| Basic Information | |
|---|---|
| Family ID | F086153 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 44 residues |
| Representative Sequence | PDLQTGAFLHLLDQDKIEGITKNTEGWLENFRELTTVK |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.10 % |
| % of genes from short scaffolds (< 2000 bps) | 91.89 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.063 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (14.414 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.550 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.892 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.82% β-sheet: 0.00% Coil/Unstructured: 68.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 20.72 |
| PF03796 | DnaB_C | 12.61 |
| PF00772 | DnaB | 10.81 |
| PF00268 | Ribonuc_red_sm | 4.50 |
| PF01695 | IstB_IS21 | 2.70 |
| PF13759 | 2OG-FeII_Oxy_5 | 1.80 |
| PF13481 | AAA_25 | 0.90 |
| PF00861 | Ribosomal_L18p | 0.90 |
| PF00583 | Acetyltransf_1 | 0.90 |
| PF02867 | Ribonuc_red_lgC | 0.90 |
| PF00085 | Thioredoxin | 0.90 |
| PF02739 | 5_3_exonuc_N | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 23.42 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 12.61 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 4.50 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 2.70 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.90 |
| COG0256 | Ribosomal protein L18 | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.06 % |
| All Organisms | root | All Organisms | 36.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001961|GOS2240_1002530 | All Organisms → cellular organisms → Bacteria | 1791 | Open in IMG/M |
| 3300001973|GOS2217_10091456 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 1865 | Open in IMG/M |
| 3300003409|JGI26088J50261_1065238 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 631 | Open in IMG/M |
| 3300003592|JGI26246J51724_1055844 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300004097|Ga0055584_101215518 | Not Available | 786 | Open in IMG/M |
| 3300004097|Ga0055584_101794765 | Not Available | 632 | Open in IMG/M |
| 3300004097|Ga0055584_101916780 | Not Available | 609 | Open in IMG/M |
| 3300004273|Ga0066608_1131781 | Not Available | 620 | Open in IMG/M |
| 3300004280|Ga0066606_10237162 | Not Available | 654 | Open in IMG/M |
| 3300004457|Ga0066224_1330667 | Not Available | 606 | Open in IMG/M |
| 3300005424|Ga0066826_10024483 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2470 | Open in IMG/M |
| 3300005942|Ga0070742_10025892 | Not Available | 1565 | Open in IMG/M |
| 3300006165|Ga0075443_10322433 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 570 | Open in IMG/M |
| 3300006749|Ga0098042_1099867 | Not Available | 736 | Open in IMG/M |
| 3300006874|Ga0075475_10173862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 934 | Open in IMG/M |
| 3300006874|Ga0075475_10391673 | Not Available | 560 | Open in IMG/M |
| 3300007539|Ga0099849_1199891 | Not Available | 752 | Open in IMG/M |
| 3300007552|Ga0102818_1022577 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1244 | Open in IMG/M |
| 3300007557|Ga0102821_1165466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 563 | Open in IMG/M |
| 3300008258|Ga0114840_1028481 | Not Available | 918 | Open in IMG/M |
| 3300008996|Ga0102831_1151704 | Not Available | 769 | Open in IMG/M |
| 3300009000|Ga0102960_1275518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 595 | Open in IMG/M |
| 3300009000|Ga0102960_1304869 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 562 | Open in IMG/M |
| 3300009000|Ga0102960_1358691 | Not Available | 515 | Open in IMG/M |
| 3300009002|Ga0102810_1050768 | Not Available | 1332 | Open in IMG/M |
| 3300009086|Ga0102812_10152005 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1266 | Open in IMG/M |
| 3300009432|Ga0115005_10966414 | Not Available | 689 | Open in IMG/M |
| 3300009505|Ga0115564_10076708 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1912 | Open in IMG/M |
| 3300010148|Ga0098043_1067726 | Not Available | 1071 | Open in IMG/M |
| 3300010149|Ga0098049_1029946 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1772 | Open in IMG/M |
| 3300010149|Ga0098049_1232396 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 562 | Open in IMG/M |
| 3300012920|Ga0160423_10624569 | Not Available | 729 | Open in IMG/M |
| 3300012928|Ga0163110_10131482 | Not Available | 1712 | Open in IMG/M |
| 3300012936|Ga0163109_11285047 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 533 | Open in IMG/M |
| 3300017708|Ga0181369_1001894 | All Organisms → cellular organisms → Bacteria | 5904 | Open in IMG/M |
| 3300017708|Ga0181369_1095229 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 622 | Open in IMG/M |
| 3300017719|Ga0181390_1139460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 618 | Open in IMG/M |
| 3300017726|Ga0181381_1092668 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 642 | Open in IMG/M |
| 3300017731|Ga0181416_1148564 | Not Available | 565 | Open in IMG/M |
| 3300017741|Ga0181421_1005877 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3483 | Open in IMG/M |
| 3300017744|Ga0181397_1125670 | Not Available | 665 | Open in IMG/M |
| 3300017748|Ga0181393_1145027 | Not Available | 594 | Open in IMG/M |
| 3300017755|Ga0181411_1225809 | Not Available | 520 | Open in IMG/M |
| 3300017781|Ga0181423_1078549 | Not Available | 1303 | Open in IMG/M |
| 3300017967|Ga0181590_10507580 | Not Available | 838 | Open in IMG/M |
| 3300017969|Ga0181585_10286879 | Not Available | 1150 | Open in IMG/M |
| 3300018424|Ga0181591_10142384 | Not Available | 1927 | Open in IMG/M |
| 3300020378|Ga0211527_10137044 | Not Available | 702 | Open in IMG/M |
| 3300020403|Ga0211532_10393660 | Not Available | 519 | Open in IMG/M |
| 3300020410|Ga0211699_10207921 | Not Available | 748 | Open in IMG/M |
| 3300020430|Ga0211622_10270021 | Not Available | 728 | Open in IMG/M |
| 3300020441|Ga0211695_10292106 | Not Available | 597 | Open in IMG/M |
| 3300020457|Ga0211643_10015006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 4034 | Open in IMG/M |
| 3300020595|Ga0206126_10122606 | Not Available | 1261 | Open in IMG/M |
| 3300021087|Ga0206683_10491984 | Not Available | 604 | Open in IMG/M |
| 3300021957|Ga0222717_10182948 | Not Available | 1254 | Open in IMG/M |
| 3300021958|Ga0222718_10386880 | Not Available | 702 | Open in IMG/M |
| 3300021959|Ga0222716_10557067 | Not Available | 634 | Open in IMG/M |
| 3300021960|Ga0222715_10355631 | Not Available | 814 | Open in IMG/M |
| 3300021960|Ga0222715_10456545 | Not Available | 686 | Open in IMG/M |
| 3300021960|Ga0222715_10524309 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 625 | Open in IMG/M |
| 3300021961|Ga0222714_10225687 | Not Available | 1065 | Open in IMG/M |
| 3300021961|Ga0222714_10400688 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 725 | Open in IMG/M |
| 3300022074|Ga0224906_1005263 | All Organisms → cellular organisms → Bacteria | 5453 | Open in IMG/M |
| 3300022198|Ga0196905_1020147 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2093 | Open in IMG/M |
| 3300022926|Ga0255753_1282268 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 652 | Open in IMG/M |
| 3300022927|Ga0255769_10187673 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 926 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10345603 | Not Available | 670 | Open in IMG/M |
| 3300024230|Ga0228638_1104322 | Not Available | 688 | Open in IMG/M |
| 3300024231|Ga0233399_1111776 | Not Available | 617 | Open in IMG/M |
| 3300024267|Ga0228623_1001907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6224 | Open in IMG/M |
| 3300024267|Ga0228623_1042281 | Not Available | 912 | Open in IMG/M |
| 3300024294|Ga0228664_1108566 | Not Available | 589 | Open in IMG/M |
| 3300024316|Ga0228654_1038750 | Not Available | 712 | Open in IMG/M |
| 3300024346|Ga0244775_11339529 | Not Available | 553 | Open in IMG/M |
| 3300024413|Ga0233393_1085588 | Not Available | 696 | Open in IMG/M |
| 3300024428|Ga0233396_1085682 | Not Available | 783 | Open in IMG/M |
| 3300024571|Ga0256302_1178098 | Not Available | 500 | Open in IMG/M |
| 3300025084|Ga0208298_1036105 | Not Available | 1013 | Open in IMG/M |
| 3300025102|Ga0208666_1109340 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 670 | Open in IMG/M |
| 3300025132|Ga0209232_1085907 | Not Available | 1082 | Open in IMG/M |
| 3300025138|Ga0209634_1025982 | Not Available | 3173 | Open in IMG/M |
| 3300025658|Ga0209659_1218807 | Not Available | 521 | Open in IMG/M |
| 3300025701|Ga0209771_1080945 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300025763|Ga0255250_1139747 | Not Available | 520 | Open in IMG/M |
| 3300025767|Ga0209137_1201487 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 671 | Open in IMG/M |
| 3300025840|Ga0208917_1041202 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1866 | Open in IMG/M |
| 3300025879|Ga0209555_10049442 | All Organisms → Viruses → Predicted Viral | 1900 | Open in IMG/M |
| 3300025880|Ga0209534_10080932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → unclassified Methylophaga → Methylophaga sp. | 1922 | Open in IMG/M |
| 3300026183|Ga0209932_1062468 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 876 | Open in IMG/M |
| 3300026200|Ga0208894_1178439 | Not Available | 537 | Open in IMG/M |
| 3300026443|Ga0247559_1077272 | Not Available | 710 | Open in IMG/M |
| 3300026460|Ga0247604_1080642 | Not Available | 756 | Open in IMG/M |
| 3300026500|Ga0247592_1170752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
| 3300027198|Ga0208163_1033970 | Not Available | 843 | Open in IMG/M |
| 3300027229|Ga0208442_1072635 | Not Available | 565 | Open in IMG/M |
| 3300027234|Ga0208170_1074626 | Not Available | 634 | Open in IMG/M |
| 3300027255|Ga0208681_1068531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 617 | Open in IMG/M |
| 3300027413|Ga0208950_1039127 | Not Available | 1226 | Open in IMG/M |
| 3300027413|Ga0208950_1083620 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp. | 699 | Open in IMG/M |
| 3300027418|Ga0208022_1063270 | Not Available | 798 | Open in IMG/M |
| 3300027714|Ga0209815_1171672 | Not Available | 681 | Open in IMG/M |
| 3300027753|Ga0208305_10018357 | All Organisms → Viruses → Predicted Viral | 2850 | Open in IMG/M |
| 3300027757|Ga0208671_10088812 | Not Available | 1137 | Open in IMG/M |
| 3300028008|Ga0228674_1097243 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10210887 | Not Available | 874 | Open in IMG/M |
| 3300028099|Ga0247576_1013583 | Not Available | 1655 | Open in IMG/M |
| 3300028110|Ga0247584_1106499 | Not Available | 702 | Open in IMG/M |
| 3300028189|Ga0257127_1046079 | Not Available | 1470 | Open in IMG/M |
| 3300028233|Ga0256417_1154955 | Not Available | 616 | Open in IMG/M |
| 3300028280|Ga0228646_1156496 | Not Available | 547 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 14.41% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 12.61% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 10.81% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 9.01% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 8.11% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.11% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.21% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.50% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.50% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 3.60% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.60% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.80% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.80% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.80% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.90% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001961 | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 | Environmental | Open in IMG/M |
| 3300001973 | Marine microbial communities from Bermuda, Atlantic Ocean - GS001 | Environmental | Open in IMG/M |
| 3300003409 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA | Environmental | Open in IMG/M |
| 3300003592 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004273 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_135m | Environmental | Open in IMG/M |
| 3300004280 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m | Environmental | Open in IMG/M |
| 3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
| 3300005424 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007552 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009002 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024230 | Seawater microbial communities from Monterey Bay, California, United States - 48D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024267 | Seawater microbial communities from Monterey Bay, California, United States - 28D | Environmental | Open in IMG/M |
| 3300024294 | Seawater microbial communities from Monterey Bay, California, United States - 78D | Environmental | Open in IMG/M |
| 3300024316 | Seawater microbial communities from Monterey Bay, California, United States - 66D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024413 | Seawater microbial communities from Monterey Bay, California, United States - 21D | Environmental | Open in IMG/M |
| 3300024428 | Seawater microbial communities from Monterey Bay, California, United States - 32D | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025658 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025763 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026200 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 (SPAdes) | Environmental | Open in IMG/M |
| 3300026443 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026460 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 85R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026500 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027198 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes) | Environmental | Open in IMG/M |
| 3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027234 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027255 | Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027413 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300028008 | Seawater microbial communities from Monterey Bay, California, United States - 1D_r | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028099 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 33R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028110 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028189 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_135m | Environmental | Open in IMG/M |
| 3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2240_10025304 | 3300001961 | Marine | LQTGAFLHLLDQDKIEGITKNTDTWLENFRGLTTVS* |
| GOS2217_100914564 | 3300001973 | Marine | PDPSGAFLHLLDNDKIEGITKNTEGWLETFRKLTVYKR* |
| JGI26088J50261_10652383 | 3300003409 | Marine | KQYVNDVLKQPAPDLQAGAFLRLLEQDKIEGITKNTEGWLETFRDLTKV* |
| JGI26246J51724_10558441 | 3300003592 | Marine | DVIKSVVPDLQVGAFLHCLDTDKIEGITKNTEAWLENFRPLTTVK* |
| Ga0055584_1012155181 | 3300004097 | Pelagic Marine | PDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK* |
| Ga0055584_1017947651 | 3300004097 | Pelagic Marine | KSTILDIVKEDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK* |
| Ga0055584_1019167801 | 3300004097 | Pelagic Marine | IVKEDIPDLQAGAFLHLLENDKIEGITKNTEGWLENFRGLTVFKK* |
| Ga0066608_11317812 | 3300004273 | Marine | KQKDHILDIIKSEIPDLQSGAFLHLLDQDKIEGITKNTEAWLEVFRSLTVFTK* |
| Ga0066606_102371622 | 3300004280 | Marine | IPDLQSGAFLHLLDQDKIEGITKNTEAWLEVFRSLTVFTK* |
| Ga0066224_13306672 | 3300004457 | Marine | KDHILDIIKSDIPSLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVLKK* |
| Ga0066826_100244831 | 3300005424 | Marine | ILDIIKSGVPDLQAGAFLHLLDTDRIEGVTKNTEGWLENFRGLTVFKK* |
| Ga0070742_100258921 | 3300005942 | Estuarine | DLQTGAFLHLLDQDKIEGITKNTEGWLDNFKGLRFVK* |
| Ga0075443_103224332 | 3300006165 | Marine | VHILDTMKSKIPTLQTGAFLHMLETDGIEGITKNTETWLENFRGLTTVIGNENR* |
| Ga0098042_10998672 | 3300006749 | Marine | ILEIIKSDIPDLQAGAFLHLLDSDKIEGITKNTEGWLENFRGLTVFKK* |
| Ga0075475_101738621 | 3300006874 | Aqueous | PDLQTGAFLHLLDQDKIEGITKNTEGWLENFRELTTVK* |
| Ga0075475_103916732 | 3300006874 | Aqueous | LPDLQTGAFLHMLDQDKVEGITKNTEGWLENFRSLTTVIK* |
| Ga0099849_11998911 | 3300007539 | Aqueous | KNTILNTITSPVPDLQSGAFLHLLDQDKIEGITKNTPGWLENFRALTTVIT* |
| Ga0102818_10225774 | 3300007552 | Estuarine | QTGAFLHSLDQDKIEGITKNTEGWLENFRRLTTVS* |
| Ga0102821_11654663 | 3300007557 | Estuarine | DLQTGAFLHSLDQDKIEGITKNTEGWLENFSRLTTVS* |
| Ga0114840_10284811 | 3300008258 | Freshwater, Plankton | TLNVLKEAVPPLQTGAFLHLLDIDKIEGITKNTEGWLENFRTLTVFKQ* |
| Ga0102831_11517041 | 3300008996 | Estuarine | TGAFLHLLDIDKIEGITKNTEGWLENFRTLTVFKQ* |
| Ga0102960_12755181 | 3300009000 | Pond Water | TGAFLHLLDHDKIEGVTKNTEGWLENFRGLTTVQ* |
| Ga0102960_13048691 | 3300009000 | Pond Water | DSVIKLPVPDLQTGTFLHYLDSDKIEGVTKNTEGWLENFRGLTTVS* |
| Ga0102960_13586912 | 3300009000 | Pond Water | LQTGAFLHHLDQDKIEGVTKNTEGWLENFRGLTTVK* |
| Ga0102810_10507683 | 3300009002 | Estuarine | DLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK* |
| Ga0102812_101520054 | 3300009086 | Estuarine | LQTGAFLHSLDQDKIEGITKNTEGWLENFRRLTTVS* |
| Ga0115005_109664142 | 3300009432 | Marine | IIRGNVPDLQTGAFLHLLEQDQIEGITKNTEGWLENFRSLTVLK* |
| Ga0115564_100767083 | 3300009505 | Pelagic Marine | KEEVRGLETGAFLHMLQHDKIEGITKNTESWLENFRGLTVIKK* |
| Ga0098043_10677262 | 3300010148 | Marine | PDLQSGAFLHLLDQDKIEGITKNTEGWLQNFRGLTVFKK* |
| Ga0098049_10299461 | 3300010149 | Marine | VINSPVPDLQTGAFLRLLEKDKIEGITKNTESWLENYRGLTTVK* |
| Ga0098049_12323963 | 3300010149 | Marine | ILKADIPDLQTGVFLSLLDQDKIEGVTKNTEGWLENFRHLTTVS* |
| Ga0160423_106245691 | 3300012920 | Surface Seawater | IIKSPVPDLQTGAFLRLLDQDKIEGVTKNTEGWLENFRGLTTVIK* |
| Ga0163110_101314821 | 3300012928 | Surface Seawater | IKVVEDIFKSEIPDLQTGVFLSLLDQDKIEGVTKNTEGWLENFRGLTTVS* |
| Ga0163109_112850472 | 3300012936 | Surface Seawater | IFKSDIPNLQTGVFLSLLDQDKIEGITKNTEGWLENFRGLTTVK* |
| Ga0181369_10018941 | 3300017708 | Marine | TGAFLHLLDQDKIEGVTKNTEGWLENFRGLTVFKK |
| Ga0181369_10952291 | 3300017708 | Marine | ELQTGVFLSLLDQDKIEGITKNTEGWLENFRGLTTVK |
| Ga0181390_11394601 | 3300017719 | Seawater | DVFKQTIPDLQTGAFLHLMDQDKIEGITKNTEGWLENFRSLTTVK |
| Ga0181381_10926681 | 3300017726 | Seawater | IFKSNIPKLQTGVFLSLLDQDKIEGITKNTEGWLENFRGLTTVK |
| Ga0181416_11485642 | 3300017731 | Seawater | DTEKSTILNIVKEDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK |
| Ga0181421_10058771 | 3300017741 | Seawater | KQYVNSIISSIIPELQSGAFLHLLDQDKIEGITKNTEAWLENFRGLTKVK |
| Ga0181397_11256703 | 3300017744 | Seawater | ITDLQTGAFLHLLDQDKIEGVTKNTEGWLDNFKGLRTVS |
| Ga0181393_11450271 | 3300017748 | Seawater | TILDIIKSPIPDLQTGAFLRLLDQDKIEGVTKNTEGWLENFRGLTTVIK |
| Ga0181411_12258092 | 3300017755 | Seawater | VEEILKSPIPDLQTGAFLHHLDQDKIEGVTKNTEGWLENFRGLTTVK |
| Ga0181423_10785494 | 3300017781 | Seawater | KLQTGVFLSLLDQDKIEGITKNTEGWLENFRGLTTVK |
| Ga0181590_105075801 | 3300017967 | Salt Marsh | PDLQTGAFLHHMDQDKIEGITKNTEGWLENFRGLTTVK |
| Ga0181585_102868791 | 3300017969 | Salt Marsh | PAPRLQTGTFLHYLDNDKIEGITKNTEAWLETFRALTGFRAREL |
| Ga0181591_101423844 | 3300018424 | Salt Marsh | DLQIGAFLHLLDQDKIEGITKNTEGWLENFRGLTTVS |
| Ga0211527_101370441 | 3300020378 | Marine | ILDIIKSDIPDLQTGAFLHLLDQDKIEGITKNTEGWLENFRGLTVFKK |
| Ga0211532_103936602 | 3300020403 | Marine | ILDIIKSPIPSLETGAFLHLLDQDKIEGITKNTEAWLETFRGLTVFKK |
| Ga0211699_102079211 | 3300020410 | Marine | KGPIPDLQSGAFLHLLDNDKIEGITKNTEGWLETFRKLTVYKR |
| Ga0211622_102700212 | 3300020430 | Marine | KNHIFDTIKDNVPNLQVGAFLHLLDIDKIEGITKNTEGWLQNFRGLTVFK |
| Ga0211695_102921061 | 3300020441 | Marine | KNHIFDTIKDKVPSLQSGAFLHLLDTDRIEGITKNTEGWLENFRGLTVIK |
| Ga0211643_100150064 | 3300020457 | Marine | DNVPNLRVGSFLRLLDIDKIEGITKNTEGWLQNFRGLTVFK |
| Ga0206126_101226061 | 3300020595 | Seawater | EKSTILDIVKEDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK |
| Ga0206683_104919842 | 3300021087 | Seawater | PVNDLQTGAFLRMLELDGIEGITKNTEGWLENFRGLTTYKKSK |
| Ga0222717_101829484 | 3300021957 | Estuarine Water | YVESIMKENIPGLQTGAFLHLMDQDKIEGITKNTEGWLETFRALTTVK |
| Ga0222718_103868802 | 3300021958 | Estuarine Water | DIVKEDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK |
| Ga0222716_105570671 | 3300021959 | Estuarine Water | QSGAFLHLMDQDKIEGVTKNTEGWLENFRGLTVFKR |
| Ga0222715_103556312 | 3300021960 | Estuarine Water | SGAFLHLLDQDKIEGITKNTEGWLENFRGLTVLKK |
| Ga0222715_104565452 | 3300021960 | Estuarine Water | SPVNNLQTGAFLRMLELDGIEGITKNTEAWLENFRGLTTYKKK |
| Ga0222715_105243091 | 3300021960 | Estuarine Water | QSGAFLHLLDQDKIEGITKNTEGWLENFRGLTTVL |
| Ga0222714_102256874 | 3300021961 | Estuarine Water | PIPDLQTGAFLHLLDLDKIEGVTKNTEGWLENFRPLTTVR |
| Ga0222714_104006883 | 3300021961 | Estuarine Water | VPNLQTGAFLHMLDQDKIEGITKNTEAWLENYRSLTTVQ |
| Ga0224906_10052631 | 3300022074 | Seawater | SILEVIKSPIPNLQTGAFLHLLDQDKIEGVTKNTEGWLDNFKGLTTVTI |
| Ga0196905_10201471 | 3300022198 | Aqueous | SEIPDLQTGAFLHLLDQDKIEGITKNTEGWLENFRGLKVIKK |
| Ga0255753_12822683 | 3300022926 | Salt Marsh | KAPVPDLQTGAFLHLMDQDKIEGITKNTEGWLENFRGLTTVQ |
| Ga0255769_101876731 | 3300022927 | Salt Marsh | QTGAFLHLLDSDKIEGITKNTEGWLENFRTLTVVK |
| (restricted) Ga0233432_103456031 | 3300023109 | Seawater | QTGAFLRQLEQDKIEGITKNTEGWLENFRGLTAVSN |
| Ga0228638_11043221 | 3300024230 | Seawater | EDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK |
| Ga0233399_11117762 | 3300024231 | Seawater | SDIPNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVLKK |
| Ga0228623_100190711 | 3300024267 | Seawater | IKEKDHILNIIKSDIPNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVIKK |
| Ga0228623_10422811 | 3300024267 | Seawater | LRASLPDLQTGAFLRQLEQDKIEGITKNTEGWLENFRGLTAVSN |
| Ga0228664_11085661 | 3300024294 | Seawater | QTGAFLHLLDQDKIEGITKNTEGWLENFRGLTVFKK |
| Ga0228654_10387502 | 3300024316 | Seawater | MEVLKSPINDLQTGAFLHLLDQDKIEGVTKNTEGWLDNFKGLRHKK |
| Ga0244775_113395292 | 3300024346 | Estuarine | ILDIIKSDIPNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVLKK |
| Ga0233393_10855882 | 3300024413 | Seawater | VIKTPVNDLQTGAFLRMLELDGIEGITKNTEAWLENFRGLTTYKKK |
| Ga0233396_10856823 | 3300024428 | Seawater | KNTILDIVKEDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK |
| Ga0256302_11780981 | 3300024571 | Freshwater | TGAFLHLLGIDKIEGITKNTEGWLENFRTLTVFKQ |
| Ga0208298_10361051 | 3300025084 | Marine | KNHILNIIKSDIPNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVIKK |
| Ga0208666_11093403 | 3300025102 | Marine | TPDLQAGAFLRLLEQDKIEGITKNTEGWLETFRDLTKV |
| Ga0209232_10859072 | 3300025132 | Marine | NSEKNTILEIIKKDIPDLQSGAFLHLLDSDKIEGITKNTEGWLENFRGLTVFKK |
| Ga0209634_10259821 | 3300025138 | Marine | ILNIIKSDIPNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVLKK |
| Ga0209659_12188071 | 3300025658 | Marine | MDVLRASLPDLQTGAFLRQLEQDKIEGITKNTEGWLENFRGLTAVSN |
| Ga0209771_10809453 | 3300025701 | Marine | KSPVPDLQTGAFLRLLEKDKIEGITKNTEGWLENFRGLTVRS |
| Ga0255250_11397471 | 3300025763 | Freshwater | PIPPLQTGAFLHLLDVDKIEGITKNTEGWLENFRTLTVFK |
| Ga0209137_12014873 | 3300025767 | Marine | LKSEMPKLQTGGFLHLLEIDKIEGITKNTEGWLENFRRLTTVR |
| Ga0208917_10412021 | 3300025840 | Aqueous | LQTGAFLHLLDQDKIEGITKNTEGWLENFRELTTVK |
| Ga0209555_100494425 | 3300025879 | Marine | LKQPAPDLQAGAFLRLLEQDKIEGITKNTEGWLETFRDLTKV |
| Ga0209534_100809323 | 3300025880 | Pelagic Marine | DTVKQDIPDLQTGAFMHLLDQDKIEGITKNTEGWLENFRGLTSFKK |
| Ga0209932_10624681 | 3300026183 | Pond Water | QYVEEVIKQPIPTLQTGAFLHLLDQDKIEGVTKNTEGWLENFRDLTTVK |
| Ga0208894_11784391 | 3300026200 | Marine | ILDIIKSGVPDLQAGAFLHLLDTDRIEGVTKNTEGWLENFRGLTVFKK |
| Ga0247559_10772721 | 3300026443 | Seawater | KDHILNIIKSDIPNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVIKK |
| Ga0247604_10806421 | 3300026460 | Seawater | PNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVIKK |
| Ga0247592_11707521 | 3300026500 | Seawater | MIKKKNHILDIIKSDIPNLQTGAFLHLLDQDKIEGITKNTEGWLENFRGLT |
| Ga0208163_10339701 | 3300027198 | Estuarine | KEEVNKLQTGAFLHLLDEDKIEGITKNTEGWLENFRRLTVVK |
| Ga0208442_10726351 | 3300027229 | Estuarine | PPLQTGAFLHLLDIDKIEGITKNTEGWLENFRTLTVFKQ |
| Ga0208170_10746261 | 3300027234 | Estuarine | LRASLPDLQTGAFLRQLEQDKIEGITKNTEGWLENFRTLTVFKQ |
| Ga0208681_10685311 | 3300027255 | Estuarine | ILHTLNVLKEPIPPLQTGAFLHLLDIDKIEGITKNTEGWLENFRTLTVFKQ |
| Ga0208950_10391272 | 3300027413 | Marine | KEEIPNLQTGAFLHLLDQDKIEGITRNTEGWLENFRGLTGYKK |
| Ga0208950_10836203 | 3300027413 | Marine | EVINSPVPDLQTGAFLRLLEKDKIEGITKNTESWLENYRGLTTVK |
| Ga0208022_10632701 | 3300027418 | Estuarine | LKEAVPPLQTGAFLHLLDIDKIEGITKNTEGWLENFRTLTVFKQ |
| Ga0209815_11716721 | 3300027714 | Marine | HILDVMKASIPDLQAGAFLHLLDTDKIEGITKNTEGWLENFRKLTVYKK |
| Ga0208305_100183571 | 3300027753 | Estuarine | DNNEKNTILDIVKEDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK |
| Ga0208671_100888121 | 3300027757 | Estuarine | VLRASLPDLQTGAFLRQLEQDKIEGITKNTEGWLENFRGLTAVSN |
| Ga0228674_10972433 | 3300028008 | Seawater | ILDIVKEDIPDLQAGAFLHLLDNDKIEGVTKNTEGWLENFRGLTVFKK |
| (restricted) Ga0233414_102108872 | 3300028045 | Seawater | QVGAFLRFLDQDQINGITKNTEGWLETFRPLTVFNKE |
| Ga0247576_10135831 | 3300028099 | Seawater | IKSDIPNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVLKK |
| Ga0247584_11064992 | 3300028110 | Seawater | PNLQSGAFLHLLDQDKIEGITKNTEGWLENFRGLTVLKK |
| Ga0257127_10460792 | 3300028189 | Marine | DKKQKDHILDIIKSEIPDLQSGAFLHLLDQDKIEGITKNTEAWLEVFRSLTVFTK |
| Ga0256417_11549551 | 3300028233 | Seawater | IPNLQSGAFLHLLDQDKIEGLTKNTEGWLENFRGLTVIKQ |
| Ga0228646_11564962 | 3300028280 | Seawater | DVIKTPVNDLQTGAFLRMLELDGIEGITKNTEAWLENFRGLTTYKKK |
| ⦗Top⦘ |