NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F086118

Metagenome Family F086118

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086118
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 46 residues
Representative Sequence MVKLFFLCRRRPDLTHDRYVERLLGGHVPLALRHHPTLRRYVVN
Number of Associated Samples 100
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.27 %
% of genes near scaffold ends (potentially truncated) 98.20 %
% of genes from short scaffolds (< 2000 bps) 96.40 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.40

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.099 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(13.514 % of family members)
Environment Ontology (ENVO) Unclassified
(25.225 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.640 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.40
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF01553Acyltransferase 18.92
PF10503Esterase_PHB 9.91
PF00027cNMP_binding 8.11
PF01694Rhomboid 7.21
PF12710HAD 5.41
PF12695Abhydrolase_5 3.60
PF03176MMPL 3.60
PF04238DUF420 2.70
PF03060NMO 1.80
PF02653BPD_transp_2 0.90
PF05494MlaC 0.90
PF01797Y1_Tnp 0.90
PF00575S1 0.90
PF14371DUF4412 0.90
PF03900Porphobil_deamC 0.90
PF13347MFS_2 0.90
PF13533Biotin_lipoyl_2 0.90
PF00403HMA 0.90
PF01741MscL 0.90
PF00107ADH_zinc_N 0.90
PF09818ABC_ATPase 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 7.21
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 3.60
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 3.60
COG2322Cytochrome oxidase assembly protein CtaM/YozB, DUF420 familyPosttranslational modification, protein turnover, chaperones [O] 2.70
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 1.80
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 1.80
COG0181Porphobilinogen deaminaseCoenzyme transport and metabolism [H] 0.90
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.90
COG1970Large-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.90
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.90
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 0.90
COG2854Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.10 %
UnclassifiedrootN/A0.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_104828447All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → Sphingopyxis alaskensis1444Open in IMG/M
3300001431|F14TB_101284189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300004463|Ga0063356_105527437All Organisms → cellular organisms → Bacteria → Proteobacteria542Open in IMG/M
3300004643|Ga0062591_101709223All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005093|Ga0062594_100192621All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1409Open in IMG/M
3300005167|Ga0066672_10643206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300005172|Ga0066683_10483519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300005178|Ga0066688_10127305All Organisms → cellular organisms → Bacteria1580Open in IMG/M
3300005180|Ga0066685_10203660All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300005328|Ga0070676_10240475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1204Open in IMG/M
3300005336|Ga0070680_100910910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales759Open in IMG/M
3300005434|Ga0070709_11209989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium607Open in IMG/M
3300005441|Ga0070700_100560272All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium889Open in IMG/M
3300005441|Ga0070700_101278291All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300005445|Ga0070708_101876612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium556Open in IMG/M
3300005451|Ga0066681_10886030All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300005468|Ga0070707_100288899All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300005536|Ga0070697_100162671All Organisms → cellular organisms → Bacteria → Proteobacteria1886Open in IMG/M
3300005536|Ga0070697_101016734All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium737Open in IMG/M
3300005546|Ga0070696_101302610All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis617Open in IMG/M
3300005552|Ga0066701_10283184All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300005552|Ga0066701_10871649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300005557|Ga0066704_10232117All Organisms → cellular organisms → Bacteria1251Open in IMG/M
3300005586|Ga0066691_10141881All Organisms → cellular organisms → Bacteria1377Open in IMG/M
3300005843|Ga0068860_100801517All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium955Open in IMG/M
3300006172|Ga0075018_10816469All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300006173|Ga0070716_100547333All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300006175|Ga0070712_101335583All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300006796|Ga0066665_11682432All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300006797|Ga0066659_10591892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria900Open in IMG/M
3300006854|Ga0075425_101568836All Organisms → cellular organisms → Bacteria → Proteobacteria742Open in IMG/M
3300009089|Ga0099828_10770152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium863Open in IMG/M
3300009090|Ga0099827_10642247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium916Open in IMG/M
3300009111|Ga0115026_10724932All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300009137|Ga0066709_101581593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium940Open in IMG/M
3300009177|Ga0105248_11437033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium780Open in IMG/M
3300010048|Ga0126373_12340933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300010301|Ga0134070_10473925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300010323|Ga0134086_10092666All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1061Open in IMG/M
3300010323|Ga0134086_10117049All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium953Open in IMG/M
3300010325|Ga0134064_10031390All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1561Open in IMG/M
3300010326|Ga0134065_10224947All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium690Open in IMG/M
3300010335|Ga0134063_10063772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1628Open in IMG/M
3300010358|Ga0126370_10963432All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300010361|Ga0126378_13406381All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300010364|Ga0134066_10314529All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300010391|Ga0136847_10673175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1192Open in IMG/M
3300010397|Ga0134124_12021434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium614Open in IMG/M
3300010403|Ga0134123_10379450All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1288Open in IMG/M
3300012200|Ga0137382_10149782All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1581Open in IMG/M
3300012209|Ga0137379_11243030All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300012922|Ga0137394_11535016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium524Open in IMG/M
3300012924|Ga0137413_10761589All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium740Open in IMG/M
3300012929|Ga0137404_11780693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300012930|Ga0137407_10659714All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium984Open in IMG/M
3300014150|Ga0134081_10007494All Organisms → cellular organisms → Bacteria2847Open in IMG/M
3300014157|Ga0134078_10236464All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium760Open in IMG/M
3300014968|Ga0157379_10673689All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium970Open in IMG/M
3300015374|Ga0132255_101758419All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium941Open in IMG/M
3300017654|Ga0134069_1302716All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium567Open in IMG/M
3300017959|Ga0187779_11196788All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300018064|Ga0187773_10232101All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria999Open in IMG/M
3300018431|Ga0066655_10256857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1119Open in IMG/M
3300018433|Ga0066667_12248475All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300018468|Ga0066662_12829540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300021432|Ga0210384_10153623All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2066Open in IMG/M
3300025310|Ga0209172_10167119All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1189Open in IMG/M
3300025910|Ga0207684_11589035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium530Open in IMG/M
3300025923|Ga0207681_10302704All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300025972|Ga0207668_12153882All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300025986|Ga0207658_10456629All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300026313|Ga0209761_1323445All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium527Open in IMG/M
3300026331|Ga0209267_1141573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium998Open in IMG/M
3300026333|Ga0209158_1236398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium628Open in IMG/M
(restricted) 3300027872|Ga0255058_10392962All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300028381|Ga0268264_10475620All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1214Open in IMG/M
3300028381|Ga0268264_10975535All Organisms → cellular organisms → Bacteria853Open in IMG/M
3300028577|Ga0265318_10122092All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia958Open in IMG/M
3300028592|Ga0247822_11498969All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium570Open in IMG/M
3300030336|Ga0247826_10740285All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300030336|Ga0247826_11162869All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300031564|Ga0318573_10566284All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300031679|Ga0318561_10422520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium733Open in IMG/M
3300031679|Ga0318561_10620534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300031682|Ga0318560_10385478All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium758Open in IMG/M
3300031713|Ga0318496_10351053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium815Open in IMG/M
3300031720|Ga0307469_10637023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium958Open in IMG/M
3300031758|Ga0315907_10663844All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300031768|Ga0318509_10131775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1370Open in IMG/M
3300031770|Ga0318521_10716331All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300031779|Ga0318566_10287448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae814Open in IMG/M
3300031797|Ga0318550_10608389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae525Open in IMG/M
3300031805|Ga0318497_10382158All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium787Open in IMG/M
3300031820|Ga0307473_10162897All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1283Open in IMG/M
3300031820|Ga0307473_10568627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium777Open in IMG/M
3300031892|Ga0310893_10383887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium612Open in IMG/M
3300031896|Ga0318551_10348613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae838Open in IMG/M
3300031954|Ga0306926_11567205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300032001|Ga0306922_11241290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300032054|Ga0318570_10431143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium601Open in IMG/M
3300032055|Ga0318575_10458323All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300032089|Ga0318525_10719230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium508Open in IMG/M
3300032160|Ga0311301_10091601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales6066Open in IMG/M
3300032177|Ga0315276_10345150All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1588Open in IMG/M
3300032180|Ga0307471_102422010All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium663Open in IMG/M
3300032180|Ga0307471_103673161All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300032180|Ga0307471_104305727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300032180|Ga0307471_104359445All Organisms → cellular organisms → Bacteria → Proteobacteria500Open in IMG/M
3300032893|Ga0335069_12119448All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium590Open in IMG/M
3300033804|Ga0314863_143382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil13.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil9.01%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.21%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.70%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.70%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.80%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.90%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.90%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.90%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.90%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.90%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.90%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.90%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.90%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300027872 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033804Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10482844733300000955SoilMPKLVFLCRRRPDLTHERYAELLLRGHVPLALRHHPTMRKYVVNVVEGL
F14TB_10128418913300001431SoilMVKLIFLCRRRPDLTHEQYVERLLQGHVPLALRHHPTMRGYVVNV
Ga0063356_10552743723300004463Arabidopsis Thaliana RhizosphereMVKLIFLCRRRPDITHERYAALLLEGHVPIALRHHPTMRRYTVNI
Ga0062591_10170922313300004643SoilMVKMMFLCRRRPDVDHARYVAMVLNDHVPLALRHHPTMRTYVVNVVDRSP
Ga0062594_10019262113300005093SoilMVKLIFLCRRRPEIGHDEYVERVLRGHVPLALRHHPTMLGYVVNIVEDTG
Ga0066672_1064320623300005167SoilMVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVVNVVEGTREPAPALD
Ga0066683_1048351923300005172SoilMVKLVFLCRRRPDLSHARYVELLLRGHVPIALAHHPTLRRYVVNVVEGTR
Ga0066688_1012730533300005178SoilMVKLVFLCRQRSDLTHERYVARLLEGHVPLALRHHPTLRRY
Ga0066685_1020366013300005180SoilMTKLFFLCHRRADLTHDEYAERLLGVHVPLALAHHPTLRRYVVNVV
Ga0070676_1024047513300005328Miscanthus RhizosphereMPKMIFLCRRRPDITHERYAELVLQGHVPLALRHHPTMRKYVVNVV
Ga0070680_10091091013300005336Corn RhizosphereMVKLVFLCRRRADLTHERYAELLLGGHVPLALRHHPTMRKYVVNLVEGLRAGA
Ga0070709_1120998923300005434Corn, Switchgrass And Miscanthus RhizosphereVVKLFFFCGRRDDLSHDAYAERLLHGHVPIALRHHPTLRRYTVNIVESS
Ga0070700_10056027223300005441Corn, Switchgrass And Miscanthus RhizosphereMLKLFFFCRRRPDITRARYAELLLDGHVPIALEHHPTMRRYVVNIVEQSPSDWQEL
Ga0070700_10127829123300005441Corn, Switchgrass And Miscanthus RhizosphereMVKLVFLCRRRPDITHETYVKRLLEGHVPLALRHHPTLRRYVVNVVEGTRGDV
Ga0070708_10187661213300005445Corn, Switchgrass And Miscanthus RhizosphereMTKLFFLCRRRADLTHEQYVERLIAGHVPLALAHHPTLRRYVVNVVE
Ga0066681_1088603023300005451SoilMVKLVFLCRRRSDLTHGRYVARLLEGHVPLALRHHPTLRRY
Ga0070707_10028889913300005468Corn, Switchgrass And Miscanthus RhizosphereMVKLVFLCRRRPDLTHEQYVARLLEGHVPLALRHHPTLRRYVVNVVEGT
Ga0070697_10016267123300005536Corn, Switchgrass And Miscanthus RhizosphereMVKLFFLCRRRPDLTHDRYVERLLGGHVPLALRHHPTLRRYVVN
Ga0070697_10101673413300005536Corn, Switchgrass And Miscanthus RhizosphereMTKLFFLCRRRADLTHEQYVERLVAGHVPLALAHHPTLRRYVVNVVEGTR
Ga0070696_10130261013300005546Corn, Switchgrass And Miscanthus RhizosphereMVKLVFLCRRRPDITHARYVELLLGGHVPLALAHHQTMRRYVVNIV
Ga0066701_1028318433300005552SoilMVKLVFLCRRRSDLTHERYVGRLLEGHVPLALRHHPTLRRYVVNIVE
Ga0066701_1087164923300005552SoilMVKLVFLCRRRPDLSHARYVELLLRGHVPIALAHHPTLRRYVVNVV
Ga0066704_1023211713300005557SoilMVKLVFLCRQRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNIVE
Ga0066691_1014188113300005586SoilMVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVVNVVEGT
Ga0068860_10080151723300005843Switchgrass RhizosphereMEKLIFLCRRRPNITHERYVELLLKGHVPIALQHHPTMRRYTVNIVEQGP
Ga0075018_1081646913300006172WatershedsMVKLMFLCRRRPELTPAQYADRLLRGHVPLALRHHATMRGYVVNL
Ga0070716_10054733313300006173Corn, Switchgrass And Miscanthus RhizosphereMVKLVFLCRRRPDVTHEQYVDMLLHGHVPLALAHHPTLRRYVVNVVEATR
Ga0070712_10133558323300006175Corn, Switchgrass And Miscanthus RhizosphereMHKLIFLCRRRSDETHERYVDWLLGEHVPLALRHHPMLRRYVVNVV
Ga0066665_1168243223300006796SoilMTKLFFLCHRRAALTHDEYAERLLGGHVPLALAHHPTLRRYVVNVVEGTR
Ga0066659_1059189223300006797SoilMLKMIFLCRRRPDATHERYVDWLLGEHVPLALRHHPTLRRYVVNVVEGT
Ga0075425_10156883613300006854Populus RhizosphereMMKLVFLCRRRPDLTHPEYAAHLLERHVPLALRHHPTLRRYVVN
Ga0099828_1077015223300009089Vadose Zone SoilMVKLVFLCRRRPDITHERYAELLLRGHVPLALRHHPALRRYVV
Ga0099827_1064224713300009090Vadose Zone SoilMVKLVFLCWRKPDLSHARYVELLLRGHVPIALSHHPTLRRYVVNVVEGTRGAGLEP
Ga0115026_1072493213300009111WetlandLHVRGVVKLIFFCRRRPDLSHGRYAELLLLGHVPLALRHHPAMRGYI
Ga0066709_10158159323300009137Grasslands SoilMTKLFFLCRRRAELTHEQYVERLIAGLVPLALAHHPTLRRYVVNVVEGTRGPAP
Ga0105248_1143703323300009177Switchgrass RhizosphereMTKLIFLCRRRPDITHERYAELVLQGHVPLALRHHP
Ga0126373_1234093313300010048Tropical Forest SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVENTGA
Ga0134070_1047392523300010301Grasslands SoilMTKLFFLCRRRGDLTHDEYVERLLGGHVPLALAHHPTLR
Ga0134086_1009266633300010323Grasslands SoilMVKVVFLCRRRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVN
Ga0134086_1011704913300010323Grasslands SoilMVKLVFLCRRRSDLTHGRYVARLLEGHVPLALRHHPT
Ga0134064_1003139013300010325Grasslands SoilMVKVVFLCRRRSDLTHERYVARLLEGHVPLALRHHPT
Ga0134065_1022494713300010326Grasslands SoilMVKLVFLCRRRSDLTHGRYVARLLEGHVPLALRHHPTLRRYVVNIVEGTRG
Ga0134063_1006377243300010335Grasslands SoilMVKVVFLCRRRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNIVE
Ga0126370_1096343223300010358Tropical Forest SoilMVKLVFLCRRRPDLTHEHYVERLLRGHVPIALAHH
Ga0126378_1340638113300010361Tropical Forest SoilMVKLIFLCRRRPDITHERYADLLLNGHVPIALRHHPTLRRYTVNI
Ga0134066_1031452923300010364Grasslands SoilMVKLVFLCRRRSDLTHERYVERLLGGHVPLAIRRHPTL
Ga0136847_1067317543300010391Freshwater SedimentVKLVFLCRRRPDLTAARYTERLLHGHVPLALRHHPTLAKYVVNLV
Ga0134124_1202143423300010397Terrestrial SoilMVKLVFLCRRRPDVTHEQYVDMLLHGHVPLALAHHSTLRR
Ga0134123_1037945013300010403Terrestrial SoilVIMVKLIFLCRRRPDLTHERYGELLLGGHVPLALRHHPTMRKYVVNLVEGLRAG
Ga0137382_1014978213300012200Vadose Zone SoilMVKLVFLCRRRPDITHERYAELLLRGHVPLALRHHPTLRRYVVNIVDDT
Ga0137379_1124303023300012209Vadose Zone SoilMVKLVFLCRRRPHITHERYAELLLGGHVPLALRHHPTLRRYVVNIVE
Ga0137394_1153501613300012922Vadose Zone SoilMVKLVFLCWRRPDISHERYVDLLLRGHVPIALAHHPTLRRYVVNVVEGTREPAPALD
Ga0137413_1076158913300012924Vadose Zone SoilMVKLLFLCRRRDGLSHPEYVERLRGRHVPLALRHHPTLRRY
Ga0137404_1178069313300012929Vadose Zone SoilMEPVVKLFFLCRRKDGLSHEAYAERLLRGHVPIALRHHPTLRRYTVNVVES
Ga0137407_1065971413300012930Vadose Zone SoilMVKLVFLCWRRPDISHERDVELLLRGHVPVALAHHP
Ga0134081_1000749413300014150Grasslands SoilMVKLVFLCRRRPDLTHERYVELLLGGHVPLALRHHPALRRYVVNI
Ga0134078_1023646413300014157Grasslands SoilMTKLFFLCRRRGDLTHDEYVERLLGGHVPLALAHHPT
Ga0157379_1067368923300014968Switchgrass RhizosphereMEKLIFLCRRRPNITHERYVELLLKGHVPIALQHHPTMRRYTVNIVEQGPP
Ga0132255_10175841923300015374Arabidopsis RhizosphereMVKLIFLCRRRPDLTHEQYVERLLEGHVPLALHHHPTMRGYVVNVVEQTGAGL
Ga0134069_130271613300017654Grasslands SoilMVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVLNVVEGTREPAPALDS
Ga0187779_1119678813300017959Tropical PeatlandMVKLIFLCRRRSDISHERYAELLLQGHVPLALEHHPTLR
Ga0187773_1023210133300018064Tropical PeatlandMVKLIFFCRRRRDISHARYTELLLTGHVPVALKHHPLMQRY
Ga0066655_1025685713300018431Grasslands SoilMTKLFFLCHRRADLTHDEYAERLLGGHVPLALAPHPALRRYVVNVVEG
Ga0066667_1224847523300018433Grasslands SoilMVKLVFLCRRRPDITHERYAELLLRGHVPLALRHHPTLRRSVVNIVQDT
Ga0066662_1282954033300018468Grasslands SoilMVKLVFLCRQRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNIVEGTRGPAPPLDS
Ga0210384_1015362343300021432SoilMVKLVFLCRRRSDLTHEQYVERLLGGHVALALRHHPTLRRYVVNIVEGTRGPTPALD
Ga0209172_1016711923300025310Hot Spring SedimentMPKLVFLCRRRPDITHERYADLLLRGHVPLALRHHPT
Ga0207684_1158903513300025910Corn, Switchgrass And Miscanthus RhizosphereMVKLIFLCRRRPDITHERYAELLLHGHVPLALRHHPTMRRYTVNIVDQGRPDEEALD
Ga0207681_1030270423300025923Switchgrass RhizosphereMVKLIFLCRRRPEIGHDEYVERVLRGHVPLALRHHPTMLGYVVNIVEDTGA
Ga0207668_1215388223300025972Switchgrass RhizosphereMRRMVKLIFLCRRRPDITHERYAELLLDGHVPIALQH
Ga0207658_1045662923300025986Switchgrass RhizosphereMRRMVKLIFLCRRRPDITHERYAELLLDGHVPIALQHHPTLRRYTVNIVERGPDS
Ga0209761_132344513300026313Grasslands SoilMVKLVFLCRRRSDLTHERYVARLLEGHVPLALRHHPTLRRYVVNI
Ga0209267_114157323300026331SoilMTKLFFLCRRRAELTHEQYVERLIAGHVPLALAHHP
Ga0209158_123639823300026333SoilMVKLVFLCWRRPDISHERYVELLLRGHVPVALAHHPTLRRYVVNVVEGTR
(restricted) Ga0255058_1039296223300027872SeawaterMLFLCRRRSGLTHDEYAHRVLQGHVPLALRHHPTLRHY
Ga0268264_1047562013300028381Switchgrass RhizosphereMEKLIFLCRRRPNITHERYVELLLKGHVPIALQHHPTMRRYTVNIVEQGPPSED
Ga0268264_1097553523300028381Switchgrass RhizosphereMRRMVKLIFLCRRRPDITHERYAELLLDGHVPIALQ
Ga0265318_1012209213300028577RhizosphereMRKLIFLCHRRPDITHERYTEQLLKSHIPIALEHHP
Ga0247822_1149896923300028592SoilMVKLLFLCRRRSDITHERYARLLLEGHVPLALRHHPTMQRYAVNIV
Ga0247826_1074028513300030336SoilMTKLIFLCRRRPDITHERYAELVLGGHVPLALRHHPTMRKYVVNVVEGFRAGA
Ga0247826_1116286923300030336SoilMVKLIFLCRRRPDIGHDEYVERVLRGHVPLALRHHPTMLG
Ga0318573_1056628413300031564SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVEDAG
Ga0318561_1042252013300031679SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHP
Ga0318561_1062053423300031679SoilMVKLIFLCRRRPDLTHEQYVERVLQGHVPLALRHHPSMR
Ga0318560_1038547823300031682SoilVVKLIFLCRRRPDLTHEQYVERVLRGHAPLALRHHPTMRGY
Ga0318496_1035105323300031713SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVV
Ga0307469_1063702313300031720Hardwood Forest SoilVVKLFFFCGRRDDLSHDAYAEQLLRGHVPIALRHHPTLRRYTVN
Ga0315907_1066384423300031758FreshwaterVRKLVFLCRRRPDLARAEYARRLLRGHVPLALRHHPTLRRYVVNVVESAAVPGSSPLD
Ga0318509_1013177513300031768SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPTM
Ga0318521_1071633113300031770SoilMVKLIFLCRRRLDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVEDAGAGL
Ga0318566_1028744813300031779SoilMVKLLFLCRRRPDIDHDRYVALLLGGHVPIALRHHPTMRKYVVNVVERAQDGLP
Ga0318550_1060838923300031797SoilMVKLLFLCRRRPDIDHDRYVALLLGGHVPIALRHHPTMRKYVVNVVERGQPV
Ga0318497_1038215823300031805SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPTMRGYVVNVV
Ga0307473_1016289723300031820Hardwood Forest SoilMVRLVFLCRRRPDIGHDRYVECLLHGHVPIALAHHPTLRRYVVNVVEE
Ga0307473_1056862713300031820Hardwood Forest SoilVVKLFFFCGRRDDLSHDAYAEQLLRGHVPIALRHHPTLRRYTVNIVESSSPGSPPV
Ga0310893_1038388713300031892SoilMPKLIFLCRRRPDITHERYAELVLGGHVPLALRHH
Ga0318551_1034861313300031896SoilMVKLLFLCRRRPDIDHDRYVALLLGGHVPIALRHHPT
Ga0306926_1156720523300031954SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVEDTGAGLEP
Ga0306922_1124129023300032001SoilMVKLIFLCRRRPELTSEQYAERLLRGHVPLALRHHHPAM
Ga0318570_1043114323300032054SoilVVKLIFLCRRRPDLTHEQYVERVLRGHVPLALRHHPTMRGYVVNVVEEASAGLE
Ga0318575_1045832323300032055SoilVVKLIFLCRRRPDLTHEQYVERVLRGHVPLALRHHPTMRGYVVNVVEEAGA
Ga0318525_1071923013300032089SoilMVKLIFLCRRRPDLTHDQYVERVLQGHVPLALRHHPAMRGYVVNVVED
Ga0310895_1073074713300032122SoilMVKMMFLCRRRPDVDHARYVAMVLSDHVPLALRHHPTMRTYVVNVVDRSPTGWPE
Ga0311301_1009160113300032160Peatlands SoilMATIPMVKLIFLCRRRPDITHAHYAERLLSGHVPIAL
Ga0315276_1034515023300032177SedimentVVKLVFLCRRRADLTHDRYAELVLDGHVPLALRHHPAMRK
Ga0307471_10242201023300032180Hardwood Forest SoilMVKLCFLCRRRPDITHEIYVRRLLDGHVPIALRHHPTLRRYTVNIVETPHAG
Ga0307471_10367316123300032180Hardwood Forest SoilMRRMVKLIFLCRRRPDITHERYTELLLDGHVPIALQHHPT
Ga0307471_10430572723300032180Hardwood Forest SoilMRKLIFLCRRRADIDHQQYAKLLVEGHIPIALKHHPA
Ga0307471_10435944513300032180Hardwood Forest SoilMEKLIFLCRRRPDITHERYADLLLGGHVPLALRHHPAMQGYVV
Ga0335069_1211944823300032893SoilMVKLVFLCRRRPDIDHARYAELLLHGHVPLALRHHPTLRRYVVNVVEQG
Ga0314863_143382_334_5133300033804PeatlandLTASQRFRQSQGMVKLIFLCRRRPDLTHEQYVERLRRGHVPIALRHHPAMRRYTVNIVDQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.