| Basic Information | |
|---|---|
| Family ID | F086185 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MTEPMITLGDLVEILSTDLTPTEIEAFLYEWGIA |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 73.87 % |
| % of genes near scaffold ends (potentially truncated) | 26.13 % |
| % of genes from short scaffolds (< 2000 bps) | 85.59 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Predicted Viral (36.036 % of family members) |
| NCBI Taxonomy ID | 10239 (predicted) |
| Taxonomy | All Organisms → Viruses → Predicted Viral |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine (22.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (87.387 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (94.595 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.82% β-sheet: 0.00% Coil/Unstructured: 41.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF04434 | SWIM | 5.41 |
| PF01713 | Smr | 0.90 |
| PF00535 | Glycos_transf_2 | 0.90 |
| PF04851 | ResIII | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 5.41 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 5.41 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 5.41 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.48 % |
| Unclassified | root | N/A | 22.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10026096 | All Organisms → Viruses → Predicted Viral | 3295 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10085819 | All Organisms → Viruses → Predicted Viral | 1370 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10089115 | All Organisms → Viruses → Predicted Viral | 1329 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10098231 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1226 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10079103 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10084052 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10163961 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 647 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10207837 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300001344|JGI20152J14361_10052166 | All Organisms → Viruses → Predicted Viral | 1066 | Open in IMG/M |
| 3300001344|JGI20152J14361_10103192 | Not Available | 566 | Open in IMG/M |
| 3300001346|JGI20151J14362_10074772 | All Organisms → Viruses → Predicted Viral | 1294 | Open in IMG/M |
| 3300001354|JGI20155J14468_10152498 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300001355|JGI20158J14315_10017613 | All Organisms → Viruses → Predicted Viral | 3736 | Open in IMG/M |
| 3300001450|JGI24006J15134_10044077 | All Organisms → Viruses → Predicted Viral | 1869 | Open in IMG/M |
| 3300001450|JGI24006J15134_10059468 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
| 3300001460|JGI24003J15210_10014946 | All Organisms → Viruses → Predicted Viral | 3051 | Open in IMG/M |
| 3300001460|JGI24003J15210_10020992 | All Organisms → Viruses → Predicted Viral | 2486 | Open in IMG/M |
| 3300001460|JGI24003J15210_10085738 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300001947|GOS2218_1022769 | All Organisms → Viruses → Predicted Viral | 1587 | Open in IMG/M |
| 3300002242|KVWGV2_10755951 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1233 | Open in IMG/M |
| 3300006164|Ga0075441_10035933 | All Organisms → Viruses → Predicted Viral | 2001 | Open in IMG/M |
| 3300006164|Ga0075441_10059667 | Not Available | 1499 | Open in IMG/M |
| 3300006164|Ga0075441_10182481 | Not Available | 785 | Open in IMG/M |
| 3300006165|Ga0075443_10043080 | Not Available | 1512 | Open in IMG/M |
| 3300006165|Ga0075443_10195444 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006484|Ga0070744_10063712 | All Organisms → Viruses → Predicted Viral | 1073 | Open in IMG/M |
| 3300006735|Ga0098038_1007974 | All Organisms → Viruses → Predicted Viral | 4230 | Open in IMG/M |
| 3300006735|Ga0098038_1124441 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 874 | Open in IMG/M |
| 3300006735|Ga0098038_1222271 | Not Available | 604 | Open in IMG/M |
| 3300006735|Ga0098038_1238877 | Not Available | 577 | Open in IMG/M |
| 3300006735|Ga0098038_1260923 | Not Available | 545 | Open in IMG/M |
| 3300006737|Ga0098037_1141567 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300006749|Ga0098042_1015543 | All Organisms → Viruses → Predicted Viral | 2305 | Open in IMG/M |
| 3300006793|Ga0098055_1129630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 977 | Open in IMG/M |
| 3300006916|Ga0070750_10389309 | Not Available | 583 | Open in IMG/M |
| 3300006920|Ga0070748_1234268 | Not Available | 663 | Open in IMG/M |
| 3300006922|Ga0098045_1097014 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006924|Ga0098051_1141039 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 639 | Open in IMG/M |
| 3300006925|Ga0098050_1101190 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 737 | Open in IMG/M |
| 3300006947|Ga0075444_10046362 | All Organisms → Viruses → Predicted Viral | 2079 | Open in IMG/M |
| 3300008999|Ga0102816_1077587 | All Organisms → Viruses → Predicted Viral | 1004 | Open in IMG/M |
| 3300009000|Ga0102960_1271677 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009000|Ga0102960_1271861 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009002|Ga0102810_1257963 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300009071|Ga0115566_10213994 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
| 3300009071|Ga0115566_10446758 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 739 | Open in IMG/M |
| 3300009071|Ga0115566_10590989 | Not Available | 622 | Open in IMG/M |
| 3300009071|Ga0115566_10668448 | Not Available | 577 | Open in IMG/M |
| 3300009076|Ga0115550_1009591 | Not Available | 5284 | Open in IMG/M |
| 3300009076|Ga0115550_1141655 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 847 | Open in IMG/M |
| 3300009076|Ga0115550_1145363 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300009076|Ga0115550_1190066 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 696 | Open in IMG/M |
| 3300009077|Ga0115552_1110861 | All Organisms → Viruses → Predicted Viral | 1178 | Open in IMG/M |
| 3300009193|Ga0115551_1127666 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300009413|Ga0114902_1184105 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300009420|Ga0114994_10105786 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300009433|Ga0115545_1104598 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300009434|Ga0115562_1319749 | Not Available | 529 | Open in IMG/M |
| 3300009437|Ga0115556_1187727 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 749 | Open in IMG/M |
| 3300009442|Ga0115563_1129967 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1034 | Open in IMG/M |
| 3300009447|Ga0115560_1249871 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 680 | Open in IMG/M |
| 3300009476|Ga0115555_1425821 | Not Available | 527 | Open in IMG/M |
| 3300009481|Ga0114932_10084919 | All Organisms → Viruses → Predicted Viral | 1983 | Open in IMG/M |
| 3300009481|Ga0114932_10152202 | All Organisms → Viruses → Predicted Viral | 1421 | Open in IMG/M |
| 3300009496|Ga0115570_10342777 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 641 | Open in IMG/M |
| 3300009498|Ga0115568_10413179 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 583 | Open in IMG/M |
| 3300009505|Ga0115564_10406382 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009508|Ga0115567_10097549 | All Organisms → Viruses → Predicted Viral | 2042 | Open in IMG/M |
| 3300009593|Ga0115011_11554865 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009677|Ga0115104_11033039 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 630 | Open in IMG/M |
| 3300009706|Ga0115002_11015341 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009790|Ga0115012_10590905 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 878 | Open in IMG/M |
| 3300012919|Ga0160422_10775974 | Not Available | 614 | Open in IMG/M |
| 3300012952|Ga0163180_10140806 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
| 3300012953|Ga0163179_10705324 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300012953|Ga0163179_11619991 | Not Available | 586 | Open in IMG/M |
| 3300012953|Ga0163179_12271121 | Not Available | 502 | Open in IMG/M |
| 3300012954|Ga0163111_12394118 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300017710|Ga0181403_1028499 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300017725|Ga0181398_1025256 | All Organisms → Viruses → Predicted Viral | 1471 | Open in IMG/M |
| 3300017748|Ga0181393_1128302 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 640 | Open in IMG/M |
| 3300017765|Ga0181413_1183551 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300017770|Ga0187217_1235426 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300017776|Ga0181394_1156109 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 707 | Open in IMG/M |
| 3300020165|Ga0206125_10013868 | Not Available | 5329 | Open in IMG/M |
| 3300020374|Ga0211477_10063260 | All Organisms → Viruses → Predicted Viral | 1426 | Open in IMG/M |
| 3300020380|Ga0211498_10403976 | Not Available | 511 | Open in IMG/M |
| 3300020416|Ga0211644_10150693 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 950 | Open in IMG/M |
| 3300020428|Ga0211521_10155630 | Not Available | 1066 | Open in IMG/M |
| 3300020438|Ga0211576_10075277 | All Organisms → Viruses → Predicted Viral | 1891 | Open in IMG/M |
| 3300020438|Ga0211576_10142123 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300020438|Ga0211576_10283165 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 865 | Open in IMG/M |
| 3300020463|Ga0211676_10074467 | All Organisms → Viruses → Predicted Viral | 2311 | Open in IMG/M |
| 3300020474|Ga0211547_10557132 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300020595|Ga0206126_10066696 | All Organisms → Viruses → Predicted Viral | 1875 | Open in IMG/M |
| 3300020595|Ga0206126_10403478 | Not Available | 601 | Open in IMG/M |
| (restricted) 3300024259|Ga0233437_1276383 | Not Available | 665 | Open in IMG/M |
| 3300025086|Ga0208157_1025658 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
| 3300025120|Ga0209535_1032186 | All Organisms → Viruses → Predicted Viral | 2458 | Open in IMG/M |
| 3300025120|Ga0209535_1175391 | Not Available | 639 | Open in IMG/M |
| 3300025132|Ga0209232_1013648 | All Organisms → Viruses → Predicted Viral | 3290 | Open in IMG/M |
| 3300025168|Ga0209337_1153027 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 996 | Open in IMG/M |
| 3300025577|Ga0209304_1066369 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 897 | Open in IMG/M |
| 3300025680|Ga0209306_1174981 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 597 | Open in IMG/M |
| 3300025704|Ga0209602_1222451 | Not Available | 544 | Open in IMG/M |
| 3300025712|Ga0209305_1138268 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300025822|Ga0209714_1175805 | Not Available | 527 | Open in IMG/M |
| 3300025890|Ga0209631_10498437 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 542 | Open in IMG/M |
| 3300027522|Ga0209384_1008695 | All Organisms → Viruses → Predicted Viral | 3759 | Open in IMG/M |
| 3300027672|Ga0209383_1115657 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300028196|Ga0257114_1014427 | All Organisms → Viruses → Predicted Viral | 4045 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.52% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 22.52% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 16.22% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.21% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 5.41% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 5.41% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.60% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.70% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.80% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.80% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.80% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.80% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.90% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.90% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.90% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.90% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.90% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001947 | Marine microbial communities from the Gulf of Maine, Canada - GS002 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009077 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009442 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009496 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 | Environmental | Open in IMG/M |
| 3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
| 3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025577 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
| 3300025822 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100260961 | 3300000101 | Marine | MQEPMITLGDLVEILSTDLTETEIEAFLFEWGIT* |
| DelMOSum2010_100858192 | 3300000101 | Marine | MTEPMITLSDLVEILSTDLTPTEIEAFLFEWGIA* |
| DelMOSum2010_100891154 | 3300000101 | Marine | MTEPYITXGDLVEILSTDLTEAEIESFLYEWGIA* |
| DelMOSum2010_100982312 | 3300000101 | Marine | MTEPMITLDDLLEILSTDLTQAEIEAFLYEWGVA* |
| DelMOSum2011_100791033 | 3300000115 | Marine | MTEPMITLNDLVEILSTDLTPTEIEAFLYEWGVA* |
| DelMOSum2011_100840521 | 3300000115 | Marine | MTEPYITLGDLVEILSTDLTEAEIESFLYEWGIA* |
| DelMOSum2011_101639613 | 3300000115 | Marine | NREDNMQEPMITLGDLVEILSTDLTETEIEAFLFEWGIA* |
| DelMOSpr2010_102078373 | 3300000116 | Marine | MTEPYITLGDLVEILSTDLTEAEIEAFLFEWGIA* |
| JGI20152J14361_100521663 | 3300001344 | Pelagic Marine | MMEPDMITLDDLLEILSTDLTPTEIEAFLFEWGVA* |
| JGI20152J14361_101031921 | 3300001344 | Pelagic Marine | MMEPDMITLDDLLEILSTDLTQTEIEAFLFEWGIA* |
| JGI20151J14362_100747721 | 3300001346 | Pelagic Marine | MTEPMITLGDLVEILSTDLTEAEIEAFLYEWGIT* |
| JGI20155J14468_101524984 | 3300001354 | Pelagic Marine | MTEPMITLSDLVEILSTDLTEAEIEAFLFEWGIA* |
| JGI20158J14315_100176133 | 3300001355 | Pelagic Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGIA* |
| JGI24006J15134_100440773 | 3300001450 | Marine | MSEPMITLGDLVEILATDLTQTEIEAFLYDWGIA* |
| JGI24006J15134_100594682 | 3300001450 | Marine | MIEPMITLGDLVEILSTDLTETEIEAFLYEWGIA* |
| JGI24003J15210_100149462 | 3300001460 | Marine | MEPDMITLDDLLEILSTDLTPTEIEAFLFEWGIA* |
| JGI24003J15210_100209923 | 3300001460 | Marine | MMEPDMITLDDLLEILSTDLTPTEIEAFLFEWGIA* |
| JGI24003J15210_100857384 | 3300001460 | Marine | MTEPMITLGDLLEILSTDLTPTEIEAFLYEWGIA* |
| GOS2218_10227691 | 3300001947 | Marine | FVNNREDNMQEPMITLGDLVEILSTDLTETEIEAFLFEWGIT* |
| KVWGV2_107559511 | 3300002242 | Marine Sediment | LIRWEMRRSLNNKGGNMTEPYITLGDLVEILSTDLTEAEIEAFLYEWGIA* |
| Ga0075441_100359331 | 3300006164 | Marine | DNMTEPMITLGDLVEILSTDLTQAEIEAFLYEWGIA* |
| Ga0075441_100596677 | 3300006164 | Marine | MMRLSLDKREDNMTEPMITLGDLVEILSTDLTQAEIEAFLYEWGI |
| Ga0075441_101824812 | 3300006164 | Marine | MTEPMITLGDLVEILSTDLTQAEIEAFLYEWGIA* |
| Ga0075443_100430806 | 3300006165 | Marine | MMRLSLDKREDNMTEPMITLGDLVEILSTDLTQAEIEAFLYEWGIA* |
| Ga0075443_101954441 | 3300006165 | Marine | MTEPMITLGDLVEILSTDLTQAEIEAFLYEWGIA*L |
| Ga0070744_100637122 | 3300006484 | Estuarine | MQEPMITLGDLVEILSTDLTETEIEAFLFEWGIA* |
| Ga0098038_10079749 | 3300006735 | Marine | MTEPMITLGDLVEILSTDLTPTEIEAFLYEWGIA* |
| Ga0098038_11244412 | 3300006735 | Marine | MTEPMITLSDLLEILATDLTPAEIEAFLYEWGIA* |
| Ga0098038_12222712 | 3300006735 | Marine | MMEPTITLSDLVEILSTDLTPTEIEAFLFEWGIA* |
| Ga0098038_12388772 | 3300006735 | Marine | MTEPMITLNDLVEILSTDLTPTEIEAFLYEWGIA* |
| Ga0098038_12609232 | 3300006735 | Marine | MTEPYITLGDLVEILSTDLTQTEIEAFLYEWGIA* |
| Ga0098037_11415671 | 3300006737 | Marine | MTEPYITLSDLVEILSTDLTEAEIEAFLFEWGIA* |
| Ga0098042_10155432 | 3300006749 | Marine | MTEPYITLSDLVEILSTDLTPTEIEAFLFEWGIA* |
| Ga0098055_11296303 | 3300006793 | Marine | MTEPYITLGDLIEILSTDLTPTEIEAFLYEWGIA*LSLSIY* |
| Ga0070750_103893093 | 3300006916 | Aqueous | MTEPYITLGDLVEILSTDLTPTEIEAFLFEWGIA* |
| Ga0070748_12342683 | 3300006920 | Aqueous | EDNMTEPYITLGDLVEILSTDLTEAEIESFLYEWGIA* |
| Ga0098045_10970142 | 3300006922 | Marine | MTEPYITLGDLVEILSTDLTPTEIEAFLYEWGIA* |
| Ga0098051_11410392 | 3300006924 | Marine | REDNMTEPYITLGDLIEILSTDLTPTEIEAFLYEWGIA* |
| Ga0098050_11011902 | 3300006925 | Marine | MTEPYITLGDLVEILSTDLTEAEIEAFLFEWGIA*LSLSIY* |
| Ga0075444_100463621 | 3300006947 | Marine | KEDNMTEPMITLGDLVEILSTDLTQAEIEAFLYEWGIA* |
| Ga0102816_10775872 | 3300008999 | Estuarine | MQEPMITLGDLVEILSTDLTEAEIEAFLFEWGIA* |
| Ga0102960_12716771 | 3300009000 | Pond Water | MTEPMITLGDLVEILSTDLTEAEIEAFLYEWGIA* |
| Ga0102960_12718611 | 3300009000 | Pond Water | MTEPYITLGDLVEILSTDLTEAEIEAFLYEWGIA* |
| Ga0102810_12579633 | 3300009002 | Estuarine | MQEPMITLGDLVEILATDLTQTEIEAFLYDWGIA* |
| Ga0115566_102139942 | 3300009071 | Pelagic Marine | MEPDMITLDDLLEILSTDLTPTEIEAFLFEWGVA* |
| Ga0115566_104467583 | 3300009071 | Pelagic Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGIS* |
| Ga0115566_105909892 | 3300009071 | Pelagic Marine | MEPDMITLDDLLEILSTDLTQTEIEAFLFEWGIA* |
| Ga0115566_106684481 | 3300009071 | Pelagic Marine | MQEPYITLGDLVEILSTDLTQTEIEAFLSEWGIA* |
| Ga0115550_10095911 | 3300009076 | Pelagic Marine | LFRRLGGYMTEPMITLGDLVEILSTDLTEAEIEAFLYEWGIA* |
| Ga0115550_11416553 | 3300009076 | Pelagic Marine | LVRITNNRENNMTEPMITLGDLVEILSTDLTPTEIEAFLFEWGIT* |
| Ga0115550_11453634 | 3300009076 | Pelagic Marine | MTEPMITLDDLLEILSTDLTQTEIEAFLFEWGIA* |
| Ga0115550_11900662 | 3300009076 | Pelagic Marine | LFRRLGGYMTEPMITLGDLVEILSTDLTEAEIEAFLYEWGIS* |
| Ga0115552_11108614 | 3300009077 | Pelagic Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGIS** |
| Ga0115551_11276662 | 3300009193 | Pelagic Marine | MTEPMITLSDLVEILSTDLTPTEIEAFLYEWGIA* |
| Ga0114902_11841052 | 3300009413 | Deep Ocean | MTEPYITLSDLVEILSTDLTETEIEAFLSEWGIA* |
| Ga0114994_101057865 | 3300009420 | Marine | MIEPYITFGDLVEILSTDLTETEIEAFLYEWGIA* |
| Ga0115545_11045983 | 3300009433 | Pelagic Marine | MTEPMITLSDLVEILSTDLTEAEIEAFLFEWGIT* |
| Ga0115562_13197492 | 3300009434 | Pelagic Marine | MTEPYITLSDLVEILSTDLTEAEIEAFLFEWGIA** |
| Ga0115556_11877271 | 3300009437 | Pelagic Marine | LTKWEYEMMEPDMITLDDLLEILSTDLTPTEIEAFLFEWGVA* |
| Ga0115563_11299672 | 3300009442 | Pelagic Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGIT* |
| Ga0115560_12498712 | 3300009447 | Pelagic Marine | MTEPMITLGDLVEILSTDLTETEIEAFLFEWGIT* |
| Ga0115555_14258211 | 3300009476 | Pelagic Marine | EHEMTEPMITLNDLVEILSTDLTPTEIEAFLFEWGVA* |
| Ga0114932_100849191 | 3300009481 | Deep Subsurface | MTEPMITLSDLIEILSTDLTPTEIEAFLYEWGIA* |
| Ga0114932_101522024 | 3300009481 | Deep Subsurface | MQEPYITLSDLVEILSTDLTPTEIEAFLFEWGVA* |
| Ga0115570_103427771 | 3300009496 | Pelagic Marine | LTKWEYEMMEPDMITLDDLLEILSTDLTQTEIEAFLFEWGIA* |
| Ga0115568_104131792 | 3300009498 | Pelagic Marine | RRLGGYMTEPMITLGDLVEILSTDLTEAEIEAFLYEWGIT* |
| Ga0115564_104063822 | 3300009505 | Pelagic Marine | MQEPMITLGDLVEILSTDLTETEIEAFLFEWGIS* |
| Ga0115567_100975495 | 3300009508 | Pelagic Marine | MTEPYITLSDLVEILSTDLTPTEIEAFLSEWGIA* |
| Ga0115011_115548653 | 3300009593 | Marine | MTEPYITLGDLIEILSTDLTPTEIEAFLYEWGIA* |
| Ga0115104_110330391 | 3300009677 | Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGIA** |
| Ga0115002_110153413 | 3300009706 | Marine | MSEPMITLGDLVEILSTDLTETEIEAFLFEWGIT* |
| Ga0115012_105909052 | 3300009790 | Marine | MTEPYITLGDLIEILSTDLTPTEIEAFLYEWGIARWKV* |
| Ga0160422_107759741 | 3300012919 | Seawater | GVKMTYFTLDQLIEILSTDLTPTEIEAFLYEWGIA* |
| Ga0163180_101408064 | 3300012952 | Seawater | MTEPMITLGDLIEILSTDLTPTEIEAFLYEWGIA* |
| Ga0163179_107053242 | 3300012953 | Seawater | MIEPYITLGDLVEILSTDLTETEIEAFLSEWGIA* |
| Ga0163179_116199912 | 3300012953 | Seawater | MTGPYITLGDLIEILSTDLTPEEIEAFLYEWGIA* |
| Ga0163179_122711212 | 3300012953 | Seawater | MTEPYITLGDLVEILSTDLTQAEIEAFLYEWGIA* |
| Ga0163111_123941183 | 3300012954 | Surface Seawater | MTEPMITLGDLIEILSTDLTEAEIEAFLFEWGIA* |
| Ga0181403_10284992 | 3300017710 | Seawater | MEPDMITLDDLLEILSTDLTPTEIEAFLYEWGVAX |
| Ga0181398_10252563 | 3300017725 | Seawater | MTEPMITLSDLVEILSTDLTETEIEAFLFEWGIAX |
| Ga0181393_11283021 | 3300017748 | Seawater | REDNMQEPYITLGDLVEILSTDLTETEIEAFLFEWGIT |
| Ga0181413_11835513 | 3300017765 | Seawater | MMEPDMITLDDLLEILSTDLTPTEIEAFLYEWGIA |
| Ga0187217_12354263 | 3300017770 | Seawater | MMEPDMITLDDLLEILSTDLTPTEIEAFLFEWGIA |
| Ga0181394_11561091 | 3300017776 | Seawater | EDNMMEPDMITLDDLLEILSTDLTPTEIEAFLFEWGIA |
| Ga0206125_1001386810 | 3300020165 | Seawater | MMEPDMITLDDLLEILSTDLTPTEIEAFLFEWGVA |
| Ga0211477_100632605 | 3300020374 | Marine | MRRSLNNKGGNMTEPYITLGDLVEILSTDLTEAEIEAFLYEWGIA |
| Ga0211498_104039762 | 3300020380 | Marine | IXLTRXEDKMTGPYITLGDLIEILSTDLTPDEIEAFLYEWGIA |
| Ga0211644_101506933 | 3300020416 | Marine | DNMTEPYITLGDLIEILSTDLTPTEIEAFLYEWGIA |
| Ga0211521_101556302 | 3300020428 | Marine | MTEPMITLGDLLEILATDLTETEIEAFLFEWGIAX |
| Ga0211576_100752771 | 3300020438 | Marine | MMEPDMITLDDLLEILSTDLTPTEIEAFLYEWGVA |
| Ga0211576_101421233 | 3300020438 | Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGITX |
| Ga0211576_102831652 | 3300020438 | Marine | MEPDMITLDDLLEILSTDLTPTEIEAFLFEWGIAX |
| Ga0211676_100744671 | 3300020463 | Marine | MMEPDMITLDDLLEILSTDLTQAEIEAFLFEWGVA |
| Ga0211547_105571323 | 3300020474 | Marine | MTEPYITLGDLVEILSTDLTQAEIEAFLYEWGIAX |
| Ga0206126_100666961 | 3300020595 | Seawater | NNREDNMQEPYITLGDLVEILSTDLTETEIEAFLFEWGIA |
| Ga0206126_104034782 | 3300020595 | Seawater | MMEPDMITLDDLLEILSTDLTQTEIEAFLFEWGIA |
| (restricted) Ga0233437_12763832 | 3300024259 | Seawater | MIEPMITLGDLVEILSTDLTETEIEAFLFEWGIAX |
| Ga0208157_10256585 | 3300025086 | Marine | REDNMTEPYITLGDLVEILSTDLTEAEIEAFLFEWGIA |
| Ga0209535_10321866 | 3300025120 | Marine | MIEPMITLGDLVEILSTDLTETEIEAFLYEWGIAX |
| Ga0209535_11753911 | 3300025120 | Marine | MMEPDMITLDDLLEILSTDLTPTEIEAFLFEWGIAX |
| Ga0209232_10136484 | 3300025132 | Marine | MTEPYITLGDLIEILSTDLTPTEIEAFLYEWGIAXLSLSIY |
| Ga0209337_11530272 | 3300025168 | Marine | MQEPMITLGDLVEILSTDLTETEIEAFLFEWGIAX |
| Ga0209304_10663692 | 3300025577 | Pelagic Marine | MQEPMITLGDLVEILSTDLTETEIEAFLFEWGISX |
| Ga0209306_11749811 | 3300025680 | Pelagic Marine | REDNMQEPYITLGDLVEILSTDLTETEIEAFLFEWGISX |
| Ga0209602_12224511 | 3300025704 | Pelagic Marine | MQEPMITLGDLVEILSTDLTETEIEAFLFEWGITX |
| Ga0209305_11382682 | 3300025712 | Pelagic Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGISX |
| Ga0209714_11758052 | 3300025822 | Pelagic Marine | TKWEYEMMEPDMITLDDLLEILSTDLTQTEIEAFLFEWGIA |
| Ga0209631_104984372 | 3300025890 | Pelagic Marine | MQEPYITLGDLVEILSTDLTETEIEAFLFEWGIAX |
| Ga0209384_10086955 | 3300027522 | Marine | MMRLSLDKKEDNMTEPMITLGDLVEILSTDLTQAEIEAFLYEWGIA |
| Ga0209383_11156571 | 3300027672 | Marine | MMRLSLDKREDNMTEPMITLGDLVEILSTDLTQAEIEAFLYEWGIA |
| Ga0257114_10144273 | 3300028196 | Marine | MIEPDMITLDDLLEILSTDLTPTEIEAFLFEWGIA |
| ⦗Top⦘ |