NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F086092

Metagenome / Metatranscriptome Family F086092

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F086092
Family Type Metagenome / Metatranscriptome
Number of Sequences 111
Average Sequence Length 42 residues
Representative Sequence MRVLILSHRDVVAALPPQACAESMAAVLAARARGETYMPLR
Number of Associated Samples 100
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.43 %
% of genes near scaffold ends (potentially truncated) 94.59 %
% of genes from short scaffolds (< 2000 bps) 86.49 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.595 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(34.234 % of family members)
Environment Ontology (ENVO) Unclassified
(36.937 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.550 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.33%    β-sheet: 0.00%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF00248Aldo_ket_red 85.59
PF12902Ferritin-like 3.60
PF01522Polysacc_deac_1 0.90
PF07883Cupin_2 0.90
PF04525LOR 0.90
PF00081Sod_Fe_N 0.90
PF07690MFS_1 0.90
PF00296Bac_luciferase 0.90
PF10901DUF2690 0.90
PF03807F420_oxidored 0.90
PF00440TetR_N 0.90
PF01546Peptidase_M20 0.90
PF00300His_Phos_1 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG0605Superoxide dismutaseInorganic ion transport and metabolism [P] 0.90
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.90
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.90
COG4894Putative phospholipid scramblase YxjI, Tubby2 superfamilyLipid transport and metabolism [I] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.59 %
UnclassifiedrootN/A5.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005467|Ga0070706_100392119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821292Open in IMG/M
3300005617|Ga0068859_101528866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082737Open in IMG/M
3300005713|Ga0066905_100175732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1574Open in IMG/M
3300005764|Ga0066903_104548794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300006102|Ga0075015_100914430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082533Open in IMG/M
3300006173|Ga0070716_100484939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082909Open in IMG/M
3300006173|Ga0070716_100514510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria886Open in IMG/M
3300006755|Ga0079222_10127260All Organisms → cellular organisms → Bacteria1400Open in IMG/M
3300006804|Ga0079221_10758726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082687Open in IMG/M
3300006804|Ga0079221_11594753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082528Open in IMG/M
3300006893|Ga0073928_11209409All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300009038|Ga0099829_10671302All Organisms → cellular organisms → Bacteria861Open in IMG/M
3300009088|Ga0099830_11479019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia565Open in IMG/M
3300009523|Ga0116221_1028657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2790Open in IMG/M
3300010046|Ga0126384_10199148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1584Open in IMG/M
3300010046|Ga0126384_10519787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1029Open in IMG/M
3300010322|Ga0134084_10391165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300010398|Ga0126383_10141899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2226Open in IMG/M
3300012924|Ga0137413_10899928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300013308|Ga0157375_10473711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1417Open in IMG/M
3300014150|Ga0134081_10371391All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300016294|Ga0182041_10620817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia951Open in IMG/M
3300016319|Ga0182033_11927297All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300016341|Ga0182035_11337759All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300016404|Ga0182037_10985966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia734Open in IMG/M
3300017937|Ga0187809_10030997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1709Open in IMG/M
3300017939|Ga0187775_10420890All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300017973|Ga0187780_11372209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300017974|Ga0187777_10671582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.734Open in IMG/M
3300020581|Ga0210399_10122133All Organisms → cellular organisms → Bacteria2141Open in IMG/M
3300021377|Ga0213874_10273512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.629Open in IMG/M
3300021402|Ga0210385_10207088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1428Open in IMG/M
3300021404|Ga0210389_10717101All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria783Open in IMG/M
3300021433|Ga0210391_10892607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300021477|Ga0210398_10119665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2140Open in IMG/M
3300021560|Ga0126371_10986455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia984Open in IMG/M
3300021560|Ga0126371_13011814All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300021861|Ga0213853_10336939All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia738Open in IMG/M
3300024323|Ga0247666_1107244All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025574|Ga0208717_1080131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300025903|Ga0207680_11107183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300025929|Ga0207664_10906941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia791Open in IMG/M
3300026095|Ga0207676_10151630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1997Open in IMG/M
3300026306|Ga0209468_1195316All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300026340|Ga0257162_1050073All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300027497|Ga0208199_1008262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2499Open in IMG/M
3300027604|Ga0208324_1011097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2919Open in IMG/M
3300027765|Ga0209073_10054259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1323Open in IMG/M
3300027869|Ga0209579_10063022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1964Open in IMG/M
3300028072|Ga0247675_1043850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300028138|Ga0247684_1079747All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300028379|Ga0268266_10914398All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300028747|Ga0302219_10277413All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300028787|Ga0307323_10215318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300028819|Ga0307296_10124633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1386Open in IMG/M
3300028828|Ga0307312_10528902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria779Open in IMG/M
3300029910|Ga0311369_11420533All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300030503|Ga0311370_10491559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821507Open in IMG/M
3300030520|Ga0311372_10249307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2879Open in IMG/M
3300030580|Ga0311355_10141465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2602Open in IMG/M
3300030617|Ga0311356_10355312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1456Open in IMG/M
3300030618|Ga0311354_10433569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1317Open in IMG/M
3300031525|Ga0302326_13725056All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031564|Ga0318573_10197517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1066Open in IMG/M
3300031572|Ga0318515_10448921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.689Open in IMG/M
3300031572|Ga0318515_10474473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.668Open in IMG/M
3300031572|Ga0318515_10562207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.607Open in IMG/M
3300031668|Ga0318542_10451864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia666Open in IMG/M
3300031713|Ga0318496_10184331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1145Open in IMG/M
3300031747|Ga0318502_10170415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1249Open in IMG/M
3300031764|Ga0318535_10348301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia662Open in IMG/M
3300031779|Ga0318566_10064819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1757Open in IMG/M
3300031780|Ga0318508_1206078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.563Open in IMG/M
3300031798|Ga0318523_10003038All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5946Open in IMG/M
3300031799|Ga0318565_10582447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.538Open in IMG/M
3300031821|Ga0318567_10242618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1011Open in IMG/M
3300031832|Ga0318499_10248036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300031846|Ga0318512_10272492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia838Open in IMG/M
3300031859|Ga0318527_10210544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia824Open in IMG/M
3300031880|Ga0318544_10118987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1003Open in IMG/M
3300031910|Ga0306923_10862863All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia994Open in IMG/M
3300031910|Ga0306923_11945542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.599Open in IMG/M
3300031912|Ga0306921_10774821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1097Open in IMG/M
3300031912|Ga0306921_11251186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia824Open in IMG/M
3300031945|Ga0310913_11061884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia566Open in IMG/M
3300031954|Ga0306926_11612116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia744Open in IMG/M
3300031959|Ga0318530_10243935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300031996|Ga0308176_10211804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1831Open in IMG/M
3300032001|Ga0306922_11122558All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia804Open in IMG/M
3300032001|Ga0306922_12010532All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300032025|Ga0318507_10434563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.571Open in IMG/M
3300032041|Ga0318549_10482616All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300032043|Ga0318556_10064237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1803Open in IMG/M
3300032044|Ga0318558_10460036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.634Open in IMG/M
3300032044|Ga0318558_10642715All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.530Open in IMG/M
3300032060|Ga0318505_10595391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.520Open in IMG/M
3300032065|Ga0318513_10376314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp.692Open in IMG/M
3300032068|Ga0318553_10305481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria832Open in IMG/M
3300032076|Ga0306924_10474674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1427Open in IMG/M
3300032089|Ga0318525_10102454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1459Open in IMG/M
3300032089|Ga0318525_10508208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300032783|Ga0335079_12203610All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300033158|Ga0335077_10322725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1682Open in IMG/M
3300033433|Ga0326726_12508296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300033544|Ga0316215_1016342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia747Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil34.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.81%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.21%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.50%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.70%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.70%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.70%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.80%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.80%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.80%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.90%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.90%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.90%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.90%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.90%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021377Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300025574Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028072Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16EnvironmentalOpen in IMG/M
3300028138Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033544Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070706_10039211923300005467Corn, Switchgrass And Miscanthus RhizosphereMRVLVLSHRAVLAALSAGECAEAMAAVLAEHARGETYMPLRSVMMP
Ga0070734_1034470913300005533Surface SoilVLVLSHDDVLAALPPEECAQAMADVLAAHARSEAQMPLRTVWAPPDAAGLVG
Ga0068859_10152886613300005617Switchgrass RhizosphereMRVLVLSHRDVLAALQPDACAAAMAAALAGHVRGESYMPLRSVMMPPDAPGFM
Ga0066905_10017573213300005713Tropical Forest SoilMRVLVLSHRDVVAALPPRACAESMAAVLAARARGE
Ga0066903_10454879423300005764Tropical Forest SoilMRVLTLSHRDVLAALQPEECAAAMATVLAEHARGGTYLPLRSVMAPPGAA
Ga0075015_10091443023300006102WatershedsMRVLVLSHRDVVAALPPRACAEAMAAVLTARARGETYHPL
Ga0070716_10048493913300006173Corn, Switchgrass And Miscanthus RhizosphereMRVLVLSHRDVLAALPPQACAAAMAAALAGHARGESYMPLRSVMMPP
Ga0070716_10051451013300006173Corn, Switchgrass And Miscanthus RhizosphereMRVLVLSHRDVLAALQPDACAAAMAAALAGHARGESYMPLRSVMM
Ga0079222_1012726033300006755Agricultural SoilMRVLVLSHRDVVTALPPQACAESMAAVLAARARGETHMPLRSI
Ga0079221_1075872623300006804Agricultural SoilMRVLILSHRDVLDALQPGPCADAMAAVLAGHARGETF
Ga0079221_1159475313300006804Agricultural SoilMRVLILSHHDVVAALPPRACAEAMAAVLAARARGET
Ga0073928_1120940913300006893Iron-Sulfur Acid SpringMRVLILSHRDVVAALAPRACAESMAAVLAARARGETHMPLR
Ga0099829_1067130233300009038Vadose Zone SoilMRVLVLSHRDVVAALLPKACAESMAAVLAARALRP
Ga0099830_1147901913300009088Vadose Zone SoilMRVLVLSHRDVVAALLPKACAESMAAVLAARARGETHMPLRS
Ga0116221_102865713300009523Peatlands SoilMRALVLSHREVLAALPVEACAHAMGAVLTEHARGGTYMPLRSVM
Ga0126384_1019914813300010046Tropical Forest SoilMPVLILSHDDVHAALPPDACAEAMAAVLAEHARGATYLPLRSV
Ga0126384_1051978723300010046Tropical Forest SoilMRVLILSHSDVEAALPPEACAEAMAAVLAEHARGATYLP
Ga0134084_1039116513300010322Grasslands SoilMRVLVLGHRDVLDALSPQACADAMAAVLAGHARGESFLPLRSVMAPPGAAG
Ga0134128_1232446013300010373Terrestrial SoilMRVLILSHDDVHKALTPEECADAMAAVLAGLARGEAFMPLHS
Ga0134126_1151815513300010396Terrestrial SoilMRVLTLSNADIHAALPPAECELAMAAVLAARARGDAFNPLRTVTVPP
Ga0126383_1014189933300010398Tropical Forest SoilMPVLILSHRDVLAALPPQACAEAMAAVLAAHARGET
Ga0137413_1089992823300012924Vadose Zone SoilMKVLVLSHRDVLAALQPDACAAAMAAVLAGHARGETFMPLRSVMMP
Ga0157375_1047371113300013308Miscanthus RhizosphereMRVLVLSHRDVLAALQPEACVAAMAAVLARHARGETFMPLRSV
Ga0134081_1037139113300014150Grasslands SoilMRVLVLSHRDVVAALSPRACAEAMAAVLAARARDETYHPLRTVMRP
Ga0182041_1062081723300016294SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIMA
Ga0182033_1192729723300016319SoilMRVLILSHRDVAAALPPQACAEAMAAVLTARARGETYH
Ga0182035_1133775923300016341SoilMPVLILSHRDVLAALPPGKCAAAMTAVLAAHGRGETY
Ga0182037_1098596613300016404SoilMRVLILSHRDVLAALTPQRCAEAMAEVLAAQARGETYLPLRSLMVPPG
Ga0187809_1003099713300017937Freshwater SedimentMRALVLGHREVLAALPLEACAQAMTKVLTEQARGGTYMPLRSVMMAPGAAGFL
Ga0187775_1042089023300017939Tropical PeatlandMRVLILSHSDVEAALPPGACAEAMAAVLAEHARGATYLPLRSVIKP
Ga0187776_1116946823300017966Tropical PeatlandVRVLILSHADVHAALTPEECADAMASVLAAHARGE
Ga0187780_1137220923300017973Tropical PeatlandMLILTHGDVLAALPPSDCAAAMAEVLEARARGETYMPLR
Ga0187777_1067158213300017974Tropical PeatlandMLILTHDDVLTVLPPSDCAAAMAEVLEARARGETYMPLRTV
Ga0187822_1033003213300017994Freshwater SedimentVRVLTLSNADIHAALTPADCERAMAGVLAARARGDAYNPLRTVTFPPGAAG
Ga0210399_1012213333300020581SoilMRLLVLSHRDVLAALSPQACAEAMAAVLAGHARGETFMP
Ga0213874_1027351223300021377Plant RootsMLVLSHDDVVAALPPEDCAEAMAEVLAARARGETYMP
Ga0210385_1020708813300021402SoilMRVLLLSHRDVLAALPPEACAEAMAAVLAAHARGETYM
Ga0210389_1071710123300021404SoilMRVLVLSHRDTLAALPAAACAEAMAEVLVARARGEAYLPLRSVM
Ga0210391_1089260723300021433SoilMSVLILNHDDVHAALEPEECERAMAAVLTAHGRGEAYFPLR
Ga0210398_1011966513300021477SoilMRVLVLSHQDVAAALPPRACAEAMAAVLTAQARGE
Ga0126371_1098645513300021560Tropical Forest SoilMRVLILSHRDVVAALPPHACAEGMAAVLAARARGETYHPLRTVMR
Ga0126371_1301181423300021560Tropical Forest SoilMRVLVLSHRDVLAALPPSACAEAMAAALAAHARGGSFMPLRSVMAPPG
Ga0213853_1033693913300021861WatershedsMRVLILSHSDVLAALTPVACAEAMAAVLAGHASGETFMPLRSV
Ga0247666_110724423300024323SoilMRVLVLSHRDVLAALQPDACAAAMAAALAGHARGESYMPLRSVMMPPDAPGFMGL
Ga0208717_108013113300025574Arctic Peat SoilMGVLILSYADVAAALATDECERAMASVLAARARGGAFNPLRSVTAP
Ga0207680_1110718323300025903Switchgrass RhizosphereMGVLILGHDDVYAALPPEVCAEAMAAVLAEHARGGTYL
Ga0207700_1079297713300025928Corn, Switchgrass And Miscanthus RhizosphereMRVLTLSNADIHAALPPAECEQAMAAVLAARARGDAFN
Ga0207664_1090694113300025929Agricultural SoilMRVLVLSHRDILAALRPQACAEAMAAVLAGHARGETFMPLRS
Ga0207676_1015163033300026095Switchgrass RhizosphereMRVLVLSHRDILAALRPQACAEAMAAVLAGHARGETFMP
Ga0209468_119531623300026306SoilMRVLVLSHRDVVAALSPRACAEAMAAVLAARARDE
Ga0257162_105007323300026340SoilMRVLILSHRDVEAALPPEACAEAMAAVLAEHARGGTYLPLRT
Ga0208199_100826213300027497Peatlands SoilMRVLVLSHRDVLAALTPQACADAMAAVLAEHASGG
Ga0208324_101109713300027604Peatlands SoilMRVLVLSHRDVLAALTPQACADAMAAVLAEHASGGTYLPLR
Ga0209073_1005425933300027765Agricultural SoilMQVLVLSHRDILAALRPQACAEAMAAVLAGHARGETFMP
Ga0209579_1006302213300027869Surface SoilMRALVLGHREVLAALPLEACAHAMGAVLTEHARGGTYMP
Ga0247675_104385023300028072SoilMRVLVLSHRDVLAALQPDACAAAMAAALAGHARGESYMPLRSVMMPPDAPG
Ga0247684_107974723300028138SoilMGVLILSHDDVYAALPPEACAEAMAAVLAEHAQGATYLPLRS
Ga0268266_1091439833300028379Switchgrass RhizosphereMRVLVLSHRDVLAALQPDACASAMAAALAGHARGESYMPL
Ga0302219_1027741323300028747PalsaMGVLVLSHDDVRAALTPAACIEAMAEVLAAHARGDAYMPLRSVMR
Ga0307323_1021531813300028787SoilMRVLTLSHRDVLAALSPEDCAEAMAAVLAEHARGGT
Ga0307296_1012463313300028819SoilMRVLTLSHRDVLAALSPEDCAEAMAAVLAEHARGG
Ga0307312_1052890223300028828SoilMRVLILSHRDVLAALSPEACAGAMTAVLAERARGE
Ga0311369_1142053313300029910PalsaMRVLVLSHDDVLAALPPADCAAAMAEVLGAHARGEAF
Ga0311370_1049155913300030503PalsaMRVLVLSHDDVLAALPPAECAAAMAEVLAAHARDEAFMPLRSVMMPP
Ga0311372_1024930713300030520PalsaMRVLVLSHDDVLAALPPAECAAAMAEVLAAHARDEAFMPLR
Ga0311355_1014146513300030580PalsaMRVLVLSHEDVRETLTPAACLEAMAEVLAALARGEAYMPLRS
Ga0311356_1035531233300030617PalsaMRVLVLSHADVHAALAPPDCELAMAEVLAARARGEAYMPLRSVMMPPGAS
Ga0311354_1043356933300030618PalsaMRVLVLSHEDVRETLTPAACLEAMAEVLAALARGEAY
Ga0302326_1372505623300031525PalsaMRVLMLSHADVHAALAPAECESAMAAVLAARARGEAYMPLRSVMMPPGAAGFM
Ga0318573_1019751713300031564SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHM
Ga0318515_1044892113300031572SoilMRVLVLSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIMAAPGAAGF
Ga0318515_1047447323300031572SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIMAAPGAAGF
Ga0318515_1056220723300031572SoilMRVLVLSHRDVVAALPPKTCAESMAAVLAARARGETHM
Ga0318542_1045186423300031668SoilMRVLVLSHRDVLAALLPEACAEAMAAVLAGHARGE
Ga0318496_1018433123300031713SoilMRVLVLSHRDVLAALTPDACAEAMAAVLAGHARGETFM
Ga0318502_1017041523300031747SoilMRVLVLSHRDVVAALPPAACAESMAAVLAARARGETHMPLRSIMAPSG
Ga0318535_1034830123300031764SoilMPVLILSHRDVLAALPPDKCAAAMAAILAAHGRGETYQ
Ga0318566_1006481913300031779SoilMRVLILSHRDVVAALPPRACAESMAAVLAARARGETYMPLRSI
Ga0318508_120607813300031780SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIMAAPGAAGV
Ga0318523_1000303813300031798SoilMRVLVLSHRDVLAALLPEACAEAMAAVLAGHARGETFMPLRSVM
Ga0318565_1058244723300031799SoilMRVLVLSHRDVVAALPPRACAESMAAVLAARARGETH
Ga0318567_1024261813300031821SoilMRVLVLSHRDVLAALSPEACAEAMAAVLAGHARGETF
Ga0318499_1024803613300031832SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPPRVPP
Ga0318512_1027249223300031846SoilMRVLILSHRDVVAALPPQACAESMAAVLAARARGETYMPLR
Ga0318527_1021054423300031859SoilMRVLVLSHGDVVAALPPRACAESMAAVLAARARGETYMPLRSIMAAPG
Ga0318544_1011898713300031880SoilMRVLVLSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIMAA
Ga0306923_1086286313300031910SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIMAAPGA
Ga0306923_1194554213300031910SoilMRVLVLSHGDVVAALPPRACAESMAAVLAARARGETYMPL
Ga0306921_1077482113300031912SoilMRVLILSHNDVEAALPPGACAEAMAAVLAEHARGATYLPLR
Ga0306921_1125118623300031912SoilMRVLILSHRDVLAALTPHGCAEAMAEVLAAQARGEAYLPLRSLMVPPGVAG
Ga0310913_1106188423300031945SoilMRVLILSHRDVVAALPPRACAESMAAVLAARARGETYM
Ga0306926_1161211623300031954SoilMRVLILSHRDVVAALPPRACAEAMAAVLAARARGET
Ga0318530_1024393523300031959SoilMRVLVLSHRDVVAALPPAACAESMAAVLAARARGETHMPL
Ga0308176_1021180413300031996SoilMRVLVLSHRDVLAALRPRPCAEAMAAVLAGHARGETH
Ga0306922_1112255823300032001SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGE
Ga0306922_1201053223300032001SoilMRVLILSHRDVLAALTPHGCAEAMAEVLAAQARGEAYLPLRSLMV
Ga0318507_1043456313300032025SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIM
Ga0318549_1048261623300032041SoilMRVLILSHRDVLAALTPHGCAEAMAEVLAAQARGEAYLPLRSLMVPPG
Ga0318556_1006423713300032043SoilMRVLVLSHRDVLAALPPQACAESMAAVLAARARGETHMPL
Ga0318558_1046003623300032044SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSLMAAP
Ga0318558_1064271513300032044SoilMRVLILSHRDVVAALPPQACAESMAAVLAARARGETYMPLRSI
Ga0318505_1059539123300032060SoilMRVLVLSHGDVVAALPPRACAESMAAVLAARARGETYMPLRSI
Ga0318513_1037631413300032065SoilMRVLILSHRDVLAALPPQACAESMAAVLAARARGETHMPLRSIMAAPGAAG
Ga0318553_1030548113300032068SoilMRVLVLSHRDVVAALPPQACAESMAAVLAARARGETHMPLCEFQLA
Ga0306924_1047467413300032076SoilMRVLVLSHRDVVAALPPKTCAESMAAVLAARARGETH
Ga0318525_1010245433300032089SoilMRVLILSHRDVVAALPPRACAESMAAVLAARARGETYMPLR
Ga0318525_1050820823300032089SoilMGVLILSHSDVEAALPPGACAEAMAAVLAEHARGA
Ga0335079_1220361013300032783SoilMHVLILSHRDVHAALPPEACAEAMAAVLAEHARGAT
Ga0335077_1032272533300033158SoilMHVLILSHRDVHAALPPEACAEAMAAVLAEHARGATYLPLRSV
Ga0326726_1250829613300033433Peat SoilMRVLVLSHGDVVTALPPGECAAAMAAVLTAHGRGETYM
Ga0316215_101634223300033544RootsMRVLVLSHSDVLAALPAAACAEAMAEVLAARARGEAYGPLRSVMI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.