| Basic Information | |
|---|---|
| Family ID | F086136 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MDRRRFLLTSLAGALAAPRAAEAQQAGKVARIGYLL |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 52.56 % |
| % of genes near scaffold ends (potentially truncated) | 61.26 % |
| % of genes from short scaffolds (< 2000 bps) | 63.06 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (54.054 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.216 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.225 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (37.838 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 40.62% β-sheet: 0.00% Coil/Unstructured: 59.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF04392 | ABC_sub_bind | 36.04 |
| PF02518 | HATPase_c | 3.60 |
| PF00072 | Response_reg | 2.70 |
| PF12836 | HHH_3 | 2.70 |
| PF13683 | rve_3 | 2.70 |
| PF12697 | Abhydrolase_6 | 2.70 |
| PF02371 | Transposase_20 | 1.80 |
| PF13185 | GAF_2 | 1.80 |
| PF08734 | GYD | 1.80 |
| PF13803 | DUF4184 | 1.80 |
| PF00903 | Glyoxalase | 1.80 |
| PF04020 | Phage_holin_4_2 | 0.90 |
| PF01068 | DNA_ligase_A_M | 0.90 |
| PF04865 | Baseplate_J | 0.90 |
| PF07883 | Cupin_2 | 0.90 |
| PF13531 | SBP_bac_11 | 0.90 |
| PF12840 | HTH_20 | 0.90 |
| PF13230 | GATase_4 | 0.90 |
| PF05221 | AdoHcyase | 0.90 |
| PF00296 | Bac_luciferase | 0.90 |
| PF01695 | IstB_IS21 | 0.90 |
| PF02744 | GalP_UDP_tr_C | 0.90 |
| PF13561 | adh_short_C2 | 0.90 |
| PF13191 | AAA_16 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 36.04 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.80 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 1.80 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.90 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.90 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.90 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.90 |
| COG1950 | Uncharacterized membrane protein YvlD, DUF360 family | Function unknown [S] | 0.90 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.05 % |
| Unclassified | root | N/A | 45.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01CU8MF | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300000955|JGI1027J12803_102587346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 825 | Open in IMG/M |
| 3300000956|JGI10216J12902_106968134 | All Organisms → cellular organisms → Bacteria | 2000 | Open in IMG/M |
| 3300004157|Ga0062590_102602228 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005545|Ga0070695_100885986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 720 | Open in IMG/M |
| 3300005577|Ga0068857_101191507 | Not Available | 737 | Open in IMG/M |
| 3300006847|Ga0075431_101728819 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 582 | Open in IMG/M |
| 3300009094|Ga0111539_10054943 | All Organisms → cellular organisms → Bacteria | 4735 | Open in IMG/M |
| 3300009100|Ga0075418_10635654 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300009100|Ga0075418_11833489 | Not Available | 660 | Open in IMG/M |
| 3300009147|Ga0114129_10693132 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300009147|Ga0114129_12688995 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009148|Ga0105243_10070886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2816 | Open in IMG/M |
| 3300009156|Ga0111538_12290990 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 678 | Open in IMG/M |
| 3300009168|Ga0105104_10859521 | Not Available | 530 | Open in IMG/M |
| 3300009174|Ga0105241_10522320 | Not Available | 1062 | Open in IMG/M |
| 3300009174|Ga0105241_11315961 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009792|Ga0126374_10449305 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010043|Ga0126380_10069526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1991 | Open in IMG/M |
| 3300010043|Ga0126380_10164539 | Not Available | 1441 | Open in IMG/M |
| 3300010043|Ga0126380_11439231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
| 3300010047|Ga0126382_10389168 | Not Available | 1083 | Open in IMG/M |
| 3300010047|Ga0126382_12158439 | Not Available | 535 | Open in IMG/M |
| 3300010359|Ga0126376_12949702 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300010360|Ga0126372_10142859 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300010362|Ga0126377_11220362 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300010362|Ga0126377_12457389 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010397|Ga0134124_11260876 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300010400|Ga0134122_10023951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4596 | Open in IMG/M |
| 3300012360|Ga0137375_10351533 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300012363|Ga0137390_10121437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2587 | Open in IMG/M |
| 3300012511|Ga0157332_1057276 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012922|Ga0137394_10924557 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300012948|Ga0126375_10721031 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300012971|Ga0126369_12656471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300013100|Ga0157373_10442337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 935 | Open in IMG/M |
| 3300013297|Ga0157378_12176722 | Not Available | 606 | Open in IMG/M |
| 3300013306|Ga0163162_10127692 | All Organisms → cellular organisms → Bacteria | 2650 | Open in IMG/M |
| 3300014325|Ga0163163_10801390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1005 | Open in IMG/M |
| 3300015371|Ga0132258_13533381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1070 | Open in IMG/M |
| 3300015374|Ga0132255_101802395 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300017792|Ga0163161_10694981 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300017997|Ga0184610_1054295 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300017997|Ga0184610_1179818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 702 | Open in IMG/M |
| 3300018031|Ga0184634_10256663 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 801 | Open in IMG/M |
| 3300018053|Ga0184626_10357765 | Not Available | 593 | Open in IMG/M |
| 3300018075|Ga0184632_10246377 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300018476|Ga0190274_12847875 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300019269|Ga0184644_1544947 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300020003|Ga0193739_1145609 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
| 3300021090|Ga0210377_10447125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 757 | Open in IMG/M |
| 3300022534|Ga0224452_1048359 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300025901|Ga0207688_10095364 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300025910|Ga0207684_11442127 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300025911|Ga0207654_10950153 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300025923|Ga0207681_10087139 | All Organisms → cellular organisms → Bacteria | 2221 | Open in IMG/M |
| 3300025972|Ga0207668_10321089 | Not Available | 1285 | Open in IMG/M |
| 3300026067|Ga0207678_10888333 | Not Available | 788 | Open in IMG/M |
| 3300027880|Ga0209481_10404803 | Not Available | 700 | Open in IMG/M |
| 3300027886|Ga0209486_10176059 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300027909|Ga0209382_11343492 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 721 | Open in IMG/M |
| 3300028589|Ga0247818_11190963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300028592|Ga0247822_10505616 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300028592|Ga0247822_11183542 | Not Available | 637 | Open in IMG/M |
| 3300030006|Ga0299907_10070088 | All Organisms → cellular organisms → Bacteria | 2833 | Open in IMG/M |
| 3300030006|Ga0299907_10290473 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300030619|Ga0268386_10437624 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031562|Ga0310886_10725720 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300031562|Ga0310886_10774494 | Not Available | 602 | Open in IMG/M |
| 3300031716|Ga0310813_10198521 | Not Available | 1643 | Open in IMG/M |
| 3300031720|Ga0307469_11149920 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031740|Ga0307468_100323016 | Not Available | 1135 | Open in IMG/M |
| 3300031908|Ga0310900_11472194 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300032174|Ga0307470_10298652 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300032174|Ga0307470_11078191 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300032180|Ga0307471_101982315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 730 | Open in IMG/M |
| 3300033550|Ga0247829_10657924 | Not Available | 871 | Open in IMG/M |
| 3300033551|Ga0247830_11058867 | Not Available | 647 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.22% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 11.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.21% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.31% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.70% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.90% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 2067725002 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012511 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026013 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_1649370 | 2035918004 | Soil | MHRRRFLLTSLAGAVAGPLAVEAQQAGKVARIGYLLGAARE |
| GPICC_02637900 | 2067725002 | Soil | VIDRRRFLLTSVAAALGPPGAIGAQPAEKVYRVGL |
| JGI1027J12803_1025873462 | 3300000955 | Soil | MDRRRFLLTSLAGALAAPLIADAQPAGKVRIIGFLGP |
| JGI1027J12803_1064791872 | 3300000955 | Soil | VIDRRRFLLTSLAGALAAPLAAEAQQAGKVYRVGYLGNF |
| JGI10216J12902_1069681343 | 3300000956 | Soil | MDRRRFLLTSLAGALVAPLAVGAQPSSKVWRIGILALVETRS* |
| Ga0062590_1026022282 | 3300004157 | Soil | MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGF |
| Ga0062594_1019918152 | 3300005093 | Soil | VIDRRRFLVTSVAGVLAAPLGAAAQQAGRVWRVGTLHTSSAKDE |
| Ga0073909_100474142 | 3300005526 | Surface Soil | MPHRPGMDRRRFLLTSLAGALAAPLAVDAQPAAKVVPRVGF |
| Ga0070695_1008859861 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGFLS |
| Ga0068857_1011915072 | 3300005577 | Corn Rhizosphere | MNRRRFLLTSLAGAITPRASGAQQPGKIWRIGYLSLVSGE |
| Ga0066903_1056280801 | 3300005764 | Tropical Forest Soil | VIDRRRFLLTSLAGTLAMPLTGESQQAERVYRVGLVSLGGD |
| Ga0082029_14891612 | 3300006169 | Termite Nest | VDRRRFLRTSLAGALAAPLAAEAQQAGKIARVGVLAG |
| Ga0075421_1001392237 | 3300006845 | Populus Rhizosphere | MDRRRFLLTSLAGALAAPFGVGAQQAERVYRVGLVSLGGDP |
| Ga0075431_1017288191 | 3300006847 | Populus Rhizosphere | MDRRRFLLTSMAGAVAAPRAAEAQQAAKITRMGYLLRDNDNPAAL |
| Ga0075433_105169741 | 3300006852 | Populus Rhizosphere | VDRRHFFLTSLAGALAAPIAVDAQQTPRPPRVGIVMPTPP |
| Ga0075433_107286692 | 3300006852 | Populus Rhizosphere | MIDRRRFLLTSLTSALAVPVAAGAQQAGKVYRVG* |
| Ga0111539_100549431 | 3300009094 | Populus Rhizosphere | MDRRRFLLTSLAGALAAPLAAEALRTGTVPRIGVLTLSVG |
| Ga0111539_116417643 | 3300009094 | Populus Rhizosphere | MDRRRFLLTSLVGALAAPLAAEAQPVDRIYRIGVLGVMPTPRL |
| Ga0075418_101453761 | 3300009100 | Populus Rhizosphere | MIDRRRFLLTSLAGAVAGPLAAGAQAAEKVWRIGLLVPGQPP |
| Ga0075418_106356542 | 3300009100 | Populus Rhizosphere | MGGPGDSPHYPGMDRRRFLLTSLAGAVATPRAAEAQHADRNARIGYLSL |
| Ga0075418_118334891 | 3300009100 | Populus Rhizosphere | MDRRRFLLTSLAGALIMPLGAEGQPGRVYRIGVTVATDIYY |
| Ga0114129_102098344 | 3300009147 | Populus Rhizosphere | MIDRRRFLVTSLAGALTVPLAAGAQQAGKLWRIGFLAGTTVPEFVE |
| Ga0114129_102257255 | 3300009147 | Populus Rhizosphere | VDRRRFLRILLAGAVAAPLAVEAQGADKVAKIGLLT |
| Ga0114129_106931321 | 3300009147 | Populus Rhizosphere | VDRRRFLLTSLAGALPAPLAAGAQQAGKVWRIGFLAGTTVPE |
| Ga0114129_126078801 | 3300009147 | Populus Rhizosphere | MNRRHFLLASLAGALAAPLAAEAQQAGKVYRLGFLAHSEPKTP |
| Ga0114129_126889952 | 3300009147 | Populus Rhizosphere | VDRRRFLLTSLAGVFAAPLAAEAQAAAKVPLIGFVVAGSR |
| Ga0114129_130313702 | 3300009147 | Populus Rhizosphere | MDRRRFFLTSLAWSIAAPLAAEAQEPLRVPRIGMLNVFGPEH |
| Ga0105243_100708861 | 3300009148 | Miscanthus Rhizosphere | VDRRRFLLTSLAWTLAAPFAAAAQHEGKMARVGFLAGARREM |
| Ga0111538_122909901 | 3300009156 | Populus Rhizosphere | MDRRRFLLTSLAGALAAPLAAEAQHPGKIYRIGIL* |
| Ga0105092_101120581 | 3300009157 | Freshwater Sediment | VIDRRRFLLTSLAGALAAPIVADAQQAGKVYRIGWLPPARHPDPSEPA |
| Ga0105092_103809032 | 3300009157 | Freshwater Sediment | MDRRRFLPTSLAGALAAPLAAEAQQAGKMVRLGVISA |
| Ga0105092_108102371 | 3300009157 | Freshwater Sediment | MDRRRFVLTSLGGLLAAPLATAAQQAAKPARIALVCG |
| Ga0105104_108595211 | 3300009168 | Freshwater Sediment | MDRRRFLLTSLAGALAGPVVAEAQEPGKVYRVGRLSLSDVDSTSIEA |
| Ga0105241_105223201 | 3300009174 | Corn Rhizosphere | VDRRRFLLTSLAGALAAPCFATAQQVGVMYRIGFLPF |
| Ga0105241_113159611 | 3300009174 | Corn Rhizosphere | MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRI |
| Ga0126374_104493053 | 3300009792 | Tropical Forest Soil | MERRRFLLTSLAGAVAGPLAARAQQAEKVARPTATF* |
| Ga0126380_100695262 | 3300010043 | Tropical Forest Soil | MDRRRFLLTSLAGVLAAPLAAGAQPPGKVYRVGFPS* |
| Ga0126380_101645391 | 3300010043 | Tropical Forest Soil | MDRRRFLLTSLAGALAAPLGAGAQQVARPWRLGYLSA |
| Ga0126380_114392311 | 3300010043 | Tropical Forest Soil | MDRRRFLLTSLAGAFAGPFAAEAQVAALPRIAVVFSTSP |
| Ga0126382_103891683 | 3300010047 | Tropical Forest Soil | MDRRRFLLTSLAGAFAAPLAAGAQEARKVYRIGWLAP |
| Ga0126382_121584391 | 3300010047 | Tropical Forest Soil | MDRRRFLLTSLAGTLAAPLGVGAQQTGKVLMVGTPTT |
| Ga0126376_129497021 | 3300010359 | Tropical Forest Soil | MDRRRFLLTSLAGALAAPLGAEAQQGAKVRRIGVLSPGPPF |
| Ga0126372_101428591 | 3300010360 | Tropical Forest Soil | MDRRRFLVTSLAGAVAGPLAARAQQAEKVARPTATF* |
| Ga0126377_106089732 | 3300010362 | Tropical Forest Soil | MIDRRRFLLTSLAGALVGPLAAGAQQSPKVPRIGYLSAARAE |
| Ga0126377_112203621 | 3300010362 | Tropical Forest Soil | VDRRRFLLISLTGAVTGPLAAGAQQALKTYRVGFLALAP |
| Ga0126377_124573891 | 3300010362 | Tropical Forest Soil | MDRRRFLLTSLAGALPTPLTAGAQQAGKVYRIGLIAAAPTAT |
| Ga0134128_124043831 | 3300010373 | Terrestrial Soil | MDRRRFLLTSLAGAVAAPLAAEGQGTGKVPRIGYVFVTSASDSQSVLD |
| Ga0134124_112608761 | 3300010397 | Terrestrial Soil | MDRRRFLLTLLAGAFAAPLAAGAQQAREVPRVGFLFYGSA |
| Ga0134122_100239513 | 3300010400 | Terrestrial Soil | MDRRRFLLTSLAGALAAPLASEVHAQQPSKIHRIGCLN* |
| Ga0134123_109490072 | 3300010403 | Terrestrial Soil | VIDRRRFLLTALVTLAGPHAAEAQHAGKMYRVGFLW |
| Ga0137375_103515334 | 3300012360 | Vadose Zone Soil | MHRRRFLLTSLAGALAGPLAAEAQQAGRVYRIGVLLQGSVAL |
| Ga0137390_101214372 | 3300012363 | Vadose Zone Soil | MDRRRFLLTSLAGAVAAPLAADTRRLGERARIIVR* |
| Ga0157332_10572761 | 3300012511 | Soil | VDRRRFLLTSLAGALATPLAVKAQQTGKVPKIGWLSDGVRV |
| Ga0137394_109245571 | 3300012922 | Vadose Zone Soil | VDRRRFLLTSLAGALAGPLAGQAEQAAKVARVGFLTADM |
| Ga0126375_107210311 | 3300012948 | Tropical Forest Soil | MDRRRFLLTSLAGALPVPLAAEAQQAKNIYVIGILSMAGGPSP |
| Ga0126369_126564712 | 3300012971 | Tropical Forest Soil | MDRRRFLLTSLAGALATPLAAWAQPTGKVWHIGYLGLGAR |
| Ga0157373_104423372 | 3300013100 | Corn Rhizosphere | MDRRRFLLTSLAGAVAMPFAAGCQQAGKVARIGVLG |
| Ga0157373_111218801 | 3300013100 | Corn Rhizosphere | MMDRRRFMLTSVAGALAAPLAAEAQQARRIYRVGVLEVRAV |
| Ga0157378_121767221 | 3300013297 | Miscanthus Rhizosphere | MDRRRFLLTSLAGAVAGPLAAGAQQAGKLPRIGFLSL |
| Ga0163162_101276921 | 3300013306 | Switchgrass Rhizosphere | MDRRRFLLTSLAGALAMPRASEAQQPGRMYRIGVL |
| Ga0163163_108013901 | 3300014325 | Switchgrass Rhizosphere | VDRRRFLLTSLAGAIAGPLVVEAQQAGKVHQIGFLPAG |
| Ga0132258_135333813 | 3300015371 | Arabidopsis Rhizosphere | MDRRRFLLTSLAGALAGPRAAEAQQTAKIWRIGTLHTSPEKDE |
| Ga0132255_1018023952 | 3300015374 | Arabidopsis Rhizosphere | MDRRRFLLTSLAGALAAPLTAEAQHADRVRRIGFLGQ |
| Ga0163161_106949811 | 3300017792 | Switchgrass Rhizosphere | MMDRRRFLLTSLVGSLLGAPLAAEAQQARKIPTVGFLVSQ |
| Ga0184610_10542953 | 3300017997 | Groundwater Sediment | VERRRFLLTSLAGALAAPLAAEGQQTAKVARIGYLGPTLAAN |
| Ga0184610_11798182 | 3300017997 | Groundwater Sediment | MDRRRFLLTSLAGPVGAPLAAGAQPAGKVYRVGFV |
| Ga0184634_102566631 | 3300018031 | Groundwater Sediment | VDRRSFLLTSLAGALAAPFSAEAQPAGKVPRVGVLC |
| Ga0184638_12232911 | 3300018052 | Groundwater Sediment | MDRRRFLLTSLAGAIAAPLAAEAQARKVARIGFLGGNDAS |
| Ga0184626_103577652 | 3300018053 | Groundwater Sediment | MDRRRFLLTSLACAVAAPIGAGAQQAGRLARVGELVA |
| Ga0184621_102700131 | 3300018054 | Groundwater Sediment | MDRRRFLLTSLAGALAAPLAAGAQPVSGPARIAWI |
| Ga0184632_102463772 | 3300018075 | Groundwater Sediment | MDRRRFLLTSLAGALAVPLAAGAQQAGKVPRIGFLSAG |
| Ga0190274_128478752 | 3300018476 | Soil | MINRRRFLLTSLAGALVGPLAADAQQPAGVARVGLLDP |
| Ga0184644_15449472 | 3300019269 | Groundwater Sediment | MDRRRFLLTPLAGALAVPLGAEAQQRAGKVYRIGYL |
| Ga0193739_11456092 | 3300020003 | Soil | MDRRRFLLTSLAGIAAPLAAEAQHAGTRARIGYLSLASPTATTGD |
| Ga0210377_104471251 | 3300021090 | Groundwater Sediment | VDRRRFLLTSLAGALAVPLAAEGQQAGKVARIGYLP |
| Ga0224452_10483591 | 3300022534 | Groundwater Sediment | MDRRRFLLTSLAGAFAAPLAVAAQQGSKTARVGVLVAGPPQA |
| Ga0207688_100953641 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTSVMDRRRFLLTSLAVLTAPVSVEAQQPGKIWRIGYL |
| Ga0207684_114421272 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VDRRRFLLTSLVGALPLAAGAQQARTIPVVGILHD |
| Ga0207654_109501532 | 3300025911 | Corn Rhizosphere | MDRRRFLLTSLAGILAAPLAAEGQSAGKAYRIGYLGNASA |
| Ga0207681_100871393 | 3300025923 | Switchgrass Rhizosphere | MDRRRFLLTSLAGAVAGPLAVEGQQAGKVATIGFLLNQ |
| Ga0207668_103210893 | 3300025972 | Switchgrass Rhizosphere | MDRRRFLLTSLAGAVATPLGAGAQQAGKIWRIGYLSVVSVE |
| Ga0208534_10048452 | 3300026013 | Natural And Restored Wetlands | MGRLPRRQFLLVSVAFLARSLAAEAQQAGRVYRIGYL |
| Ga0207678_108883331 | 3300026067 | Corn Rhizosphere | MDRRRFLLTSLAGTLIAPLGTEAQQAGKVYRVSFLGNSSAAL |
| Ga0209684_10166981 | 3300027527 | Tropical Forest Soil | MDRRRFVLTSLAGAFAAPLGAGAQQAAKVPRIGFLSAVT |
| Ga0209481_104048032 | 3300027880 | Populus Rhizosphere | MDRRRFLLTSLAGALAAPRAAEAQQAGKVARIGYLL |
| Ga0209486_101760592 | 3300027886 | Agricultural Soil | MNRRRFLLTSLAGALAAALTAEAQQAGKMFRVGALSSVP |
| Ga0209382_113434921 | 3300027909 | Populus Rhizosphere | MDRRRFLLTSLASALARPPTTEAQQAGRTYRLGTMIPLG |
| Ga0247818_111909632 | 3300028589 | Soil | MDRRRFLLTSLAGALAGPRAAEAQQAGKVYRIGFLSAIS |
| Ga0247822_105056161 | 3300028592 | Soil | MMDRRRFLLTSLAGALAAPLAAGAQQTAKIWRIGTLHTSSE |
| Ga0247822_111835422 | 3300028592 | Soil | MDRRRFLLTSLAGVLAAPRAAGAQQAGKVWRIGYLLLAP |
| Ga0247822_117230841 | 3300028592 | Soil | MDRRRFVLTSLAGAFAGPLAAAAQQAGKVPRIGFLSLTSP |
| Ga0299907_100700884 | 3300030006 | Soil | VDRRRFLLTSLAGALTAPPAVAAQQVQRVARVGVLAPR |
| Ga0299907_102904731 | 3300030006 | Soil | MDRRRFLLTSLAGALAGPLPAEAQQAKVARLGVLL |
| Ga0268386_104376242 | 3300030619 | Soil | MDRRRFLLTSLAGALAAPLGGEAQARKPVRVGFLSSFPNNP |
| Ga0308194_103584111 | 3300031421 | Soil | MDRRRFLLTSLAGALAAPLAAGAQQAGKVWRIGTLSLTTPAAGAPNP |
| Ga0310886_107257202 | 3300031562 | Soil | MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGFL |
| Ga0310886_107744942 | 3300031562 | Soil | MMDRRRFVLTSLAGTFAEPLAAGAQQAREVPRVGFLF |
| Ga0310813_101985211 | 3300031716 | Soil | MDRRRFLLTSLAGALAAPLGAGAQQAGKLYRIGLLGGSPP |
| Ga0307469_111499201 | 3300031720 | Hardwood Forest Soil | VDRRRFLLTSLAGALATPLVAGAQQAEKLPRVGFLSAL |
| Ga0307468_1003230161 | 3300031740 | Hardwood Forest Soil | LTPDPRLPHHPGMDRRRFLLTSLAGALAAPLAVEAQPAEKGKVYRIGFIGP |
| Ga0310900_114721941 | 3300031908 | Soil | MDRRRFLLTSLAGALAAPLASEVHAQQPSKIHRIGCLN |
| Ga0310899_103557671 | 3300032017 | Soil | MERRRFVLTSLAAALAGPLAAVAQQAGKSARIRRLTP |
| Ga0310895_103101571 | 3300032122 | Soil | MMDRRRFMLTSVAGALAAPLAAEAQQARRIYRVGVLEVRAVGSNAT |
| Ga0307470_102986521 | 3300032174 | Hardwood Forest Soil | MMDRRRFLLTSLAGALVGPLVAEAQQTGKVYRLGFL |
| Ga0307470_110781912 | 3300032174 | Hardwood Forest Soil | MDRRRFLLTSLAGALAAPLATGAQQAAKISRIAMLV |
| Ga0307471_1019823153 | 3300032180 | Hardwood Forest Soil | MDRRRFLLTSLAGPLAAEAQQAGKVPRVGILVSEPTP |
| Ga0316626_112938562 | 3300033485 | Soil | MDRRRFLLISLAGALAAPLAAEPQQAGKVYRVGFLAGISPTT |
| Ga0247829_103817554 | 3300033550 | Soil | MDRRRFLLTSLAGALAAPVGVASQQSVKSPRVGVLR |
| Ga0247829_106579241 | 3300033550 | Soil | MMDRRRFLLTSLAGALAAPLAAEALRTGTVPRIGVLTLS |
| Ga0247830_102316774 | 3300033551 | Soil | MDRRRFVLTSLAGAFAGPLAAAAQQAGKVPRIGFL |
| Ga0247830_110588672 | 3300033551 | Soil | MDRRRFLLISLAGALAAPLGAEAQQGGRIHRIGMLETRSTTLN |
| ⦗Top⦘ |