 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F086241 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MRVTIFGATGLLGKALMREWREDQVTGLSSKDADIRDP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.96 % |
| % of genes near scaffold ends (potentially truncated) | 99.10 % |
| % of genes from short scaffolds (< 2000 bps) | 92.79 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (59.459 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.910 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.054 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.70% β-sheet: 15.15% Coil/Unstructured: 65.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00908 | dTDP_sugar_isom | 47.75 |
| PF16363 | GDP_Man_Dehyd | 13.51 |
| PF00483 | NTP_transferase | 8.11 |
| PF00171 | Aldedh | 4.50 |
| PF04321 | RmlD_sub_bind | 3.60 |
| PF00141 | peroxidase | 3.60 |
| PF13692 | Glyco_trans_1_4 | 2.70 |
| PF01370 | Epimerase | 2.70 |
| PF02744 | GalP_UDP_tr_C | 1.80 |
| PF00005 | ABC_tran | 1.80 |
| PF00117 | GATase | 0.90 |
| PF02321 | OEP | 0.90 |
| PF07969 | Amidohydro_3 | 0.90 |
| PF13579 | Glyco_trans_4_4 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 47.75 |
| COG0451 | Nucleoside-diphosphate-sugar epimerase | Cell wall/membrane/envelope biogenesis [M] | 7.21 |
| COG0702 | Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains | General function prediction only [R] | 7.21 |
| COG1086 | NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC | Cell wall/membrane/envelope biogenesis [M] | 7.21 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 4.50 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 4.50 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 4.50 |
| COG0376 | Catalase (peroxidase I) | Inorganic ion transport and metabolism [P] | 3.60 |
| COG1087 | UDP-glucose 4-epimerase | Cell wall/membrane/envelope biogenesis [M] | 3.60 |
| COG1088 | dTDP-D-glucose 4,6-dehydratase | Cell wall/membrane/envelope biogenesis [M] | 3.60 |
| COG1089 | GDP-D-mannose dehydratase | Cell wall/membrane/envelope biogenesis [M] | 3.60 |
| COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 3.60 |
| COG1091 | dTDP-4-dehydrorhamnose reductase | Cell wall/membrane/envelope biogenesis [M] | 3.60 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 59.46 % |
| All Organisms | root | All Organisms | 40.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.80% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.90% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.90% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028013 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE2 | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029923 | II_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030935 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J18819_104361661 | 3300001867 | Forest Soil | MRVTIFGATGLLGKALMREWRDDQVTGLGSKDADIRDPQQ |
| JGIcombinedJ26739_1010233551 | 3300002245 | Forest Soil | MRATIFGASGLLGKALMREWSEDAVTGLSSSDVDIRDEMRVHIKLQ |
| Ga0062389_1033484061 | 3300004092 | Bog Forest Soil | MRVTIFGATGLLGKALMGDAMRSKWGTDQVSGLSTKDADIRDPKQV |
| Ga0062593_1005105492 | 3300004114 | Soil | MRVLIFGATGMLGKALMRVWKDDEVAGLGSGNADIRIPAEVE |
| Ga0062594_1000235531 | 3300005093 | Soil | MRVLIFGATGMLGKALMRVWKDDEVAGLGSGDADIRIPEE |
| Ga0066672_108825691 | 3300005167 | Soil | MKVTIFGATGLLGKDLMCEWRDDELIGFGQRDADIRDAKQVQTV |
| Ga0070680_1008843611 | 3300005336 | Corn Rhizosphere | MRITIFGATGLLGKALMREWKDDEATGFGSADGDIRDEKQVL |
| Ga0068868_1005001552 | 3300005338 | Miscanthus Rhizosphere | MKVTIFGAAGLVGKSLMHEWRDDQVIPLGSEDADLRSQSQVQD |
| Ga0070709_106374102 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGETLRMRITIFGATGLLGKALMSEWTEDEVTGFGSKDGDIR |
| Ga0070699_1018928351 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVTVFGATGLLGKPLVRQWTDDDVSGLSSRDADIRDPKQIS |
| Ga0070732_101529013 | 3300005542 | Surface Soil | MRVTVFGSSGLLGNALMHEWGDDELTGLSSKNADIRD |
| Ga0070732_104281313 | 3300005542 | Surface Soil | MKVMIFGASGLLGQALTREWSGDEIVGLNSRDLDI |
| Ga0066701_109318372 | 3300005552 | Soil | MRVTIFGATGLLGKALVRQWTDDDVSGLGFRDADIRNPKQI |
| Ga0068856_1015976171 | 3300005614 | Corn Rhizosphere | MRITIFGATGLLGKALMREWKDDEATRFGSADGDIRDEKQVLTLV |
| Ga0066903_1042232151 | 3300005764 | Tropical Forest Soil | MRITIFGATGLLGQSLMRCSKTGDVTGLSSKDADLRDS |
| Ga0070715_102327413 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVTIFGATGLLGKALMREWQGDELNGLGSRDVDIRS |
| Ga0099793_100958421 | 3300007258 | Vadose Zone Soil | MRVAIFGASGLLGTALMREWSGDAVVGYSSRDVDIRD |
| Ga0066710_1027516362 | 3300009012 | Grasslands Soil | MRITIFGASGLLGKALMREWKEDQVTGLGSKDADIR |
| Ga0099830_104858111 | 3300009088 | Vadose Zone Soil | MRVTIFGATGMLGKALVRRWEGDIRGEDEVTGLGSAQAD |
| Ga0099830_108523112 | 3300009088 | Vadose Zone Soil | MRITIFGATGLLGKALMREWREDELTGFGSSYRDIRDGKRVLELVERSG |
| Ga0116221_10493444 | 3300009523 | Peatlands Soil | MRVTIFGASGLLGKALLREWREDEVVGLNSRDADLGEAVQV |
| Ga0105249_123891821 | 3300009553 | Switchgrass Rhizosphere | MRITIFGATGLLGKALMREWKDDEATGFGSADGDIRNEKQVLTLV |
| Ga0126374_107315871 | 3300009792 | Tropical Forest Soil | MRVTIFGATGLLGKALMREWQGDEVTGLGSKDADIRSRE |
| Ga0116219_105400972 | 3300009824 | Peatlands Soil | MRVTIFGASGLLGKALISNWTGDAVTGLGSRDADIR |
| Ga0134125_102592641 | 3300010371 | Terrestrial Soil | MRVTIFGATGMLGKALMRQWTGDEVTGLGSGQADIRS |
| Ga0134125_122687891 | 3300010371 | Terrestrial Soil | MRITLFGATGLVGNALMRESPSDSIAGLSSKDADIRKPQAIAQ |
| Ga0126381_1005000561 | 3300010376 | Tropical Forest Soil | MRITIFGATGLLGKALRQEWHEEEVQGLGSRDADIR |
| Ga0134127_106096361 | 3300010399 | Terrestrial Soil | MRVTIFGATGMLGKALVRLWTNDEVTALGSSHADIR |
| Ga0137363_110264421 | 3300012202 | Vadose Zone Soil | MRILIFGATGMLGKALTRRWTADTSDKVTGLGSVQADIR |
| Ga0137379_116667941 | 3300012209 | Vadose Zone Soil | MKVMIFGASGLLGKVLMREWHSDELIGLSSRDVDI |
| Ga0137377_118301831 | 3300012211 | Vadose Zone Soil | MRITIFGASGLLGKALMREWKEDQVTGLGSKDADIRDP |
| Ga0137361_117757072 | 3300012362 | Vadose Zone Soil | MRVTIFGAAGLLGNALMREWRGDELSGLGSRDADIRSQE |
| Ga0137398_101743001 | 3300012683 | Vadose Zone Soil | MRVTIFGASGLLGKALMRDWNSNVVTGLSSRDADIRDQA |
| Ga0137395_104222033 | 3300012917 | Vadose Zone Soil | MRVTLFGASGLLGQDLMREWRGDVVTGLSSRDADI |
| Ga0137396_111259252 | 3300012918 | Vadose Zone Soil | MRVAIFGASGLLGTALMREWSGDAVVGYSSRDVDIRDA |
| Ga0137416_119811001 | 3300012927 | Vadose Zone Soil | MRVLVLGATGLLGRVLLAEWTTDEIMGLSSRDADIRDRSQFHSR |
| Ga0164300_105369422 | 3300012951 | Soil | MRVLIFGATGMLGKALMQRWSGDEAVGLGSSQADIRR |
| Ga0164301_110804772 | 3300012960 | Soil | MRITIFGAIGLLGKALVREWKDDEVTGLSSADGDIRDE |
| Ga0164307_112113812 | 3300012987 | Soil | MRITIFGATGLLGKALMREWREDEVTGLGSGDADV |
| Ga0157372_115807851 | 3300013307 | Corn Rhizosphere | MRITLFGATGLVGNALMRESPSDSIAGLSSKDADIRKPQAIAQAL |
| Ga0181526_101202993 | 3300014200 | Bog | MRVTVFGATGLLGHALMREWSGHAVTGLGSQEADIRDA |
| Ga0163163_101081033 | 3300014325 | Switchgrass Rhizosphere | MRITLFGATGLLGNALMRESATDPIAGLNSKDADIRDPGAI |
| Ga0181525_100693194 | 3300014654 | Bog | MRVTIFGASGLLGKALMQEWRGDAVTGVGSRDADIRDTK |
| Ga0134085_101348181 | 3300015359 | Grasslands Soil | MKVTIFGATGLLGKALMREWREDRVTGLSSKDADVRDP |
| Ga0182036_109374762 | 3300016270 | Soil | MRVTIFGATGLLGKALLPHWEKDEVIGLGSSDAELVE |
| Ga0187817_110093041 | 3300017955 | Freshwater Sediment | MQVTIFGASGLLGQALLREWTGDNVTGLSVEDVDVRD |
| Ga0187776_106018781 | 3300017966 | Tropical Peatland | MRITIFGATGLLGKSLTRVWEGDEVTGLGSGDGDIRNQKD |
| Ga0187782_113385291 | 3300017975 | Tropical Peatland | MRVTIFGATGLLGKALIQEWQQDEVIGFGSKDVDIR |
| Ga0187782_113534231 | 3300017975 | Tropical Peatland | MRLTIFGASGMLGGALIRECSSHDVVGLSSRDADIRDAG |
| Ga0187859_108426501 | 3300018047 | Peatland | MRVTIFGASGLLGKALLHEWNGDTVTGLTSHAADIR |
| Ga0187772_108002432 | 3300018085 | Tropical Peatland | MRVTIFGATGLLGQALTQEWQGDEVAGFGVEDADV |
| Ga0187770_112671601 | 3300018090 | Tropical Peatland | MRVTIFGASGLLGQALMREWNGDEVAGFSIEDVDIR |
| Ga0066662_102147002 | 3300018468 | Grasslands Soil | MILGASGLLGKALVREWSGDEVIGLGSRDVDIRQAT |
| Ga0187852_11470351 | 3300019082 | Peatland | MRVTVFGATGLLGHALMREWSGHAVTGLGSQEADIRD |
| Ga0193723_11823471 | 3300019879 | Soil | MRVIIFGASGLLGKELMRFWHGDELVGLGSKDADIRDANR |
| Ga0193707_11074523 | 3300019881 | Soil | MRVTIFGATGLLGKALMREWTGDDLSGLSSRDADIRDPKQISN |
| Ga0210400_114497891 | 3300021170 | Soil | MRITIFGATGLLGKALMREWRDDEVTGLGSANGDIRNAE |
| Ga0210396_108838852 | 3300021180 | Soil | MKVMILGSTGLLGKALTRAWSGDEVHGLGSRDADI |
| Ga0193719_103741601 | 3300021344 | Soil | MRVTIFGATGLLGKALMREWTGDDLSGLSSRDADMRDPKQISNV |
| Ga0210391_111219102 | 3300021433 | Soil | MQILVFGATGLLGKALMREQPHHSQVVGLGSRDADIRSP |
| Ga0210391_111945862 | 3300021433 | Soil | MRVTLFGASGLLGKALMGEWSGDAVSGLSSRDADIRDAQSV |
| Ga0210410_111667002 | 3300021479 | Soil | MRITIFGATGLLGKTLVREWSGDELVGLGSADADIR |
| Ga0210409_104470363 | 3300021559 | Soil | MRVTIFGASGLLGKALMREWSGDTVTGLTSHGVDI |
| Ga0224544_10051153 | 3300023250 | Soil | MRITIFGASGLLGKALLHEWNGDAVTGLSSRDADIR |
| Ga0207697_101705792 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVTIFGAAGLVGKSLMHEWRDDQVIPLGSEDADLRS |
| Ga0207647_106417742 | 3300025904 | Corn Rhizosphere | MRVLIFGATGMLGKALMRVWKDDEVAGLGSGNADI |
| Ga0207654_106986741 | 3300025911 | Corn Rhizosphere | MRVLIFGATGMLGKALMRVWKDDEVAGLGSGNADIRIPA |
| Ga0207698_120552301 | 3300026142 | Corn Rhizosphere | MRITIFGATGLLGKALVREWKDDEVTGFASADGDIR |
| Ga0209237_11267211 | 3300026297 | Grasslands Soil | MKVTIFGASGLLGKALMREWKEDQVTGLGSKDADVRH |
| Ga0209236_10253265 | 3300026298 | Grasslands Soil | MRVTIFGATGLLGKALVRQWTDDDVSGLGFRDADIR |
| Ga0209055_12893291 | 3300026309 | Soil | MRVTVFGATGLLGKALTRKWTDDDLSGLGSKDTDIRDP |
| Ga0209152_102944991 | 3300026325 | Soil | MRVTIFGATGLLGKALVRQWTDDDVSGLGFRDADIRNPKQISN |
| Ga0209378_12271091 | 3300026528 | Soil | MRVTIFGATGLLGKALMREWREDQVTGLSSKDADIRDP |
| Ga0209805_11121443 | 3300026542 | Soil | MKVAVIGASGLLGKYLVREWKGDDVAGFSSKDVDI |
| Ga0209161_102143381 | 3300026548 | Soil | MRITIFGASGLLGKALMSEWKEDQVTGLGSKDADIRDP |
| Ga0209580_103144222 | 3300027842 | Surface Soil | MRVMIVGATGLLGKALMRAWKDDEIVGLGSGGVDIRDAQ |
| Ga0209274_106816031 | 3300027853 | Soil | MRVTIFGASGLLGKALMREWSGDTVTGLTSHAAEIRDARRVLEVV |
| Ga0209579_100549774 | 3300027869 | Surface Soil | MRITLFGATGLLGSELIREWKDDAVTGLSSRDADL |
| Ga0209067_102309491 | 3300027898 | Watersheds | MRITIFGATGLLGKALMREWRDDEVTGFGSADGDIRD |
| Ga0265350_1002801 | 3300028013 | Soil | MKVTILGSTGLLGKALMRTWGGDQVQGLGSRDLDIRD |
| Ga0265356_10270222 | 3300028017 | Rhizosphere | MKVTILGASGLLGKALMREWTRDEVVGLGSRDVDIRD |
| Ga0302233_101894513 | 3300028746 | Palsa | MRITIFGASGLLGRALMREWSGDTVTGLSSRDADIR |
| Ga0302219_102201782 | 3300028747 | Palsa | MRVTIFGASGLLGNALMREWSEDAAAGLSSRDADIRD |
| Ga0302225_100920291 | 3300028780 | Palsa | MRVTIFGASGLLGNALMREWSEDAVTGLSSRDADIRD |
| Ga0302189_100914621 | 3300028788 | Bog | MRGIIFGASGLLGKALMQEWAGDEITGLTSRDADIRNAKQV |
| Ga0307504_102741672 | 3300028792 | Soil | MRVTIFGATGLLGNALLREWRGDELSGLGSRDADV |
| Ga0302227_104286811 | 3300028795 | Palsa | MRVTIFGASGLLGNALMREWSEDAAAGLSSRDADIRDA |
| Ga0307308_102623561 | 3300028884 | Soil | MRVTVFGASGLLGKALMREWIDDDVNGLGSRDTDIR |
| Ga0311341_107834971 | 3300029908 | Bog | MKVTIFGASGLLGQDLMRVWAGDEVTSLASRDADIRE |
| Ga0311358_111506282 | 3300029915 | Bog | MKVTIFGATGLLGKALMQEWRGDSITGLSSGDADVRNAER |
| Ga0311347_103824602 | 3300029923 | Fen | MRVTIFGTTGLLGKALMQEWKDAIVTGLSSKDADLRNPRQIQDA |
| Ga0265762_10030454 | 3300030760 | Soil | MKVTILGSTGLLGKALLGAWRGDEVHGLGSRDLDIRDAQKV |
| Ga0075401_113434982 | 3300030935 | Soil | MKAMILGASGLLGKALMHEWREDLVVGLSSRDVDIRDSEK |
| Ga0265754_10377931 | 3300031040 | Soil | MRVTLFGASGLLGKALMREWHQDAVTGLSSSDADIRDAG |
| Ga0302325_126384761 | 3300031234 | Palsa | MRVTIFGATGLLGQPLMRVWDHDEVHGFGSKQADIRDP |
| Ga0265316_110974531 | 3300031344 | Rhizosphere | MKVAIFGASGLLGQALMREWTDDEIVGLSSRDVDIRDARQ |
| Ga0170820_116683641 | 3300031446 | Forest Soil | MRITIFGATGLLGKALMSETTSDEITGFGSADGDIRDESRVL |
| Ga0307469_101442863 | 3300031720 | Hardwood Forest Soil | MRVTIFGATGLLGKALMREWTGDDLSALRSKDADIRDPK |
| Ga0307469_108021393 | 3300031720 | Hardwood Forest Soil | MRVTIFGATGLLGKALMREWTGDDVSGLGSGDSDIRDPKQISGVLQ |
| Ga0306918_115782141 | 3300031744 | Soil | MRVLLLGATGMLGKAMVRRWTGDEIIGLSSAQADIRNPDQ |
| Ga0318537_102882351 | 3300031763 | Soil | MRVTIFGATGLLGKALMREWTGDEVRGMGSRDADLRSKQQI |
| Ga0307478_114491991 | 3300031823 | Hardwood Forest Soil | MKAMILGASGLLGKELMREWASDEVIGLSSRDVDIRSAD |
| Ga0307479_111751201 | 3300031962 | Hardwood Forest Soil | MRVTIFGASGLLGKSLVREWGGDELVGLGSADADIRDADRV |
| Ga0307479_117080031 | 3300031962 | Hardwood Forest Soil | MRVAIFGATGMLGKALLRRWKDGKIIALGSADADIRV |
| Ga0318506_104281822 | 3300032052 | Soil | MESMRITIFGATGLLGKALVREWQGDDVTALGSGDAD |
| Ga0306924_100556435 | 3300032076 | Soil | MRVTIFGATGLLGKALLPHWEKDEVIGLGSSDADIRDAAE |
| Ga0306920_1030953992 | 3300032261 | Soil | MESMRITVFGATGLLGKALVREWQGDDVTALGSADADIRS |
| Ga0335070_118118461 | 3300032829 | Soil | MKTIILGASGLLGQALMREWTHDEVLGLSSFDVDIRDEGRLRERLE |
| Ga0335075_100752278 | 3300032896 | Soil | MKVLIFGASGLLGKALLREWTQDEVTGVTSRDADI |
| Ga0335077_101710454 | 3300033158 | Soil | MRITILGASGLLGRALRQRWTGDQVSGFSSKDADIRDVQQVDA |
| Ga0334854_029082_1226_1330 | 3300033829 | Soil | MRVTVFGATGMLGKALARHSIAREWSGLGSKDADI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |