Metagenome / Metatranscriptome Family F086136

Basic Information
Family ID	F086136
Family Type	Metagenome / Metatranscriptome
Number of Sequences	111
Average Sequence Length	39 residues
Representative Sequence	MDRRRFLLTSLAGALAAPRAAEAQQAGKVARIGYLL
Number of Associated Samples	84
Number of Associated Scaffolds	111

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	52.56 %
% of genes near scaffold ends (potentially truncated)	61.26 %
% of genes from short scaffolds (< 2000 bps)	63.06 %
Associated GOLD sequencing projects	81
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Most Common Taxonomy
Group	Bacteria (54.054 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.216 % of family members)
Environment Ontology (ENVO)	Unclassified (25.225 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (37.838 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 40.62% β-sheet: 0.00% Coil/Unstructured: 59.38%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 111 Family Scaffolds
PF04392	ABC_sub_bind	36.04
PF02518	HATPase_c	3.60
PF00072	Response_reg	2.70
PF12836	HHH_3	2.70
PF13683	rve_3	2.70
PF12697	Abhydrolase_6	2.70
PF02371	Transposase_20	1.80
PF13185	GAF_2	1.80
PF08734	GYD	1.80
PF13803	DUF4184	1.80
PF00903	Glyoxalase	1.80
PF04020	Phage_holin_4_2	0.90
PF01068	DNA_ligase_A_M	0.90
PF04865	Baseplate_J	0.90
PF07883	Cupin_2	0.90
PF13531	SBP_bac_11	0.90
PF12840	HTH_20	0.90
PF13230	GATase_4	0.90
PF05221	AdoHcyase	0.90
PF00296	Bac_luciferase	0.90
PF01695	IstB_IS21	0.90
PF02744	GalP_UDP_tr_C	0.90
PF13561	adh_short_C2	0.90
PF13191	AAA_16	0.90

COG ID	Name	Functional Category	% Frequency in 111 Family Scaffolds
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	36.04
COG3547	Transposase	Mobilome: prophages, transposons [X]	1.80
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	1.80
COG0499	S-adenosylhomocysteine hydrolase	Coenzyme transport and metabolism [H]	0.90
COG1423	ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family	Replication, recombination and repair [L]	0.90
COG1484	DNA replication protein DnaC	Replication, recombination and repair [L]	0.90
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.90
COG1950	Uncharacterized membrane protein YvlD, DUF360 family	Function unknown [S]	0.90
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.90

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	54.05 %
Unclassified	root	N/A	45.95 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	54.05 %
Unclassified	root	N/A	45.95 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	54.05 %
Unclassified	root	N/A	45.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.95 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	9.91 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	8.11 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.95 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	9.91 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2.70 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.90 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.90 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.95 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	9.91 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.70 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.90 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	0.90 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.95 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	9.01 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1.80 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	0.90 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.90 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	45.95 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	9.01 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1.80 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	0.90 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	0.90 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	0.90 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2035918004\|FACENC_F56XM5W01CU8MF	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300000955\|JGI1027J12803_102587346	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	825	Open in IMG/M
3300000956\|JGI10216J12902_106968134	All Organisms → cellular organisms → Bacteria	2000	Open in IMG/M
3300004157\|Ga0062590_102602228	All Organisms → cellular organisms → Bacteria	538	Open in IMG/M
3300005545\|Ga0070695_100885986	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	720	Open in IMG/M
3300005577\|Ga0068857_101191507	Not Available	737	Open in IMG/M
3300006847\|Ga0075431_101728819	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	582	Open in IMG/M
3300009094\|Ga0111539_10054943	All Organisms → cellular organisms → Bacteria	4735	Open in IMG/M
3300009100\|Ga0075418_10635654	All Organisms → cellular organisms → Bacteria	1149	Open in IMG/M
3300009100\|Ga0075418_11833489	Not Available	660	Open in IMG/M
3300009147\|Ga0114129_10693132	All Organisms → cellular organisms → Bacteria	1310	Open in IMG/M
3300009147\|Ga0114129_12688995	All Organisms → cellular organisms → Bacteria	593	Open in IMG/M
3300009148\|Ga0105243_10070886	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	2816	Open in IMG/M
3300009156\|Ga0111538_12290990	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	678	Open in IMG/M
3300009168\|Ga0105104_10859521	Not Available	530	Open in IMG/M
3300009174\|Ga0105241_10522320	Not Available	1062	Open in IMG/M
3300009174\|Ga0105241_11315961	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300009792\|Ga0126374_10449305	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300010043\|Ga0126380_10069526	All Organisms → cellular organisms → Bacteria → Proteobacteria	1991	Open in IMG/M
3300010043\|Ga0126380_10164539	Not Available	1441	Open in IMG/M
3300010043\|Ga0126380_11439231	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	607	Open in IMG/M
3300010047\|Ga0126382_10389168	Not Available	1083	Open in IMG/M
3300010047\|Ga0126382_12158439	Not Available	535	Open in IMG/M
3300010359\|Ga0126376_12949702	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300010360\|Ga0126372_10142859	All Organisms → cellular organisms → Bacteria	1897	Open in IMG/M
3300010362\|Ga0126377_11220362	All Organisms → cellular organisms → Bacteria	823	Open in IMG/M
3300010362\|Ga0126377_12457389	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300010397\|Ga0134124_11260876	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300010400\|Ga0134122_10023951	All Organisms → cellular organisms → Bacteria → Proteobacteria	4596	Open in IMG/M
3300012360\|Ga0137375_10351533	All Organisms → cellular organisms → Bacteria	1308	Open in IMG/M
3300012363\|Ga0137390_10121437	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2587	Open in IMG/M
3300012511\|Ga0157332_1057276	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300012922\|Ga0137394_10924557	All Organisms → cellular organisms → Bacteria	727	Open in IMG/M
3300012948\|Ga0126375_10721031	All Organisms → cellular organisms → Bacteria	779	Open in IMG/M
3300012971\|Ga0126369_12656471	All Organisms → cellular organisms → Bacteria → Proteobacteria	585	Open in IMG/M
3300013100\|Ga0157373_10442337	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	935	Open in IMG/M
3300013297\|Ga0157378_12176722	Not Available	606	Open in IMG/M
3300013306\|Ga0163162_10127692	All Organisms → cellular organisms → Bacteria	2650	Open in IMG/M
3300014325\|Ga0163163_10801390	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1005	Open in IMG/M
3300015371\|Ga0132258_13533381	All Organisms → cellular organisms → Bacteria → Proteobacteria	1070	Open in IMG/M
3300015374\|Ga0132255_101802395	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300017792\|Ga0163161_10694981	All Organisms → cellular organisms → Bacteria	846	Open in IMG/M
3300017997\|Ga0184610_1054295	All Organisms → cellular organisms → Bacteria	1192	Open in IMG/M
3300017997\|Ga0184610_1179818	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	702	Open in IMG/M
3300018031\|Ga0184634_10256663	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	801	Open in IMG/M
3300018053\|Ga0184626_10357765	Not Available	593	Open in IMG/M
3300018075\|Ga0184632_10246377	All Organisms → cellular organisms → Bacteria	781	Open in IMG/M
3300018476\|Ga0190274_12847875	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300019269\|Ga0184644_1544947	All Organisms → cellular organisms → Bacteria	543	Open in IMG/M
3300020003\|Ga0193739_1145609	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	571	Open in IMG/M
3300021090\|Ga0210377_10447125	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	757	Open in IMG/M
3300022534\|Ga0224452_1048359	All Organisms → cellular organisms → Bacteria	1260	Open in IMG/M
3300025901\|Ga0207688_10095364	All Organisms → cellular organisms → Bacteria	1712	Open in IMG/M
3300025910\|Ga0207684_11442127	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300025911\|Ga0207654_10950153	All Organisms → cellular organisms → Bacteria	624	Open in IMG/M
3300025923\|Ga0207681_10087139	All Organisms → cellular organisms → Bacteria	2221	Open in IMG/M
3300025972\|Ga0207668_10321089	Not Available	1285	Open in IMG/M
3300026067\|Ga0207678_10888333	Not Available	788	Open in IMG/M
3300027880\|Ga0209481_10404803	Not Available	700	Open in IMG/M
3300027886\|Ga0209486_10176059	All Organisms → cellular organisms → Bacteria	1195	Open in IMG/M
3300027909\|Ga0209382_11343492	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	721	Open in IMG/M
3300028589\|Ga0247818_11190963	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	544	Open in IMG/M
3300028592\|Ga0247822_10505616	All Organisms → cellular organisms → Bacteria	957	Open in IMG/M
3300028592\|Ga0247822_11183542	Not Available	637	Open in IMG/M
3300030006\|Ga0299907_10070088	All Organisms → cellular organisms → Bacteria	2833	Open in IMG/M
3300030006\|Ga0299907_10290473	All Organisms → cellular organisms → Bacteria	1336	Open in IMG/M
3300030619\|Ga0268386_10437624	All Organisms → cellular organisms → Bacteria	910	Open in IMG/M
3300031562\|Ga0310886_10725720	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300031562\|Ga0310886_10774494	Not Available	602	Open in IMG/M
3300031716\|Ga0310813_10198521	Not Available	1643	Open in IMG/M
3300031720\|Ga0307469_11149920	All Organisms → cellular organisms → Bacteria	731	Open in IMG/M
3300031740\|Ga0307468_100323016	Not Available	1135	Open in IMG/M
3300031908\|Ga0310900_11472194	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	573	Open in IMG/M
3300032174\|Ga0307470_10298652	All Organisms → cellular organisms → Bacteria	1091	Open in IMG/M
3300032174\|Ga0307470_11078191	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300032180\|Ga0307471_101982315	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	730	Open in IMG/M
3300033550\|Ga0247829_10657924	Not Available	871	Open in IMG/M
3300033551\|Ga0247830_11058867	Not Available	647	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	68.47%
Host-Associated	Host-Associated	31.53%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.86%
Plants	Host-Associated → Plants	31.53%
Aquatic	Environmental → Aquatic	12.61%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	55.86%
Rhizosphere	Host-Associated → Plants → Rhizosphere	25.23%
Sediment	Environmental → Aquatic → Sediment	7.21%
Freshwater	Environmental → Aquatic → Freshwater	5.41%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.41%
Roots	Host-Associated → Plants → Roots	0.90%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	50.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	22.52%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.21%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.41%
Loam	Environmental → Terrestrial → Soil → Loam	3.60%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.60%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.70%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	1.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.80%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.90%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	22.52%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	11.71%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.21%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.41%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.50%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.60%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.70%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.70%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	1.80%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.80%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.80%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.90%

Habitat	Taxonomy	Distribution
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	16.22%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	11.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	11.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	7.21%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	6.31%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.50%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	3.60%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.60%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.70%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.70%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.80%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.80%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.80%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.80%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.90%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.90%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.90%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.90%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.90%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.90%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.90%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.90%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2035918004	Soil microbial communities from sample at FACE Site 2 North Carolina CO2-	Environmental	Open in IMG/M
2067725002	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006169	Termite nest microbial communities from Madurai, India	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009157	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009168	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012511	Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018031	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1	Environmental	Open in IMG/M
3300018052	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2	Environmental	Open in IMG/M
3300018053	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1	Environmental	Open in IMG/M
3300018054	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1	Environmental	Open in IMG/M
3300018075	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019269	Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300020003	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2	Environmental	Open in IMG/M
3300021090	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026013	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 (SPAdes)	Environmental	Open in IMG/M
3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027527	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027909	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)	Host-Associated	Open in IMG/M
3300028589	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300030619	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)	Environmental	Open in IMG/M
3300031421	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300033485	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A	Environmental	Open in IMG/M
3300033550	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4	Environmental	Open in IMG/M
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FACENCA_1649370	2035918004	Soil	MHRRRFLLTSLAGAVAGPLAVEAQQAGKVARIGYLLGAARE
GPICC_02637900	2067725002	Soil	VIDRRRFLLTSVAAALGPPGAIGAQPAEKVYRVGL
JGI1027J12803_1025873462	3300000955	Soil	MDRRRFLLTSLAGALAAPLIADAQPAGKVRIIGFLGP
JGI1027J12803_1064791872	3300000955	Soil	VIDRRRFLLTSLAGALAAPLAAEAQQAGKVYRVGYLGNF
JGI10216J12902_1069681343	3300000956	Soil	MDRRRFLLTSLAGALVAPLAVGAQPSSKVWRIGILALVETRS*
Ga0062590_1026022282	3300004157	Soil	MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGF
Ga0062594_1019918152	3300005093	Soil	VIDRRRFLVTSVAGVLAAPLGAAAQQAGRVWRVGTLHTSSAKDE
Ga0073909_100474142	3300005526	Surface Soil	MPHRPGMDRRRFLLTSLAGALAAPLAVDAQPAAKVVPRVGF
Ga0070695_1008859861	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGFLS
Ga0068857_1011915072	3300005577	Corn Rhizosphere	MNRRRFLLTSLAGAITPRASGAQQPGKIWRIGYLSLVSGE
Ga0066903_1056280801	3300005764	Tropical Forest Soil	VIDRRRFLLTSLAGTLAMPLTGESQQAERVYRVGLVSLGGD
Ga0082029_14891612	3300006169	Termite Nest	VDRRRFLRTSLAGALAAPLAAEAQQAGKIARVGVLAG
Ga0075421_1001392237	3300006845	Populus Rhizosphere	MDRRRFLLTSLAGALAAPFGVGAQQAERVYRVGLVSLGGDP
Ga0075431_1017288191	3300006847	Populus Rhizosphere	MDRRRFLLTSMAGAVAAPRAAEAQQAAKITRMGYLLRDNDNPAAL
Ga0075433_105169741	3300006852	Populus Rhizosphere	VDRRHFFLTSLAGALAAPIAVDAQQTPRPPRVGIVMPTPP
Ga0075433_107286692	3300006852	Populus Rhizosphere	MIDRRRFLLTSLTSALAVPVAAGAQQAGKVYRVG*
Ga0111539_100549431	3300009094	Populus Rhizosphere	MDRRRFLLTSLAGALAAPLAAEALRTGTVPRIGVLTLSVG
Ga0111539_116417643	3300009094	Populus Rhizosphere	MDRRRFLLTSLVGALAAPLAAEAQPVDRIYRIGVLGVMPTPRL
Ga0075418_101453761	3300009100	Populus Rhizosphere	MIDRRRFLLTSLAGAVAGPLAAGAQAAEKVWRIGLLVPGQPP
Ga0075418_106356542	3300009100	Populus Rhizosphere	MGGPGDSPHYPGMDRRRFLLTSLAGAVATPRAAEAQHADRNARIGYLSL
Ga0075418_118334891	3300009100	Populus Rhizosphere	MDRRRFLLTSLAGALIMPLGAEGQPGRVYRIGVTVATDIYY
Ga0114129_102098344	3300009147	Populus Rhizosphere	MIDRRRFLVTSLAGALTVPLAAGAQQAGKLWRIGFLAGTTVPEFVE
Ga0114129_102257255	3300009147	Populus Rhizosphere	VDRRRFLRILLAGAVAAPLAVEAQGADKVAKIGLLT
Ga0114129_106931321	3300009147	Populus Rhizosphere	VDRRRFLLTSLAGALPAPLAAGAQQAGKVWRIGFLAGTTVPE
Ga0114129_126078801	3300009147	Populus Rhizosphere	MNRRHFLLASLAGALAAPLAAEAQQAGKVYRLGFLAHSEPKTP
Ga0114129_126889952	3300009147	Populus Rhizosphere	VDRRRFLLTSLAGVFAAPLAAEAQAAAKVPLIGFVVAGSR
Ga0114129_130313702	3300009147	Populus Rhizosphere	MDRRRFFLTSLAWSIAAPLAAEAQEPLRVPRIGMLNVFGPEH
Ga0105243_100708861	3300009148	Miscanthus Rhizosphere	VDRRRFLLTSLAWTLAAPFAAAAQHEGKMARVGFLAGARREM
Ga0111538_122909901	3300009156	Populus Rhizosphere	MDRRRFLLTSLAGALAAPLAAEAQHPGKIYRIGIL*
Ga0105092_101120581	3300009157	Freshwater Sediment	VIDRRRFLLTSLAGALAAPIVADAQQAGKVYRIGWLPPARHPDPSEPA
Ga0105092_103809032	3300009157	Freshwater Sediment	MDRRRFLPTSLAGALAAPLAAEAQQAGKMVRLGVISA
Ga0105092_108102371	3300009157	Freshwater Sediment	MDRRRFVLTSLGGLLAAPLATAAQQAAKPARIALVCG
Ga0105104_108595211	3300009168	Freshwater Sediment	MDRRRFLLTSLAGALAGPVVAEAQEPGKVYRVGRLSLSDVDSTSIEA
Ga0105241_105223201	3300009174	Corn Rhizosphere	VDRRRFLLTSLAGALAAPCFATAQQVGVMYRIGFLPF
Ga0105241_113159611	3300009174	Corn Rhizosphere	MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRI
Ga0126374_104493053	3300009792	Tropical Forest Soil	MERRRFLLTSLAGAVAGPLAARAQQAEKVARPTATF*
Ga0126380_100695262	3300010043	Tropical Forest Soil	MDRRRFLLTSLAGVLAAPLAAGAQPPGKVYRVGFPS*
Ga0126380_101645391	3300010043	Tropical Forest Soil	MDRRRFLLTSLAGALAAPLGAGAQQVARPWRLGYLSA
Ga0126380_114392311	3300010043	Tropical Forest Soil	MDRRRFLLTSLAGAFAGPFAAEAQVAALPRIAVVFSTSP
Ga0126382_103891683	3300010047	Tropical Forest Soil	MDRRRFLLTSLAGAFAAPLAAGAQEARKVYRIGWLAP
Ga0126382_121584391	3300010047	Tropical Forest Soil	MDRRRFLLTSLAGTLAAPLGVGAQQTGKVLMVGTPTT
Ga0126376_129497021	3300010359	Tropical Forest Soil	MDRRRFLLTSLAGALAAPLGAEAQQGAKVRRIGVLSPGPPF
Ga0126372_101428591	3300010360	Tropical Forest Soil	MDRRRFLVTSLAGAVAGPLAARAQQAEKVARPTATF*
Ga0126377_106089732	3300010362	Tropical Forest Soil	MIDRRRFLLTSLAGALVGPLAAGAQQSPKVPRIGYLSAARAE
Ga0126377_112203621	3300010362	Tropical Forest Soil	VDRRRFLLISLTGAVTGPLAAGAQQALKTYRVGFLALAP
Ga0126377_124573891	3300010362	Tropical Forest Soil	MDRRRFLLTSLAGALPTPLTAGAQQAGKVYRIGLIAAAPTAT
Ga0134128_124043831	3300010373	Terrestrial Soil	MDRRRFLLTSLAGAVAAPLAAEGQGTGKVPRIGYVFVTSASDSQSVLD
Ga0134124_112608761	3300010397	Terrestrial Soil	MDRRRFLLTLLAGAFAAPLAAGAQQAREVPRVGFLFYGSA
Ga0134122_100239513	3300010400	Terrestrial Soil	MDRRRFLLTSLAGALAAPLASEVHAQQPSKIHRIGCLN*
Ga0134123_109490072	3300010403	Terrestrial Soil	VIDRRRFLLTALVTLAGPHAAEAQHAGKMYRVGFLW
Ga0137375_103515334	3300012360	Vadose Zone Soil	MHRRRFLLTSLAGALAGPLAAEAQQAGRVYRIGVLLQGSVAL
Ga0137390_101214372	3300012363	Vadose Zone Soil	MDRRRFLLTSLAGAVAAPLAADTRRLGERARIIVR*
Ga0157332_10572761	3300012511	Soil	VDRRRFLLTSLAGALATPLAVKAQQTGKVPKIGWLSDGVRV
Ga0137394_109245571	3300012922	Vadose Zone Soil	VDRRRFLLTSLAGALAGPLAGQAEQAAKVARVGFLTADM
Ga0126375_107210311	3300012948	Tropical Forest Soil	MDRRRFLLTSLAGALPVPLAAEAQQAKNIYVIGILSMAGGPSP
Ga0126369_126564712	3300012971	Tropical Forest Soil	MDRRRFLLTSLAGALATPLAAWAQPTGKVWHIGYLGLGAR
Ga0157373_104423372	3300013100	Corn Rhizosphere	MDRRRFLLTSLAGAVAMPFAAGCQQAGKVARIGVLG
Ga0157373_111218801	3300013100	Corn Rhizosphere	MMDRRRFMLTSVAGALAAPLAAEAQQARRIYRVGVLEVRAV
Ga0157378_121767221	3300013297	Miscanthus Rhizosphere	MDRRRFLLTSLAGAVAGPLAAGAQQAGKLPRIGFLSL
Ga0163162_101276921	3300013306	Switchgrass Rhizosphere	MDRRRFLLTSLAGALAMPRASEAQQPGRMYRIGVL
Ga0163163_108013901	3300014325	Switchgrass Rhizosphere	VDRRRFLLTSLAGAIAGPLVVEAQQAGKVHQIGFLPAG
Ga0132258_135333813	3300015371	Arabidopsis Rhizosphere	MDRRRFLLTSLAGALAGPRAAEAQQTAKIWRIGTLHTSPEKDE
Ga0132255_1018023952	3300015374	Arabidopsis Rhizosphere	MDRRRFLLTSLAGALAAPLTAEAQHADRVRRIGFLGQ
Ga0163161_106949811	3300017792	Switchgrass Rhizosphere	MMDRRRFLLTSLVGSLLGAPLAAEAQQARKIPTVGFLVSQ
Ga0184610_10542953	3300017997	Groundwater Sediment	VERRRFLLTSLAGALAAPLAAEGQQTAKVARIGYLGPTLAAN
Ga0184610_11798182	3300017997	Groundwater Sediment	MDRRRFLLTSLAGPVGAPLAAGAQPAGKVYRVGFV
Ga0184634_102566631	3300018031	Groundwater Sediment	VDRRSFLLTSLAGALAAPFSAEAQPAGKVPRVGVLC
Ga0184638_12232911	3300018052	Groundwater Sediment	MDRRRFLLTSLAGAIAAPLAAEAQARKVARIGFLGGNDAS
Ga0184626_103577652	3300018053	Groundwater Sediment	MDRRRFLLTSLACAVAAPIGAGAQQAGRLARVGELVA
Ga0184621_102700131	3300018054	Groundwater Sediment	MDRRRFLLTSLAGALAAPLAAGAQPVSGPARIAWI
Ga0184632_102463772	3300018075	Groundwater Sediment	MDRRRFLLTSLAGALAVPLAAGAQQAGKVPRIGFLSAG
Ga0190274_128478752	3300018476	Soil	MINRRRFLLTSLAGALVGPLAADAQQPAGVARVGLLDP
Ga0184644_15449472	3300019269	Groundwater Sediment	MDRRRFLLTPLAGALAVPLGAEAQQRAGKVYRIGYL
Ga0193739_11456092	3300020003	Soil	MDRRRFLLTSLAGIAAPLAAEAQHAGTRARIGYLSLASPTATTGD
Ga0210377_104471251	3300021090	Groundwater Sediment	VDRRRFLLTSLAGALAVPLAAEGQQAGKVARIGYLP
Ga0224452_10483591	3300022534	Groundwater Sediment	MDRRRFLLTSLAGAFAAPLAVAAQQGSKTARVGVLVAGPPQA
Ga0207688_100953641	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MTSVMDRRRFLLTSLAVLTAPVSVEAQQPGKIWRIGYL
Ga0207684_114421272	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	VDRRRFLLTSLVGALPLAAGAQQARTIPVVGILHD
Ga0207654_109501532	3300025911	Corn Rhizosphere	MDRRRFLLTSLAGILAAPLAAEGQSAGKAYRIGYLGNASA
Ga0207681_100871393	3300025923	Switchgrass Rhizosphere	MDRRRFLLTSLAGAVAGPLAVEGQQAGKVATIGFLLNQ
Ga0207668_103210893	3300025972	Switchgrass Rhizosphere	MDRRRFLLTSLAGAVATPLGAGAQQAGKIWRIGYLSVVSVE
Ga0208534_10048452	3300026013	Natural And Restored Wetlands	MGRLPRRQFLLVSVAFLARSLAAEAQQAGRVYRIGYL
Ga0207678_108883331	3300026067	Corn Rhizosphere	MDRRRFLLTSLAGTLIAPLGTEAQQAGKVYRVSFLGNSSAAL
Ga0209684_10166981	3300027527	Tropical Forest Soil	MDRRRFVLTSLAGAFAAPLGAGAQQAAKVPRIGFLSAVT
Ga0209481_104048032	3300027880	Populus Rhizosphere	MDRRRFLLTSLAGALAAPRAAEAQQAGKVARIGYLL
Ga0209486_101760592	3300027886	Agricultural Soil	MNRRRFLLTSLAGALAAALTAEAQQAGKMFRVGALSSVP
Ga0209382_113434921	3300027909	Populus Rhizosphere	MDRRRFLLTSLASALARPPTTEAQQAGRTYRLGTMIPLG
Ga0247818_111909632	3300028589	Soil	MDRRRFLLTSLAGALAGPRAAEAQQAGKVYRIGFLSAIS
Ga0247822_105056161	3300028592	Soil	MMDRRRFLLTSLAGALAAPLAAGAQQTAKIWRIGTLHTSSE
Ga0247822_111835422	3300028592	Soil	MDRRRFLLTSLAGVLAAPRAAGAQQAGKVWRIGYLLLAP
Ga0247822_117230841	3300028592	Soil	MDRRRFVLTSLAGAFAGPLAAAAQQAGKVPRIGFLSLTSP
Ga0299907_100700884	3300030006	Soil	VDRRRFLLTSLAGALTAPPAVAAQQVQRVARVGVLAPR
Ga0299907_102904731	3300030006	Soil	MDRRRFLLTSLAGALAGPLPAEAQQAKVARLGVLL
Ga0268386_104376242	3300030619	Soil	MDRRRFLLTSLAGALAAPLGGEAQARKPVRVGFLSSFPNNP
Ga0308194_103584111	3300031421	Soil	MDRRRFLLTSLAGALAAPLAAGAQQAGKVWRIGTLSLTTPAAGAPNP
Ga0310886_107257202	3300031562	Soil	MPRHPGMDRRRFLLTSLAGAVAGPLAAGAQQAGKVPRIGFL
Ga0310886_107744942	3300031562	Soil	MMDRRRFVLTSLAGTFAEPLAAGAQQAREVPRVGFLF
Ga0310813_101985211	3300031716	Soil	MDRRRFLLTSLAGALAAPLGAGAQQAGKLYRIGLLGGSPP
Ga0307469_111499201	3300031720	Hardwood Forest Soil	VDRRRFLLTSLAGALATPLVAGAQQAEKLPRVGFLSAL
Ga0307468_1003230161	3300031740	Hardwood Forest Soil	LTPDPRLPHHPGMDRRRFLLTSLAGALAAPLAVEAQPAEKGKVYRIGFIGP
Ga0310900_114721941	3300031908	Soil	MDRRRFLLTSLAGALAAPLASEVHAQQPSKIHRIGCLN
Ga0310899_103557671	3300032017	Soil	MERRRFVLTSLAAALAGPLAAVAQQAGKSARIRRLTP
Ga0310895_103101571	3300032122	Soil	MMDRRRFMLTSVAGALAAPLAAEAQQARRIYRVGVLEVRAVGSNAT
Ga0307470_102986521	3300032174	Hardwood Forest Soil	MMDRRRFLLTSLAGALVGPLVAEAQQTGKVYRLGFL
Ga0307470_110781912	3300032174	Hardwood Forest Soil	MDRRRFLLTSLAGALAAPLATGAQQAAKISRIAMLV
Ga0307471_1019823153	3300032180	Hardwood Forest Soil	MDRRRFLLTSLAGPLAAEAQQAGKVPRVGILVSEPTP
Ga0316626_112938562	3300033485	Soil	MDRRRFLLISLAGALAAPLAAEPQQAGKVYRVGFLAGISPTT
Ga0247829_103817554	3300033550	Soil	MDRRRFLLTSLAGALAAPVGVASQQSVKSPRVGVLR
Ga0247829_106579241	3300033550	Soil	MMDRRRFLLTSLAGALAAPLAAEALRTGTVPRIGVLTLS
Ga0247830_102316774	3300033551	Soil	MDRRRFVLTSLAGAFAGPLAAAAQQAGKVPRIGFL
Ga0247830_110588672	3300033551	Soil	MDRRRFLLISLAGALAAPLGAEAQQGGRIHRIGMLETRSTTLN

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F086136

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign