0070747_12413463 | 3300007276 | Aqueous | LRLYRNKRGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGTHGT* |
Ga0070747_12780383 | 3300007276 | Aqueous | DYVVYDKDGKVVIITHHKRYAIAYARSIEDGTNGT* |
Ga0102823_11940351 | 3300007692 | Estuarine | LRLYQNKRGDYVVYDKAGKVVIITHHKRYAVEYARSLEDAE* |
Ga0075480_104258853 | 3300008012 | Aqueous | LRLYQNKKGDYVVYDKDGKVVIITHHKMYAIAYARSIEDGSKET* |
Ga0102957_11155711 | 3300009027 | Pond Water | KRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE* |
Ga0115550_12792862 | 3300009076 | Pelagic Marine | ALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE* |
Ga0115552_13901761 | 3300009077 | Pelagic Marine | CIALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE* |
Ga0114918_103306531 | 3300009149 | Deep Subsurface | LRFYRNKKGDYVVYDKYGKVVIITHNKNYAIAYARN |
Ga0114995_102177784 | 3300009172 | Marine | RNKRGDYVVYDKYGKVVIITHNKNYAIAYARSLEDGNET* |
Ga0114994_103042484 | 3300009420 | Marine | LKLYRNKKGDYVVYDKHGKVVIITHNKNYAVSHARSIEDGNKA* |
Ga0114998_101416304 | 3300009422 | Marine | GDYVVYDKHGKVVIITHNKSYAIAYARSLEDVDET* |
Ga0115563_11221241 | 3300009442 | Pelagic Marine | VLRWSIALRLYQNKRGDYVVYDKYGKVVIITHHKKYAIAYARSIEYAK* |
Ga0115553_12004791 | 3300009445 | Pelagic Marine | RGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE* |
Ga0115560_13336671 | 3300009447 | Pelagic Marine | QVKQRCIALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE* |
Ga0115560_14001863 | 3300009447 | Pelagic Marine | YQNRKGDYAVYDEDGRVVIITHHKHYAIAYARSLNNE* |
Ga0115565_105651843 | 3300009467 | Pelagic Marine | LYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDGTHGT* |
Ga0115570_102295771 | 3300009496 | Pelagic Marine | QRFIALRLYQNRKGDYVVYDEDGRVVIITHHKHYAIAYARSLNNE* |
Ga0115570_104881372 | 3300009496 | Pelagic Marine | LRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE* |
Ga0133547_113858674 | 3300010883 | Marine | WCIALRLYRNKRGDYVIYDKHGKVVIITHNKNYAIAYARSLYGEK* |
Ga0129327_102207001 | 3300013010 | Freshwater To Marine Saline Gradient | RGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGTNGT* |
Ga0180120_101486041 | 3300017697 | Freshwater To Marine Saline Gradient | KQRCIALRLYRNKRGDYVVYDKYGKVVIITHHKHRAVAYARSIEDAK |
Ga0180120_101531141 | 3300017697 | Freshwater To Marine Saline Gradient | TALRLYQNKKGDYVVYDKDGKVVIITHHKMYAIAYARSIEDGSKKARRSKQV |
Ga0180120_101591334 | 3300017697 | Freshwater To Marine Saline Gradient | CIVLRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAK |
Ga0180120_102819743 | 3300017697 | Freshwater To Marine Saline Gradient | LRLYRNKRGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGKDGT |
Ga0180120_103535153 | 3300017697 | Freshwater To Marine Saline Gradient | LRLYRNKRGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGTNGT |
Ga0181390_10564854 | 3300017719 | Seawater | LYQNKRGDYVVYDKEGRVVIITHHKHYAINYARSLEDDV |
Ga0181390_10840423 | 3300017719 | Seawater | ALRLFQNKRGDYVVYDKYGKVVIITHHKHHAIAYARSLEDGTHDT |
Ga0181419_11583373 | 3300017728 | Seawater | STALRLYQNRKGDYVVYDEDGRVLIITHHKHHAIAYARSLNNE |
Ga0181392_12422661 | 3300017749 | Seawater | LRLYQNKKGNYVVYDKDGKVVIITHHKHYAIAYARSVEDGGKEVGRSVE |
Ga0187219_10979081 | 3300017751 | Seawater | ALRLFQNKRGDYVVYDKYGKVVIITHHKHHAIAYARSLEDGRHDT |
Ga0181423_12302171 | 3300017781 | Seawater | LRLYQNKKGDYVVYDKAGKVVIITHHKRYAVEYARSLEDAE |
Ga0206682_101073541 | 3300021185 | Seawater | KLRCIALRLYQNKKGDYVVYDKEGRVVIITHHKHYAINYARSLEDDV |
Ga0212025_10934481 | 3300022057 | Aqueous | LQAKQRCIVLRLYRNKRGDYVVYDKDGKVVIITHHKRYAVEYARSLEDAE |
Ga0212022_10278891 | 3300022164 | Aqueous | CIALRLFRNKKGDYVVYSKENTIVIITHHKGYAIEYARSLKND |
Ga0196903_10022606 | 3300022169 | Aqueous | LRLYQNKKGDYVVYDKNGKVVIITHHKSHALEYARSIEDAE |
Ga0196899_11613981 | 3300022187 | Aqueous | NKRGYYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0196899_11628733 | 3300022187 | Aqueous | NKRGDYVVYDKYGKVVIITHHKRYAVKYARSLKDGTHGT |
(restricted) Ga0233438_103622563 | 3300024255 | Seawater | LYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0244775_114400503 | 3300024346 | Estuarine | RCIALRLYQNKRGDYVVYDKDGKVVIITHHKHYAIAYARSVEDGGKEVGRSV |
(restricted) Ga0255049_105292281 | 3300024517 | Seawater | QRCIALRIYRNKRGDYVVYDKYGKVVIITHHKKYAIAYARSLEDAE |
Ga0208303_10100601 | 3300025543 | Aqueous | RAKQRCIALRLYRNKRGDYVIYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0208303_10733231 | 3300025543 | Aqueous | KQRCIVLRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLDDGSEEARRSK |
Ga0209195_10779103 | 3300025590 | Pelagic Marine | GDYVVYDKDGKVVIITHHKRYAIAYARSIEDGEDDT |
Ga0209716_11119543 | 3300025626 | Pelagic Marine | RCIVLRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0208134_10672531 | 3300025652 | Aqueous | NKRGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGTHGT |
Ga0209196_11711423 | 3300025654 | Pelagic Marine | RNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0209601_11806173 | 3300025666 | Pelagic Marine | NKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0209251_11368541 | 3300025668 | Marine | TVLRWFIVLRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0208898_11069561 | 3300025671 | Aqueous | IALRLYRNKRGDYVVYDKDGKVVIITHHKRYAIAYARSIEDGTNGT |
Ga0208898_11474861 | 3300025671 | Aqueous | RGDYVVYDKYGKVVIITHHKRYAVEYARSLEDGRTTG |
Ga0209602_12073113 | 3300025704 | Pelagic Marine | RCIALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLDDGSEEARRSK |
Ga0209199_11445271 | 3300025809 | Pelagic Marine | ALRLYQNKRGDYVVYDKEGRVVIITHHKHYAINYARSLGNGSKEVGRPK |
Ga0208547_10458521 | 3300025828 | Aqueous | IALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVKYARSLEDGTHGT |
Ga0209307_11180593 | 3300025832 | Pelagic Marine | RCIALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0208917_11296504 | 3300025840 | Aqueous | ALRLYRNKRGDYVVYDKYGKVVIITHHKHRAVAYARSIEDAK |
Ga0208645_11717323 | 3300025853 | Aqueous | AKQRCIVLRLYRNKRGDYVVYDKYGKVVIITHHKHRAVAYARSIEDAK |
Ga0209308_104151391 | 3300025869 | Pelagic Marine | LRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLED |
Ga0208170_10358843 | 3300027234 | Estuarine | LRLYQNKRGDYVVYDKAGKVVIITHHKRYAIAYARSIEDGGKET |
Ga0209502_103666011 | 3300027780 | Marine | RNKKGDYVVYDKHGKVVIITHNKNYAVAYARSLKDGRTTGKDIRVG |
(restricted) Ga0233414_103298833 | 3300028045 | Seawater | LTALRWYIALRLYQNKKGDYVVYDRNGKVVIITHHKSHAVEYARSLENDV |
Ga0228614_10661291 | 3300028416 | Seawater | NKKGDYVIYDRYGKVVIITHHKHHAIAYARSLKDAK |
Ga0307488_105212272 | 3300031519 | Sackhole Brine | LRLYRNKRGDYVVYDKYGKVVIITYNKNYAIAYARSLKDGRTTGKDIRVG |
Ga0307993_11281032 | 3300031602 | Marine | LKLYRNQRGDYVVYDAQGKIVIITYHRKHAIAYARRMQNGNKTR |
Ga0302121_100657334 | 3300031626 | Marine | LRLYRNKRGDYVVYDKYGKVVIITHNKNYAIAYARSLEDGSKEARRSK |
Ga0302121_100861843 | 3300031626 | Marine | AQRWCIALRLYRNKRGDYVVYDKYGKVVIITHNKNHAVAYARSLEDGNET |
Ga0307985_100023591 | 3300031629 | Marine | IALKLYRNKRGNYVVYDKQGKVVIITHHKRYAIAYARSLKDDRV |
Ga0307985_100116438 | 3300031629 | Marine | RNKRGDYVVYDKQGKVVIITHHKRYAIAYARGLKDGNKAR |
Ga0307986_101272591 | 3300031659 | Marine | LRLYRNKRGDYVVYDKQGKVVIITHHKRYAIAYARGLKDGNKNRK |
Ga0307986_101366453 | 3300031659 | Marine | ALKLYRNKRGDYVVYDKQGKVVIITHHKRYAIAYARGLQRLHGGK |
Ga0307995_100540710 | 3300031696 | Marine | YRNKRGNYVVYDKQGKVVIITHHKRYAIAYARSLKDDRV |
Ga0307995_12943471 | 3300031696 | Marine | LYRNKRGDYVVYDKQGKVVIITHHKRYAIAYARGLKSLYGRK |
Ga0302130_10717941 | 3300031700 | Marine | IALRLYRNKRGDYVVYDKYGKVVIITHNKNYAIAYARSLEDGD |
Ga0316203_10987531 | 3300032274 | Microbial Mat | KQRCIALRLYRNKRGDYVIYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0316202_103736041 | 3300032277 | Microbial Mat | ALRLYRNKRGDYVVYDKYGKVVIITHHKRYAIAYARSIEDGTNGT |
Ga0316204_102815524 | 3300032373 | Microbial Mat | RCTALRLYQNKKGDYVVYDKDGKVVIITHHKMYAIAYARSIEDGSKKARRSKQV |
Ga0316204_103206505 | 3300032373 | Microbial Mat | LRLYQNKRGDYVVYDKNGKVVIITHHKSHALEYARSLEDGSKEVG |
Ga0316204_113112251 | 3300032373 | Microbial Mat | LYRNKRGDYVVYDKYGKVVIITHHKRYAVKYARSLKDAE |
Ga0314858_114767_519_686 | 3300033742 | Sea-Ice Brine | RLEHLQLRCTALRLYRNKKGDYVVYDKYGKVVIITYHKGYAIAYARRLKDGNKTR |
Ga0348335_061617_1239_1370 | 3300034374 | Aqueous | IVLRLYQNKKGDYVVYDKNGKVVIITHHKSHALKYARSLEDDV |
Ga0348335_123126_648_761 | 3300034374 | Aqueous | RGDYVVYDKYGKVVIITHHKRYAVKYARSLKDGTHGT |
Ga0348335_152023_3_128 | 3300034374 | Aqueous | LRLYRNKRGDYVVYDKYGKVVIITHHKRYAVKYARSLKDAE |
Ga0348336_006828_1_132 | 3300034375 | Aqueous | IALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVEYARSLEDAE |
Ga0348336_059651_3_149 | 3300034375 | Aqueous | VKQRCIALRLYRNKRGDYVVYDKYGKVVIITHHKRYAVKYARSLKDAE |
Ga0348337_158845_1_120 | 3300034418 | Aqueous | LYRNKRGDYVVYDKNGKVVIITHHRRYAVEYARSLEDAE |
⦗Top⦘ |