| Basic Information | |
|---|---|
| Family ID | F086060 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MPNNYDNRVLGRRNARQLSAEEFQKILGQGKPQMTQLPSIPFHPDF |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 84.68 % |
| % of genes near scaffold ends (potentially truncated) | 21.62 % |
| % of genes from short scaffolds (< 2000 bps) | 77.48 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.162 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (18.919 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.126 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.550 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.51% β-sheet: 0.00% Coil/Unstructured: 86.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00291 | PALP | 9.91 |
| PF01471 | PG_binding_1 | 3.60 |
| PF00930 | DPPIV_N | 2.70 |
| PF00704 | Glyco_hydro_18 | 1.80 |
| PF12680 | SnoaL_2 | 1.80 |
| PF00107 | ADH_zinc_N | 1.80 |
| PF13589 | HATPase_c_3 | 1.80 |
| PF11941 | DUF3459 | 1.80 |
| PF00593 | TonB_dep_Rec | 0.90 |
| PF04390 | LptE | 0.90 |
| PF16491 | Peptidase_M48_N | 0.90 |
| PF03030 | H_PPase | 0.90 |
| PF05985 | EutC | 0.90 |
| PF04679 | DNA_ligase_A_C | 0.90 |
| PF01872 | RibD_C | 0.90 |
| PF01649 | Ribosomal_S20p | 0.90 |
| PF12704 | MacB_PCD | 0.90 |
| PF13147 | Obsolete Pfam Family | 0.90 |
| PF02810 | SEC-C | 0.90 |
| PF08240 | ADH_N | 0.90 |
| PF11185 | DUF2971 | 0.90 |
| PF13503 | DUF4123 | 0.90 |
| PF08335 | GlnD_UR_UTase | 0.90 |
| PF13460 | NAD_binding_10 | 0.90 |
| PF01212 | Beta_elim_lyase | 0.90 |
| PF13414 | TPR_11 | 0.90 |
| PF03372 | Exo_endo_phos | 0.90 |
| PF07969 | Amidohydro_3 | 0.90 |
| PF00128 | Alpha-amylase | 0.90 |
| PF13377 | Peripla_BP_3 | 0.90 |
| PF13603 | tRNA-synt_1_2 | 0.90 |
| PF00578 | AhpC-TSA | 0.90 |
| PF00155 | Aminotran_1_2 | 0.90 |
| PF04879 | Molybdop_Fe4S4 | 0.90 |
| PF07228 | SpoIIE | 0.90 |
| PF02384 | N6_Mtase | 0.90 |
| PF13857 | Ank_5 | 0.90 |
| PF05368 | NmrA | 0.90 |
| PF04255 | DUF433 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 2.70 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 2.70 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.80 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.90 |
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.90 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.90 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.90 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.90 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.90 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.90 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.90 |
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.90 |
| COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.90 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.90 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.90 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.90 |
| COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.90 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.90 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.90 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.90 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.90 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.90 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.90 |
| COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.90 |
| COG0268 | Ribosomal protein S20 | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.90 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.90 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.90 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.16 % |
| Unclassified | root | N/A | 37.84 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10002909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4624 | Open in IMG/M |
| 3300001686|C688J18823_10000019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 124627 | Open in IMG/M |
| 3300003321|soilH1_10267032 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300004479|Ga0062595_100749513 | Not Available | 794 | Open in IMG/M |
| 3300004479|Ga0062595_100923936 | Not Available | 738 | Open in IMG/M |
| 3300004800|Ga0058861_12044362 | Not Available | 692 | Open in IMG/M |
| 3300004803|Ga0058862_10615774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300004803|Ga0058862_12789090 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
| 3300005329|Ga0070683_100021952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 5699 | Open in IMG/M |
| 3300005332|Ga0066388_100184270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2699 | Open in IMG/M |
| 3300005332|Ga0066388_101876489 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300005336|Ga0070680_100478319 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005336|Ga0070680_100889738 | Not Available | 768 | Open in IMG/M |
| 3300005341|Ga0070691_10715359 | Not Available | 602 | Open in IMG/M |
| 3300005345|Ga0070692_10551419 | Not Available | 755 | Open in IMG/M |
| 3300005345|Ga0070692_10985238 | Not Available | 588 | Open in IMG/M |
| 3300005434|Ga0070709_10236348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis | 1310 | Open in IMG/M |
| 3300005434|Ga0070709_10468855 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 951 | Open in IMG/M |
| 3300005435|Ga0070714_100390438 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300005436|Ga0070713_100158977 | All Organisms → cellular organisms → Bacteria | 2016 | Open in IMG/M |
| 3300005436|Ga0070713_100673567 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
| 3300005436|Ga0070713_100988286 | Not Available | 812 | Open in IMG/M |
| 3300005436|Ga0070713_101294271 | Not Available | 706 | Open in IMG/M |
| 3300005437|Ga0070710_10770950 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005439|Ga0070711_100002625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 10288 | Open in IMG/M |
| 3300005439|Ga0070711_100182654 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300005439|Ga0070711_100518753 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 984 | Open in IMG/M |
| 3300005439|Ga0070711_100638193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
| 3300005458|Ga0070681_10543700 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300005458|Ga0070681_10785559 | Not Available | 869 | Open in IMG/M |
| 3300005518|Ga0070699_100790564 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005529|Ga0070741_10011720 | All Organisms → cellular organisms → Bacteria | 16094 | Open in IMG/M |
| 3300005529|Ga0070741_10038403 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6281 | Open in IMG/M |
| 3300005533|Ga0070734_10654544 | Not Available | 597 | Open in IMG/M |
| 3300005534|Ga0070735_10000132 | All Organisms → cellular organisms → Bacteria | 94470 | Open in IMG/M |
| 3300005537|Ga0070730_10032068 | All Organisms → cellular organisms → Bacteria | 3955 | Open in IMG/M |
| 3300005537|Ga0070730_10535372 | Not Available | 751 | Open in IMG/M |
| 3300005539|Ga0068853_100192759 | Not Available | 1852 | Open in IMG/M |
| 3300005542|Ga0070732_10070137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 2042 | Open in IMG/M |
| 3300005542|Ga0070732_10249238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300005557|Ga0066704_10772953 | Not Available | 599 | Open in IMG/M |
| 3300005563|Ga0068855_101998669 | Not Available | 586 | Open in IMG/M |
| 3300005563|Ga0068855_102438475 | Not Available | 521 | Open in IMG/M |
| 3300005577|Ga0068857_100313810 | Not Available | 1447 | Open in IMG/M |
| 3300005614|Ga0068856_100095458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2961 | Open in IMG/M |
| 3300005616|Ga0068852_100030981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4408 | Open in IMG/M |
| 3300005764|Ga0066903_100002497 | All Organisms → cellular organisms → Bacteria | 14467 | Open in IMG/M |
| 3300005764|Ga0066903_102388557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
| 3300005842|Ga0068858_102534708 | Not Available | 506 | Open in IMG/M |
| 3300005891|Ga0075283_1000368 | All Organisms → cellular organisms → Bacteria | 4311 | Open in IMG/M |
| 3300006041|Ga0075023_100304930 | Not Available | 657 | Open in IMG/M |
| 3300006050|Ga0075028_100106702 | Not Available | 1436 | Open in IMG/M |
| 3300006050|Ga0075028_100371516 | Not Available | 812 | Open in IMG/M |
| 3300006173|Ga0070716_101225533 | Not Available | 604 | Open in IMG/M |
| 3300006175|Ga0070712_100455604 | Not Available | 1066 | Open in IMG/M |
| 3300006797|Ga0066659_10198186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1468 | Open in IMG/M |
| 3300006914|Ga0075436_100830236 | Not Available | 689 | Open in IMG/M |
| 3300006954|Ga0079219_10017923 | All Organisms → cellular organisms → Bacteria | 2556 | Open in IMG/M |
| 3300009551|Ga0105238_11130818 | Not Available | 806 | Open in IMG/M |
| 3300010043|Ga0126380_11255850 | Not Available | 642 | Open in IMG/M |
| 3300010048|Ga0126373_12022206 | Not Available | 639 | Open in IMG/M |
| 3300010359|Ga0126376_11933583 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300010360|Ga0126372_11028509 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010362|Ga0126377_10136014 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300010371|Ga0134125_10007039 | All Organisms → cellular organisms → Bacteria | 12713 | Open in IMG/M |
| 3300010371|Ga0134125_10493691 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300010373|Ga0134128_11866700 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300010373|Ga0134128_13194845 | Not Available | 503 | Open in IMG/M |
| 3300010376|Ga0126381_100805775 | Not Available | 1348 | Open in IMG/M |
| 3300010396|Ga0134126_10008460 | All Organisms → cellular organisms → Bacteria | 12954 | Open in IMG/M |
| 3300010396|Ga0134126_10030989 | All Organisms → cellular organisms → Bacteria | 6770 | Open in IMG/M |
| 3300010398|Ga0126383_11469243 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300012212|Ga0150985_117528726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1201 | Open in IMG/M |
| 3300012469|Ga0150984_100835459 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
| 3300012985|Ga0164308_10104945 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
| 3300012987|Ga0164307_10098697 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300013104|Ga0157370_10449118 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300013105|Ga0157369_11225748 | Not Available | 765 | Open in IMG/M |
| 3300015053|Ga0137405_1201322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2371 | Open in IMG/M |
| 3300020069|Ga0197907_10494514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300020070|Ga0206356_11111637 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300020070|Ga0206356_11457602 | Not Available | 599 | Open in IMG/M |
| 3300020081|Ga0206354_10820291 | Not Available | 668 | Open in IMG/M |
| 3300021560|Ga0126371_10354151 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300021560|Ga0126371_10865943 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300021560|Ga0126371_11272000 | Not Available | 870 | Open in IMG/M |
| 3300025898|Ga0207692_11149541 | Not Available | 515 | Open in IMG/M |
| 3300025911|Ga0207654_11299627 | Not Available | 530 | Open in IMG/M |
| 3300025912|Ga0207707_10193775 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300025915|Ga0207693_10190705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 1613 | Open in IMG/M |
| 3300025924|Ga0207694_10169405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Tepidamorphaceae → Lutibaculum | 1768 | Open in IMG/M |
| 3300025928|Ga0207700_10015775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4995 | Open in IMG/M |
| 3300025928|Ga0207700_10899684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sulfuricellaceae → Sulfuriferula → Sulfuriferula multivorans | 792 | Open in IMG/M |
| 3300025934|Ga0207686_10065169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 2322 | Open in IMG/M |
| 3300025994|Ga0208142_1003334 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300026041|Ga0207639_11380221 | Not Available | 661 | Open in IMG/M |
| 3300026078|Ga0207702_10969460 | Not Available | 843 | Open in IMG/M |
| 3300026142|Ga0207698_12459945 | Not Available | 531 | Open in IMG/M |
| 3300027376|Ga0209004_1085524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 534 | Open in IMG/M |
| 3300027857|Ga0209166_10008177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6942 | Open in IMG/M |
| 3300027986|Ga0209168_10000105 | All Organisms → cellular organisms → Bacteria | 94539 | Open in IMG/M |
| 3300030844|Ga0075377_11396831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 760 | Open in IMG/M |
| 3300030846|Ga0075403_10943990 | Not Available | 507 | Open in IMG/M |
| 3300031122|Ga0170822_14600463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium SCGC AG-212-P17 | 600 | Open in IMG/M |
| 3300031890|Ga0306925_11574705 | Not Available | 640 | Open in IMG/M |
| 3300031939|Ga0308174_10154856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1709 | Open in IMG/M |
| 3300031954|Ga0306926_10394614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1708 | Open in IMG/M |
| 3300031954|Ga0306926_10535223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1437 | Open in IMG/M |
| 3300032074|Ga0308173_12001710 | Not Available | 546 | Open in IMG/M |
| 3300032261|Ga0306920_102148243 | Not Available | 778 | Open in IMG/M |
| 3300033412|Ga0310810_10718830 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 18.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.01% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 9.01% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.41% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.60% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 2.70% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.80% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.90% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.90% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025994 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes) | Environmental | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030846 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_100029094 | 3300001305 | Soil | MSDNNSNRVLCRRTARELSPEEFQKMLGGKPQMTQLPSIPFHPDF* |
| C688J18823_1000001954 | 3300001686 | Soil | MKETKCGKEKRMSDNNSNRVLCRRTARELSPEEFQKMLGGKPQMTQLPSIPFHPDF* |
| soilH1_102670321 | 3300003321 | Sugarcane Root And Bulk Soil | DCMPNNFENRVLGRRHAHQLSAEEFQKILDKGNTQMTQLPSIPFHPDF* |
| Ga0062595_1007495131 | 3300004479 | Soil | MPENNNDRVLVRANARQLTAEEFQKIMEEGKKQMTQLPSTPFHPDF* |
| Ga0062595_1009239362 | 3300004479 | Soil | MPNNYENRVLVRRNARLLSAEEFQEIMEKGKTQMTQLPSIPFNPDF* |
| Ga0058861_120443622 | 3300004800 | Host-Associated | GECMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV* |
| Ga0058862_106157742 | 3300004803 | Host-Associated | ENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF* |
| Ga0058862_127890901 | 3300004803 | Host-Associated | CMPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF* |
| Ga0070683_1000219522 | 3300005329 | Corn Rhizosphere | MPENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTQLPSTPFHPDF* |
| Ga0066388_1001842702 | 3300005332 | Tropical Forest Soil | MLNNYDNRVLGRRKARQLSPEEFDKIMQGTTQMTQLPSIPFHPDF* |
| Ga0066388_1018764892 | 3300005332 | Tropical Forest Soil | MPNNYDNRVLVRRNARQLSAEEYETILEKGKTQMTQLPSIPFNPDF* |
| Ga0070680_1004783191 | 3300005336 | Corn Rhizosphere | MPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV* |
| Ga0070680_1008897382 | 3300005336 | Corn Rhizosphere | MPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF* |
| Ga0070691_107153592 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNFENRVLSRKNAHQLSAEEYQKILEQGKTQLTQLPSIPFNPDF* |
| Ga0070692_105514191 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | KKEKCMPENNNDRVLIRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF* |
| Ga0070692_109852382 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF* |
| Ga0070709_102363482 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPSDYANRVLCRTNARQLTAEEYTWIKEQGKTQMTQLPSMPFHPDF* |
| Ga0070709_104688552 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPDF* |
| Ga0070714_1003904382 | 3300005435 | Agricultural Soil | MSDNNNNRVLCRRTARELSAEEFQKMMGGKPQMTQLPSIPFHPDF* |
| Ga0070713_1001589772 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MQNNNNNRVLGRTNARELSAEEFQKMLGGKPQMTQLPSIPFHPDF* |
| Ga0070713_1006735672 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSIPFQPDF* |
| Ga0070713_1009882862 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKNESNRVLCRTNAREVSAEEYTKILGQGKPQMTQLPSIPFNPDF* |
| Ga0070713_1012942711 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIDYENRVLVRRNARLLSAEEFQEIMEKGKAQATQLPSMPFFPDF* |
| Ga0070710_107709502 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDHNSNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF* |
| Ga0070711_1000026257 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNDYENRVLVRRNARLVSAEEFQEIMEKGKTQMTQLPSMPFHPDF* |
| Ga0070711_1001826542 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQNNNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPDF* |
| Ga0070711_1005187531 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNNNNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF* |
| Ga0070711_1006381932 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MQDDDKNNRVLGRTNARELSAEEFQKMLGGKPQMTQLPSIPFHPDF* |
| Ga0070681_105437002 | 3300005458 | Corn Rhizosphere | MADNNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF* |
| Ga0070681_107855591 | 3300005458 | Corn Rhizosphere | MPNDFENRVLVRTNARQLSDEEFQEIMEKGKAQMTQLPSIPFNPDF* |
| Ga0070699_1007905641 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNNYENRVLVRTNARQVSAEEFQEIMEKGKAQMTQLPSMPFHPDF* |
| Ga0070741_100117208 | 3300005529 | Surface Soil | MPNNFENRVLVRTNARQLTPEEYATIMEKSKPQMTFIPSIPHNPDF* |
| Ga0070741_100384038 | 3300005529 | Surface Soil | MPNNFENRVLVRTNARQLSAEEFQWIMEKGNAQMTLLPSTPFHPDF* |
| Ga0070734_106545441 | 3300005533 | Surface Soil | MPNQNNNRVLGRINARHVSAEELHKILGKGNTQMTQLPSIPFHPDF* |
| Ga0070735_1000013214 | 3300005534 | Surface Soil | MTNNNDNRVLGRRNARQLTAEELHKILGQGNTQMTQLPSMPFHPDF* |
| Ga0070730_100320684 | 3300005537 | Surface Soil | MSDNNSNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF* |
| Ga0070730_105353721 | 3300005537 | Surface Soil | MSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPF |
| Ga0068853_1001927592 | 3300005539 | Corn Rhizosphere | MADINSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF* |
| Ga0070732_100701371 | 3300005542 | Surface Soil | MPENYNDRVLVRTNARLVSAEEFQEIMEKGTAQMTQLPSMPFFPDF* |
| Ga0070732_102492382 | 3300005542 | Surface Soil | MPKNTSNRVLCRTNAREVSAEEFEKIMGQGKPQMTQLPSMPFHPDF* |
| Ga0066704_107729531 | 3300005557 | Soil | MADNNSNRVLCRRTAREISAEEFQKILGQGKPQMTQLPSMPFNPDF* |
| Ga0068855_1019986691 | 3300005563 | Corn Rhizosphere | MPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPS |
| Ga0068855_1024384752 | 3300005563 | Corn Rhizosphere | MPNYENRVLSRRHARQLSAEEYQKILAEGKTQVTLLPSIPFQPDV* |
| Ga0068857_1003138102 | 3300005577 | Corn Rhizosphere | MPENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTKLPSTPFHPDF* |
| Ga0068856_1000954583 | 3300005614 | Corn Rhizosphere | MPENNNDRVLIRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF* |
| Ga0068852_1000309816 | 3300005616 | Corn Rhizosphere | MPENYNDRVLVRTNARKLTAEEFQKIMDEENELMTLLPSTPFHPDF* |
| Ga0066903_1000024971 | 3300005764 | Tropical Forest Soil | MPNNYDNRVLGRRNARQLSAEEFQKILGQGKPQMTQLPSIPFHPDF* |
| Ga0066903_1023885571 | 3300005764 | Tropical Forest Soil | MLNNSDNRVLGRRKARQLSPEEFDKIMQGTTQMTQLPSIPFHPDF* |
| Ga0068858_1025347081 | 3300005842 | Switchgrass Rhizosphere | KEKCMPENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF* |
| Ga0075283_10003682 | 3300005891 | Rice Paddy Soil | MPNNYENRVLSRRNAHQLSAEEFQKILDQGKTQMTQLPSIPFNPDF* |
| Ga0075023_1003049301 | 3300006041 | Watersheds | MPNNYENRVLVRRNARLLSAEEFTEIMEKGKSQMTQLPSMPFHPDF* |
| Ga0075028_1001067023 | 3300006050 | Watersheds | MPNNYENRVLVRRNARLVSAEEFQEIMEKGKTQMTQLPSMPFHPDF* |
| Ga0075028_1003715162 | 3300006050 | Watersheds | MPKNNSNRVLCRANAREVSAEEFQKILGEGKPQMTQLPSMPFHPDF* |
| Ga0070716_1012255333 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF* |
| Ga0070712_1004556041 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNNNNRVLCRRTARELSTEEFQKMLGGKPQMTQLPSIPFHPDF* |
| Ga0066659_101981862 | 3300006797 | Soil | MANDNDNRILARRNAGHLSAEELNKILGNGNNQMTQLPSIPFHPDF* |
| Ga0075436_1008302362 | 3300006914 | Populus Rhizosphere | MADNNSNRVLCRRTAREISAEEFQKILGQGKPQMTQLPSIPFNPDF* |
| Ga0079219_100179235 | 3300006954 | Agricultural Soil | MPNNYENRVLVRRNARQLSAEEFQEIMEKGKDQMTQLPSIPFHPDF* |
| Ga0105238_111308182 | 3300009551 | Corn Rhizosphere | MWKGECMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV* |
| Ga0126380_112558502 | 3300010043 | Tropical Forest Soil | MPNNYDNRVLVRTNARLLSAEEYQEIMENGKAQMTQLPSTPFHPDF* |
| Ga0126373_120222062 | 3300010048 | Tropical Forest Soil | MQNNYENRVLVRRNARLLTAEEYETILEKGKTQMTQLPSIPFFPDF* |
| Ga0126376_119335832 | 3300010359 | Tropical Forest Soil | MPNNYENRVLVRTNARLLSAEEFQEIMEKGKAQMTQLP |
| Ga0126372_110285091 | 3300010360 | Tropical Forest Soil | KCMTNNNDNRVLCRRNARHLSAEELEKILGKGNNQMTQLPSIPFYPDF* |
| Ga0126377_101360142 | 3300010362 | Tropical Forest Soil | MPNNSDNRVLGRKKARQLSPEEFDKIMQGTTQMTQLPSIPFHPDF* |
| Ga0134125_100070396 | 3300010371 | Terrestrial Soil | MPNNYENRVLGRRHAHQLSAEEFQKILDQGKTQMTQLPSIPFHPDF* |
| Ga0134125_104936912 | 3300010371 | Terrestrial Soil | KEKRMPENNNRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF* |
| Ga0134128_118667002 | 3300010373 | Terrestrial Soil | MNDLENRVLSRRNARQLSAEEYSKIQTDGKTQMTLLPSIPFHPDV* |
| Ga0134128_131948452 | 3300010373 | Terrestrial Soil | MPNDKDNRVLGRRTARELKAEEFQKIMGEGKPQMTQLPSIPFHPDF* |
| Ga0126381_1008057752 | 3300010376 | Tropical Forest Soil | MPNNHENRVLVRTNARQLTAEEYATIMEKSKPQMTFLPSIPHNPDF* |
| Ga0134126_100084604 | 3300010396 | Terrestrial Soil | MSDNNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFNPDF* |
| Ga0134126_100309892 | 3300010396 | Terrestrial Soil | MPNNYENRVLVRTNARQLSAEEFQWIMEKGKAQMTQLPSTPFHPDF* |
| Ga0126383_114692431 | 3300010398 | Tropical Forest Soil | MPTNNDNRVLARRNARYLSAEELQKILGQGNTQMTQLPSIPF |
| Ga0150985_1175287263 | 3300012212 | Avena Fatua Rhizosphere | PENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTQLPSTPFHPDF* |
| Ga0150984_1008354594 | 3300012469 | Avena Fatua Rhizosphere | MPNKNSNRVLCRTNAREVSAEEFEKIMGQGKPQMTQLPSMPFHPDF* |
| Ga0164308_101049452 | 3300012985 | Soil | MQNNNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPHF* |
| Ga0164307_100986972 | 3300012987 | Soil | MQNDNNNRVLGRTNARELSAEEFQKMMGGKPQMTQLPSIPFHPDF* |
| Ga0157370_104491182 | 3300013104 | Corn Rhizosphere | MPNYENRVLSRRHASQLSAEEYQKILAEGKTQVTLLPSIPFQPDV* |
| Ga0157369_112257482 | 3300013105 | Corn Rhizosphere | MPENNSDRVLVRAKARQLTAEEFQKIMEGNELMTLLPSTPFHPDF* |
| Ga0137405_12013222 | 3300015053 | Vadose Zone Soil | MPNNNNNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF* |
| Ga0197907_104945142 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | GKEKCMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV |
| Ga0206356_111116372 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | ECMPNNYEHRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV |
| Ga0206356_114576022 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV |
| Ga0206354_108202911 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNFENRVLSRKNAHQLSAEEYQKILEQGKTQLTQLPSIPFNPDF |
| Ga0126371_103541512 | 3300021560 | Tropical Forest Soil | MHNNNDNRVLARRNAHQLSAEELATILGKGNTQMTQLPSIPFYPDF |
| Ga0126371_108659431 | 3300021560 | Tropical Forest Soil | MQNNYENRVLVRRNARLLTAEEYETILEKGKTQMTQLPSIPFFPDF |
| Ga0126371_112720002 | 3300021560 | Tropical Forest Soil | MPNNYENRVLVRTNARILSAEEFQWIMEKGKAQMTQLPSTPYHPDF |
| Ga0207692_111495411 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | SDYANRVLCRTNARQLTAEEYTWIKEQGKTQMTQLPSMPFHPDF |
| Ga0207654_112996271 | 3300025911 | Corn Rhizosphere | MPENNNDRVLVRANARQLTAEEFQKIMEEGKEQMTQLPSTPFHPDF |
| Ga0207707_101937752 | 3300025912 | Corn Rhizosphere | MPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLPSIPFNPDF |
| Ga0207693_101907054 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPENNNDRVLVRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF |
| Ga0207694_101694052 | 3300025924 | Corn Rhizosphere | MPENYNDRVLVRTNARQLSAEEFQEIMEKGKAQMTQLP |
| Ga0207700_100157755 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDHNSNRVLCRRTAREISAEEFQKIMGQGKPQMTQLPSMPFQPDF |
| Ga0207700_108996842 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKNESNRVLCRTNAREVSAEEYTKILGQGKPQMTQLPSIPFNPDF |
| Ga0207686_100651693 | 3300025934 | Miscanthus Rhizosphere | MPNDFENRVLVRTNARQLSDEEFQEIMEKGKAQMTQLPSIPFNPDF |
| Ga0208142_10033343 | 3300025994 | Rice Paddy Soil | MPNNYENRVLSRRNAHQLSAEEFQKILDQGKTQMTQLPSIPFNPDF |
| Ga0207639_113802211 | 3300026041 | Corn Rhizosphere | KGECMPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSIPFHPDV |
| Ga0207702_109694602 | 3300026078 | Corn Rhizosphere | MPENNNDRVLIRAKARQLTAEEFQKIMDEGSELMTLLPSTPFHPDF |
| Ga0207698_124599452 | 3300026142 | Corn Rhizosphere | MPNNYENRVLSRRNARQLSAEEYQKILAEGKTQVTLLPSI |
| Ga0209004_10855242 | 3300027376 | Forest Soil | MPANNNDRVLLRTNARLVSAGEFQEIMEKGKAQMTQLPSMPFFP |
| Ga0209166_100081774 | 3300027857 | Surface Soil | MSDNNSNRVLCRRTARELSAEEFQKMLGGKPQMTQLPSIPFHPDF |
| Ga0209168_1000010513 | 3300027986 | Surface Soil | MTNNNDNRVLGRRNARQLTAEELHKILGQGNTQMTQLPSMPFHPDF |
| Ga0075377_113968311 | 3300030844 | Soil | MPNNYENRVLVRRNARLVSAEEFQEIMEKGKAQMTQLPSMPFHPDF |
| Ga0075403_109439902 | 3300030846 | Soil | LVRRNARLVSAEEFQEIMEKGKAQMTQLPSMPFHPDF |
| Ga0170822_146004632 | 3300031122 | Forest Soil | MKRRKCMPNNYENRVLVRRNARLVSAEEFQEIMEKGKAQMTQLPSMPFHPDF |
| Ga0306925_115747052 | 3300031890 | Soil | MPNNYENRVLVRRNARLLSAEEFQEIMEKGKAQMTQLPSMPFHP |
| Ga0308174_101548562 | 3300031939 | Soil | MNDLENRVLSRRNARQLSAEEYSKILADGKTQVTLLPSIPFHPDV |
| Ga0306926_103946142 | 3300031954 | Soil | MPNNYENRVLVRRNARLLSAEEFQEIMEKGKAQMTQLPSMPFHPDF |
| Ga0306926_105352232 | 3300031954 | Soil | MPNNFENRVLVRRNARLLSPEEYQEIMEKGKTQMTQLPSIPHFPDF |
| Ga0308173_120017102 | 3300032074 | Soil | MNDLENRVLSRRNARQLSAEEYSKILADGKTQVTLLPSIPF |
| Ga0306920_1021482432 | 3300032261 | Soil | MSNNNDHRVLGRRGARQLSAETMQKILEAGKTHMTQLPSIPFHPDF |
| Ga0310810_107188301 | 3300033412 | Soil | MNNFENRVLSRKNAHQLSAEEYQKILEQGKTQLTQLPSIP |
| ⦗Top⦘ |