| Basic Information | |
|---|---|
| Family ID | F086038 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 44 residues |
| Representative Sequence | RGVRSGKVLTIVNPDPETPLSPADYPPGKLIALTDPSAAPLN |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 2.70 % |
| % of genes from short scaffolds (< 2000 bps) | 0.90 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (97.297 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.712 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.748 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.57% β-sheet: 5.71% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF12802 | MarR_2 | 14.41 |
| PF00857 | Isochorismatase | 8.11 |
| PF12796 | Ank_2 | 2.70 |
| PF07676 | PD40 | 2.70 |
| PF02527 | GidB | 1.80 |
| PF02897 | Peptidase_S9_N | 1.80 |
| PF16657 | Malt_amylase_C | 0.90 |
| PF06778 | Chlor_dismutase | 0.90 |
| PF01047 | MarR | 0.90 |
| PF01618 | MotA_ExbB | 0.90 |
| PF13358 | DDE_3 | 0.90 |
| PF10756 | bPH_6 | 0.90 |
| PF00313 | CSD | 0.90 |
| PF07884 | VKOR | 0.90 |
| PF02195 | ParBc | 0.90 |
| PF01740 | STAS | 0.90 |
| PF02586 | SRAP | 0.90 |
| PF14344 | DUF4397 | 0.90 |
| PF00011 | HSP20 | 0.90 |
| PF01041 | DegT_DnrJ_EryC1 | 0.90 |
| PF13103 | TonB_2 | 0.90 |
| PF04055 | Radical_SAM | 0.90 |
| PF01329 | Pterin_4a | 0.90 |
| PF05239 | PRC | 0.90 |
| PF06210 | DUF1003 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 8.11 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 8.11 |
| COG0357 | 16S rRNA G527 N7-methylase RsmG (former glucose-inhibited division protein B) | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 1.80 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 1.80 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.90 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.90 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.90 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.90 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.90 |
| COG2154 | Pterin-4a-carbinolamine dehydratase | Coenzyme transport and metabolism [H] | 0.90 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.90 |
| COG3253 | Coproheme decarboxylase/chlorite dismutase | Coenzyme transport and metabolism [H] | 0.90 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.90 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 97.30 % |
| All Organisms | root | All Organisms | 2.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300021168|Ga0210406_10096918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2508 | Open in IMG/M |
| 3300027604|Ga0208324_1007397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3707 | Open in IMG/M |
| 3300031823|Ga0307478_10414981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.01% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.11% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 6.31% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.31% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.80% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.80% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.80% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.90% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.90% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.90% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
| 3300001098 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 | Environmental | Open in IMG/M |
| 3300001166 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300025434 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028021 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N55_03177580 | 2189573000 | Grass Soil | HSGEVLTIINPEPQTPLTQEDLPPGKLIALTDPSLRP |
| JGI12633J13313_1052372 | 3300001098 | Forest Soil | IKGILSGHVLTIVNPEPETPLTREDYPVGKLIALSDPSAAPLN* |
| JGI12694J13545_10132382 | 3300001166 | Forest Soil | LTIVNPDPDTPLTPAEYPPGKLIALSDPSNSPGN* |
| JGI12635J15846_108490611 | 3300001593 | Forest Soil | XDVLTIVNPEPETPLTQEDYPLGKLIALTDPSATTLN* |
| JGIcombinedJ26739_1006517641 | 3300002245 | Forest Soil | HTGDVLTIINPEPEIPISRDDYPVGKLIALTDPSNKLHN* |
| JGIcombinedJ26739_1011508071 | 3300002245 | Forest Soil | GEELTIINPEPDIPLSHEEYPPGKLISLTDPSTEPQN* |
| JGI26346J50198_10224371 | 3300003351 | Bog Forest Soil | DRLLIRGVVSGDVLAIVNPEPETPLTQEDYPLGKLISLTDPSVAPLN* |
| Ga0062389_1038020651 | 3300004092 | Bog Forest Soil | GILSGEVLTIVNPQPETPLTPEEYPPGKLIALTDPSAAPLN* |
| Ga0066672_104250611 | 3300005167 | Soil | EGSRLLVRGILSDDVLTIVNTEPQTPLAPEDYPPGKSIALTDPSTAPLN* |
| Ga0066679_110162332 | 3300005176 | Soil | VVRGIFSGDVVTIINAEPETPLTQEDYPLGKLIVLTDPSTTPLN* |
| Ga0070735_108591142 | 3300005534 | Surface Soil | RLTIRGVRSGKVLTIVNPDPSTPLTPAEYPPGKLIALSDPSASPFN* |
| Ga0070761_101224211 | 3300005591 | Soil | GVRSGKVLTIVNPDPETPLSPADYPPGKLIALTDPSTAPLN* |
| Ga0070761_106295392 | 3300005591 | Soil | AVESQCLVIRGVRSGKVLTIVNPDPETPLSAADYPPGKLIALTDPSAAPLN* |
| Ga0070761_110889651 | 3300005591 | Soil | RGVRSGKVLTIVNPDPETPLSPADYPPGKLIALTDPSAAPLN* |
| Ga0070764_104845541 | 3300005712 | Soil | ESQSLTIRGERSGEVLKIINPDPDTPLTPAEYPPGKLIALSDPSASQGN* |
| Ga0075017_1013183752 | 3300006059 | Watersheds | TIINPNPDAPLSPAEYPLGKLIALSDPSTNSPVN* |
| Ga0075019_102915981 | 3300006086 | Watersheds | RSGKVLTIVNPDPETPLSPAEYPPGKLIALSDPSAAPLN* |
| Ga0075015_1005738601 | 3300006102 | Watersheds | VESQSLTIRGVRSGEVLRIINPDPETPLTPTDYPPGRLIALADPSAAPLN* |
| Ga0075030_1002588321 | 3300006162 | Watersheds | AVESQSLTIRGVRSGEVLTIINPNPDAPLSPAEYPLGKLIALSDPSTKSPAN* |
| Ga0075014_1000634312 | 3300006174 | Watersheds | VESQSLTIRGVRSGEVLTIINPNPEAPLSPAEYPLGKLIALSDPSTNSPVN* |
| Ga0075014_1006122981 | 3300006174 | Watersheds | RSGEVLTIINPDPSTPLTPAEYPPGKLIALSDPSRTSPAN* |
| Ga0099829_107104211 | 3300009038 | Vadose Zone Soil | AVESDRLLIRGIRSGKVLTIMNPEPEIPIKLEDYPPGKLIALTDPSTLPLD* |
| Ga0066709_1013215151 | 3300009137 | Grasslands Soil | IRGVRSGEVLTIINPDPETPLTPAEYPPGKLIALSDPSTSIQN* |
| Ga0099792_109856932 | 3300009143 | Vadose Zone Soil | LSGQVLTIINPAPDIPLSQLDFPPGKLIALTDPSTSPPN* |
| Ga0105241_111148002 | 3300009174 | Corn Rhizosphere | LVIQGVLSGKVLTIMNPEPNTPISPQDYPPGKLIVLNDPAIDSQN* |
| Ga0116218_10343084 | 3300009522 | Peatlands Soil | IRGVRSGKVLTIVNPDPETPLTPVDYPPGKLIALTDPSRAPLN* |
| Ga0116225_11871131 | 3300009524 | Peatlands Soil | SGEVLAIVNPEPETPLTQDDYPLGKLIALTDPSATPLNDWN* |
| Ga0116111_11525062 | 3300009616 | Peatland | GAILMVVNPEPETPLTPQDFPLGKLIALSDPSQAPLN* |
| Ga0116125_100038022 | 3300009628 | Peatland | SGKVLTIINPEPEIPLTEADYPTGKLIALTDPSTATLN* |
| Ga0116217_108152492 | 3300009700 | Peatlands Soil | ESQCLVIRGVRSGKVLTIVNPDPETPLTPAEYPPGKLIALTDPSLAPLN* |
| Ga0116134_10557864 | 3300009764 | Peatland | LVIRGVLSGELLTIVNPEPETPLTREDYPPGKLIALSDPSAAPLN* |
| Ga0126373_106771262 | 3300010048 | Tropical Forest Soil | EDQCLVIRGIRSGEVLVINVAPEIPLTEEDYPPGRLIALSDPSTDVPN* |
| Ga0136449_1012900531 | 3300010379 | Peatlands Soil | SGEVLTIINPDPETPLTPAEYPPGKLIALSDPSTSTPFN* |
| Ga0150983_106053922 | 3300011120 | Forest Soil | GVRSGKVLTIVNPDPDTPLTPAEYPPGKLIALSDPSTSPGN* |
| Ga0150983_111104512 | 3300011120 | Forest Soil | RSGKVLTIVNPDPETPLSAADYPPGKLIALTDPSAAPLN* |
| Ga0137383_112934351 | 3300012199 | Vadose Zone Soil | RGILSGEVLTIINSEPETPLTPQDYPPGKLIALTDPSTEPLN* |
| Ga0137399_102008434 | 3300012203 | Vadose Zone Soil | DRLVIRGTLSGDVLTIINPEPETPLTKEDYPLGKLIALTDPSQTPLN* |
| Ga0137366_108592091 | 3300012354 | Vadose Zone Soil | EGQSLTIRGIRSGKVLKIVNPDPNTPLNSAEYPPGKLIALSDPSGVPSN* |
| Ga0137395_103135421 | 3300012917 | Vadose Zone Soil | LTIISTELASPLTPEDYPLGKLIALTDPSTAPLN* |
| Ga0137396_110966651 | 3300012918 | Vadose Zone Soil | IRGTLSGDVLTIINPEPETPLTKEDYPLGKLIALTDPSQTPLN* |
| Ga0181518_104809053 | 3300014156 | Bog | VLAIVNPEPETPLTQDDYPLGKLIALTDPSAAPLNDLN* |
| Ga0181530_104154501 | 3300014159 | Bog | LSGAVLTILNPEPETPLTQEDYPVGKLIALTDPSAAPLN* |
| Ga0182024_110709931 | 3300014501 | Permafrost | RVLAVESQRLVIRGELSGKVLTIVNHQPDVPLTEEDYPPGKLIALSDPSITPN* |
| Ga0182024_115664681 | 3300014501 | Permafrost | IRGVRSGKVLTIVNPDPDTPLTPAEYPPGKLIALSDPSTSPGN* |
| Ga0182021_130671422 | 3300014502 | Fen | LIRGTLSGAVLTILNPEPETPLTQEDYPVGKLIALTDPSAAPLN* |
| Ga0182030_108162121 | 3300014838 | Bog | ILTIVNPEPETPLRHEDYPPGKLIALTDPSTAPLN* |
| Ga0134112_1000672810 | 3300017656 | Grasslands Soil | LSGAVLTIISTELASPLTPEDYPLGKLIALTDPSTAPLN |
| Ga0187801_101310172 | 3300017933 | Freshwater Sediment | LAVESHSLTIRGVRSGEVLTIINPNPDTPLTPADYPPGKLIALSDPSTNSPVN |
| Ga0187801_102556562 | 3300017933 | Freshwater Sediment | RVIAVESQCLTIRGVRSGKVLTIVNPDPETPLSPAEYPPGKLIRLSDPSARPLN |
| Ga0187848_103597392 | 3300017935 | Peatland | GILSGAILMVVNPEPETPLTPQDFPLGKLIALSDPSQAPLN |
| Ga0187821_100728004 | 3300017936 | Freshwater Sediment | VEGQSLTIRGVRSGKVLKIVNPDPSTPLTSTEYPPGKLIKLSDPSGSPAN |
| Ga0187816_100431291 | 3300017995 | Freshwater Sediment | CLTIRGVRSGKVLTIVNPDPETPLSPAEYPPGKLIRLSDPSARPLN |
| Ga0187875_103845033 | 3300018035 | Peatland | DRLRIRGILSGKVLTIINPEPEIPLTEADYPTGKLIALTDPSTATLN |
| Ga0187883_101887713 | 3300018037 | Peatland | LLTIVNPEPDTPLTPEDYPPGKLIALTDPSAAPLN |
| Ga0187859_101366482 | 3300018047 | Peatland | SQCLVIRGVRSGRVLTIMNPDPETPLTLADYPPGKLIALSDPSRAPLN |
| Ga0187858_100210631 | 3300018057 | Peatland | VLAIVNPEPETPLTQDDYPLGKLIALTDPSAAPLNDLN |
| Ga0210403_107368181 | 3300020580 | Soil | VVAVESQSLTIRGERSGEVLKIINPDPDTPLTPAEYPPGKLIALSDPSASQGN |
| Ga0210395_113494621 | 3300020582 | Soil | VQSDCLTIRGVRSGKVLTIVNPDPETPLTTADYPPGKLIALSDPSAAPLN |
| Ga0210401_105825442 | 3300020583 | Soil | LVIRGVQSGKVLTIMNPDPETPLSPAEYPPGKLIALSDPSAAPLN |
| Ga0210406_100969181 | 3300021168 | Soil | GTHSGDVLTIINPQPETPLTKEDYPPGKLIALTDPSQTPQN |
| Ga0210405_107978642 | 3300021171 | Soil | DVLTIINPEPETPLTKEDYPLGKLIALTDPSETPLN |
| Ga0210393_100447031 | 3300021401 | Soil | GVHTGDVLTIINPEPEIPISQDDYPVGKLIALTDPSNKLHN |
| Ga0210393_111052851 | 3300021401 | Soil | DVLTIINPDPDTPLSPVEYPPGMLIALSDPSAEAPTEAN |
| Ga0210398_108672331 | 3300021477 | Soil | GKVLTIVNPDPETPLTTADYPPGKLIALSDPSAAPLN |
| Ga0210398_109108122 | 3300021477 | Soil | RSGKVLTIVNPDPETPLSPADYPPGKLIALTDPSTAPLN |
| Ga0210402_118229551 | 3300021478 | Soil | GTLSGDVLTTINPEPETPLTKEDYPLGKLIALTDPSETPLN |
| Ga0210410_110275522 | 3300021479 | Soil | SGKVLTIVNPDPETPLSPAEYPPGKLIALSDPSAAPLN |
| Ga0213853_106990111 | 3300021861 | Watersheds | VLAVESQSLTIRGVRSGEVLTIINPNPDTPLSPAEYPLGKLIALSDPSTNLPVN |
| Ga0224558_10274231 | 3300023090 | Soil | VIRGVLSGEVLTIVNPEPESPLTQQDYPLGKLIALTDPSQSPLN |
| Ga0208690_10108243 | 3300025434 | Peatland | RGILSGKVLTIINPEPEIPLTEADYPTGKLIALTDPSTATLN |
| Ga0208323_10053701 | 3300025439 | Peatland | GDVLTIINPHPEIPISQEDYPVGKLIALTDPSKTLPN |
| Ga0208686_10704883 | 3300025500 | Peatland | GDVLAIVNPEPETPLTHDDYPPGKLIALTDPSVAPLNDLN |
| Ga0208188_10800523 | 3300025507 | Peatland | RLFIRGILSGDVLAIVNPEPETPLTHDDYPPGKLIALTDPSVAPLNDLN |
| Ga0207646_103015074 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VIRGTLSGDVLTIINPEPETPLTKEDYPPGKLIALTDPSQTPLN |
| Ga0207646_107614561 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VESQCLTIRGVRSGKVLTIMNPDPDTPLTPAEYPPGKLIALSDPGATPLN |
| Ga0257154_10309661 | 3300026467 | Soil | KVLTIMNPDPETPLSPAEYPPGKLIALSDPSAAPLN |
| Ga0179587_106724882 | 3300026557 | Vadose Zone Soil | VEVESQRLTLRGIRSGRVLTINAPAESPLSARDYPLGKLIALSDPAAAPGD |
| Ga0209421_10919801 | 3300027432 | Forest Soil | RLFIRGVRSGDVLVIVNPEPETPLTPEDYPLGKLIALTDPSATPANGLN |
| Ga0208324_10073971 | 3300027604 | Peatlands Soil | VSGDVLAIVNPEPETPLSQEDYPLGKLISLTDPSVAPLN |
| Ga0208324_11331191 | 3300027604 | Peatlands Soil | IRGVRSGKVLTIVNPDPETPLTPVDYPPGKLIALTDPSRAPLN |
| Ga0209626_11466102 | 3300027684 | Forest Soil | GDVLTIINPEPEIPISRDDYPVGKLIALTDPSNKLHN |
| Ga0209274_107526652 | 3300027853 | Soil | VRSGKVLTIVNPDPETPLSPADYPPGKLIALTDPSAAPLN |
| Ga0209517_101484551 | 3300027854 | Peatlands Soil | KVLTIVNPDPETPLTTADYPPGKLIALTDPSAAPLN |
| Ga0209488_105659431 | 3300027903 | Vadose Zone Soil | AIEDDRLVIRGTLSGDVLTIINPEPETPLTKEDYPLGKLIALTDPSQTPLN |
| Ga0265352_10154761 | 3300028021 | Soil | IRGVRSGKVLTIVNPDPDTPLTPAEYPPGKLIALSDPSTSPGN |
| Ga0209526_100090331 | 3300028047 | Forest Soil | IEDDRLVIRGTLSGDVLTIINPEPDTPLTKEDYPLGKLIALTDPSQTPLN |
| Ga0265338_108358022 | 3300028800 | Rhizosphere | EQSLTIRGVRSGEVLTIINPNPETPLTPDEYPPGKLIALSDPSTAPGN |
| Ga0311353_106284042 | 3300030399 | Palsa | VLTIVNPESAIPLSEDDYPVGKLIALTDPSASAVLN |
| Ga0311370_116886391 | 3300030503 | Palsa | LVIRGVRSGRVLTIMNPDPETPLTLADYPPGKLIALSDPSAAPLN |
| Ga0302183_102110651 | 3300030509 | Palsa | RLVIRGVLSGEVLAIVNDEPDTPFTSDDYPLGKLIALTDPSAAPLNDLN |
| Ga0311372_102837261 | 3300030520 | Palsa | ESQCLVIRGVRSGKVLTIVNPDPETPLSAAEYPPGKLIALTDPSAAPLN |
| Ga0311354_118859952 | 3300030618 | Palsa | SGEVLTIINPDPETPLTPAEFPPGKLIALSDPSNSPFN |
| Ga0302313_102788442 | 3300030693 | Palsa | GVRSGKVLTIVNPDPETPLSAAEYPPGKLIALTDPSAAPLN |
| Ga0265461_131621221 | 3300030743 | Soil | HSGEVLTIVNPELATPLSKDEYPVGKLIALTDPSTDPPA |
| Ga0170824_1005811292 | 3300031231 | Forest Soil | CLVIRGVQSGKVLTIMNPDPETPLSPAEYPPGKLIALSDPSAAPLN |
| Ga0170824_1067062212 | 3300031231 | Forest Soil | SQCLTIQGVRSGKVLTIMNPDPETPLSPADYPPGKLIALSDPGAVPLN |
| Ga0302324_1030222712 | 3300031236 | Palsa | IRSGEVLTIINPEPDTFLSQEDYPPGKLIALTDPSALLPN |
| Ga0265316_111432962 | 3300031344 | Rhizosphere | ESQSLTIRGVRSGKVLKIVNPDPNTPLTPDEYPPGKLIKLSDPSMTPGN |
| Ga0310686_1127590671 | 3300031708 | Soil | VLTIVNPEPEIPLSEEEYPLGKLIALTDPSTALLN |
| Ga0307474_104490413 | 3300031718 | Hardwood Forest Soil | VLTIVNPDPDTPLTPAEYPPGKLIALSDPSTSPGN |
| Ga0307477_100327915 | 3300031753 | Hardwood Forest Soil | VESQSLTIRGVRSGEVLTIINPNPDAPLSPAEYPLGKLIALSDPSSNSPVN |
| Ga0307475_100224581 | 3300031754 | Hardwood Forest Soil | VVAVESQRLTIRGVRSGKVLTIVNPDPNTPLTPAEYPPGKLIKLSDPSAAPGN |
| Ga0307475_113086292 | 3300031754 | Hardwood Forest Soil | GDRLVIRGTLSGDVLTIINPEPETPLTKEDYPLGKLIALTDPSQTPLN |
| Ga0307478_104149811 | 3300031823 | Hardwood Forest Soil | QGIRSGKVLTIVNPDPDTPLSCAEYPPGKLIALSDPSASPFN |
| Ga0307479_100076462 | 3300031962 | Hardwood Forest Soil | VESQSLTIRGVRSGEVLTIINPNPDAPLSPAEYPLGKLIALSDPSTNSPVN |
| Ga0311301_109456461 | 3300032160 | Peatlands Soil | VAVESTRLVIQGVLSGQVLTIVNPDPEVPLTPKDYPLGKLIALTDPSRATPN |
| Ga0335079_120933491 | 3300032783 | Soil | VVAVESERLTIRGVRSGEVLTIDTQHMGTRLTPAEYPPGKLIALSDPSTTQGS |
| Ga0335078_118151991 | 3300032805 | Soil | YRVVAVESQSLTIRGVRTGKVLTINPATPFRVADYPPGRLIALSDPNNGPAS |
| Ga0335083_104978602 | 3300032954 | Soil | VESQSLTIRGVRSGAVLTIINPDPETPLTPAEYPPGRLIALSDPSTAPAN |
| Ga0335073_101164261 | 3300033134 | Soil | LFIQGILSGEVLTIINPELETPLRAEDYPLGKLIALTDPSTAPLN |
| Ga0335073_105077653 | 3300033134 | Soil | IRGVRSGAVLTIINPDPETPLTPAEYPPGRLIALSDPSTAPAN |
| ⦗Top⦘ |