| Basic Information | |
|---|---|
| Family ID | F086020 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARELIEL |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 97.30 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 94.59 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.297 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.622 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.730 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.658 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00691 | OmpA | 76.58 |
| PF07676 | PD40 | 3.60 |
| PF13432 | TPR_16 | 0.90 |
| PF02577 | BFN_dom | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.30 % |
| Unclassified | root | N/A | 2.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106264667 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
| 3300001593|JGI12635J15846_10186471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1386 | Open in IMG/M |
| 3300001661|JGI12053J15887_10624341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100873837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101869617 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300002561|JGI25384J37096_10181537 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300003352|JGI26345J50200_1012036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300004080|Ga0062385_10537702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
| 3300004633|Ga0066395_10725505 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300004633|Ga0066395_10847039 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005174|Ga0066680_10330949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 972 | Open in IMG/M |
| 3300005187|Ga0066675_10979777 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300005332|Ga0066388_107469121 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005436|Ga0070713_100547023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
| 3300005529|Ga0070741_11253924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300005554|Ga0066661_10175148 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300005566|Ga0066693_10074832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1181 | Open in IMG/M |
| 3300005602|Ga0070762_11253770 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005921|Ga0070766_10409797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 889 | Open in IMG/M |
| 3300005950|Ga0066787_10068506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300005993|Ga0080027_10292039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300006174|Ga0075014_100856475 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006176|Ga0070765_100879417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300006755|Ga0079222_11343423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300006794|Ga0066658_10876019 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300009090|Ga0099827_11360424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300009792|Ga0126374_10707733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300010343|Ga0074044_10339859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
| 3300010359|Ga0126376_10667473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300010359|Ga0126376_13209647 | Not Available | 506 | Open in IMG/M |
| 3300010366|Ga0126379_11595383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → unclassified Acidipila → Acidipila sp. | 758 | Open in IMG/M |
| 3300010398|Ga0126383_11265068 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300010859|Ga0126352_1002578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300011269|Ga0137392_11068397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 662 | Open in IMG/M |
| 3300011271|Ga0137393_10284165 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300011444|Ga0137463_1174672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300012096|Ga0137389_10342428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
| 3300012202|Ga0137363_11630336 | Not Available | 537 | Open in IMG/M |
| 3300012203|Ga0137399_11018764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300012203|Ga0137399_11802113 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012351|Ga0137386_11049105 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012362|Ga0137361_11736003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012923|Ga0137359_11065181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300013297|Ga0157378_10246325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1709 | Open in IMG/M |
| 3300015054|Ga0137420_1233397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2136 | Open in IMG/M |
| 3300015193|Ga0167668_1068218 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300016319|Ga0182033_11502747 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300016404|Ga0182037_10799727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300017654|Ga0134069_1364838 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300017659|Ga0134083_10553649 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300017937|Ga0187809_10124188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300020004|Ga0193755_1224780 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300020199|Ga0179592_10265426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300020579|Ga0210407_10237800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1418 | Open in IMG/M |
| 3300020580|Ga0210403_11522943 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300020581|Ga0210399_10802573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300020583|Ga0210401_11419937 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300021168|Ga0210406_10632076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300021170|Ga0210400_11122940 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300021171|Ga0210405_10813471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300021307|Ga0179585_1186412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1143 | Open in IMG/M |
| 3300021402|Ga0210385_11198581 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300021420|Ga0210394_10592431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300021432|Ga0210384_10187918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1857 | Open in IMG/M |
| 3300021478|Ga0210402_11097677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300021559|Ga0210409_11575955 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300021560|Ga0126371_11846847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 725 | Open in IMG/M |
| 3300022504|Ga0242642_1034242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
| 3300022557|Ga0212123_10935144 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300022726|Ga0242654_10045688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1217 | Open in IMG/M |
| 3300024325|Ga0247678_1027609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 883 | Open in IMG/M |
| 3300024330|Ga0137417_1011827 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300025910|Ga0207684_10255566 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
| 3300025910|Ga0207684_11148799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300026285|Ga0209438_1201622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300026305|Ga0209688_1033916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300026318|Ga0209471_1207434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300026523|Ga0209808_1307602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300026551|Ga0209648_10008651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 8800 | Open in IMG/M |
| 3300026555|Ga0179593_1074245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2987 | Open in IMG/M |
| 3300027565|Ga0209219_1123408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300027605|Ga0209329_1056572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 840 | Open in IMG/M |
| 3300027643|Ga0209076_1034016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300027795|Ga0209139_10230683 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300027846|Ga0209180_10108624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1585 | Open in IMG/M |
| 3300027846|Ga0209180_10244672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300027862|Ga0209701_10028438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3638 | Open in IMG/M |
| 3300027884|Ga0209275_10027303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2606 | Open in IMG/M |
| 3300028037|Ga0265349_1004051 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300028146|Ga0247682_1084832 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300029636|Ga0222749_10443679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300030738|Ga0265462_10341875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300030862|Ga0265753_1039097 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300031057|Ga0170834_104986538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 886 | Open in IMG/M |
| 3300031122|Ga0170822_11939217 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031231|Ga0170824_109095052 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300031573|Ga0310915_10989408 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031720|Ga0307469_11938944 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031753|Ga0307477_10244718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300031753|Ga0307477_10881119 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300031754|Ga0307475_10283354 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1329 | Open in IMG/M |
| 3300031792|Ga0318529_10605523 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031912|Ga0306921_10005069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13625 | Open in IMG/M |
| 3300031942|Ga0310916_10883468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
| 3300031954|Ga0306926_10691365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1238 | Open in IMG/M |
| 3300032008|Ga0318562_10411987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300032025|Ga0318507_10122325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1099 | Open in IMG/M |
| 3300032035|Ga0310911_10875183 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300032174|Ga0307470_10878011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300032180|Ga0307471_103840444 | Not Available | 531 | Open in IMG/M |
| 3300033412|Ga0310810_11017564 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.62% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.41% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.60% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.70% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.90% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.90% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.90% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.90% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.90% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005950 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010859 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028037 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030738 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1062646673 | 3300000955 | Soil | MRMRNVVMFSAAILAGGLAGSMVGPRPAEAVARELIEL |
| JGI12635J15846_101864711 | 3300001593 | Forest Soil | MRFRNLAAFSAAILAGAIAGSLIGPRPAEAVARELIE |
| JGI12053J15887_106243411 | 3300001661 | Forest Soil | MRVRNIAIFSAAVMAGALGGSLMGPRPAEAVARELIE |
| JGIcombinedJ26739_1008738373 | 3300002245 | Forest Soil | MRVRNIAIFSAAVLAGALGGSLIGPRPAEAVARELI |
| JGIcombinedJ26739_1018696172 | 3300002245 | Forest Soil | MRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARELIELQRDVTS |
| JGI25384J37096_101815372 | 3300002561 | Grasslands Soil | MRTRDLALFGAAMLAGAIGGSLIGPRTAEAVAREIIELQQ |
| JGI26345J50200_10120361 | 3300003352 | Bog Forest Soil | MKIRNIVVFAAAVLAGALGGSIIGPRPAEAVAREILDLQR |
| Ga0062385_105377021 | 3300004080 | Bog Forest Soil | MRLRNIAIFSAFILVAAICGSLVGPRPAQAVAREIIELQHD |
| Ga0066395_107255051 | 3300004633 | Tropical Forest Soil | MRIRDIAIFSAAVFSSAICGSLMGPRPAEAVAREIIDLQRDLT |
| Ga0066395_108470391 | 3300004633 | Tropical Forest Soil | MRIRNIAAFSAAILAGAICGSLIGPRPVEAVAREIIDLQRDVTS |
| Ga0066680_103309491 | 3300005174 | Soil | MRIRNIAIFSAAVLAGALAGSLVGPRPAEAVARELIELQRDVTSLL |
| Ga0066675_109797771 | 3300005187 | Soil | MRIRNIAIFSAAVLAGAIGGSLMGPRPAEAVAREIIDLQRDVT |
| Ga0066388_1074691211 | 3300005332 | Tropical Forest Soil | MRMRNVAIFAAAVLLGAFFGSLMGPHPAEAVAREIIDLQRD |
| Ga0070713_1005470231 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVRNIVIFSAAVMAGALGGSLMGPRPAEAVARELIELQRDVTSVLQ |
| Ga0070741_112539241 | 3300005529 | Surface Soil | MRLRNLAGFGAALVAGAICGSLIGPRPAQAVAREIIELQRDVT |
| Ga0066661_101751483 | 3300005554 | Soil | MRIRHIAIFSAAVLAGALTGSLVGPRPAEAVARELIEL |
| Ga0066693_100748322 | 3300005566 | Soil | MRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARELIELQRDVT |
| Ga0070762_112537702 | 3300005602 | Soil | MKIRTIVIFAAAVFAGALGGSLIGPRPAQAVAREIIDLQRDVTT |
| Ga0070766_104097972 | 3300005921 | Soil | MKIRTIVIFAAAVFAGALGGSLIGPRPAQAVAREIID |
| Ga0066787_100685061 | 3300005950 | Soil | MRLRNIAMFSAIILVAAICGSMLGPRPAGAVAREIIDLQH |
| Ga0080027_102920391 | 3300005993 | Prmafrost Soil | MRLRNIAMFSAIILVAAICGSMLGPRPAGAVAREIIDLQHD |
| Ga0075014_1008564751 | 3300006174 | Watersheds | MRIRNLATFGAAALAGVIFGSLLGPRPVAAVARELIELQRDVT |
| Ga0070765_1008794172 | 3300006176 | Soil | MRIRHIAIFSAAVLAGALAGSLIGPRPAEAVARELIELQRDV |
| Ga0079222_113434233 | 3300006755 | Agricultural Soil | MRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARELIELQRDV |
| Ga0066658_108760192 | 3300006794 | Soil | MRIRHIAIFSAAVLAGALTGSLVGPRPADAVARELIELQRHVPS |
| Ga0099827_113604242 | 3300009090 | Vadose Zone Soil | MRIRHIAIFSAAVLAGALGGSLVGPRPAEAVARELIEL |
| Ga0126374_107077331 | 3300009792 | Tropical Forest Soil | MRNVAIFAAAVLLGAFFGSLMGPHPAEAVAREIIDLQRDV |
| Ga0074044_103398592 | 3300010343 | Bog Forest Soil | MKIRTIVIFAAAVFAGALGGSLIGPRPAEAVAREIIDLQ |
| Ga0126376_106674731 | 3300010359 | Tropical Forest Soil | MRNVAIFAAAVLLGAFFGSLRGPHPAKAVAREIIDLQRDVTS |
| Ga0126376_132096472 | 3300010359 | Tropical Forest Soil | MRARNIAIFSAALLAGAIGGSVIGPRPAEAVAREILELQHDVTSI |
| Ga0126379_115953831 | 3300010366 | Tropical Forest Soil | MRIRNVAIFGAAVMAGALVGSLAGPRPASAVARELIELQRD |
| Ga0126383_112650682 | 3300010398 | Tropical Forest Soil | MRIRDIAIFSAAVFSSAICGSLVGPRPAEAVAREIID |
| Ga0126352_10025781 | 3300010859 | Boreal Forest Soil | MKIRTIAIFAAAIFAGALGGSLVGPRPAEAVAREIIDL |
| Ga0137392_110683972 | 3300011269 | Vadose Zone Soil | MRIRHIAIFSAAVLAGALTGSLVGPRPAEAVAREIIELQR |
| Ga0137393_102841651 | 3300011271 | Vadose Zone Soil | MRARNIAIFSAAVVAGAIVGSAVGPRPAQAVARELIELQHDVTT |
| Ga0137463_11746721 | 3300011444 | Soil | MRIRNVAIFSTAVLAGALAGSLVGPRPAEAVAREL |
| Ga0137389_103424281 | 3300012096 | Vadose Zone Soil | MRARNIAIFSAAVVAGAIVGSAVGPRPAQAVARELIELQHDVT |
| Ga0137363_116303361 | 3300012202 | Vadose Zone Soil | LAKPGWHASLVDTEEEFFMRFRNLAGFAAALLIGALCGSLIGPRPAEAVA |
| Ga0137399_110187641 | 3300012203 | Vadose Zone Soil | MRFRNVAMFGAAMLIGVLAGSLIGPAPVNAVARELIEL |
| Ga0137399_118021132 | 3300012203 | Vadose Zone Soil | MFSAAVLAGALAGSLVGPRPAEAVARELIELQRDV |
| Ga0137386_110491051 | 3300012351 | Vadose Zone Soil | MRIRHIAIFSAAVLAGALAGSLVGPHPAEAVARELIE |
| Ga0137361_117360032 | 3300012362 | Vadose Zone Soil | MRIRHIAIFSAAVLAGALTGSLVGPRPAEAVARELIELQ |
| Ga0137359_110651812 | 3300012923 | Vadose Zone Soil | MFMRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARE |
| Ga0157378_102463251 | 3300013297 | Miscanthus Rhizosphere | MRFRNIAAFGVALGVGAVCGSLIGPRPARAVAREIIELQ |
| Ga0137420_12333971 | 3300015054 | Vadose Zone Soil | MRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARELIESSFS |
| Ga0167668_10682181 | 3300015193 | Glacier Forefield Soil | MRVRNIAIFSAAVLAGALGGSLVGPRPAEAVAREL |
| Ga0182033_115027471 | 3300016319 | Soil | MRFRNFAAFGCALMAGAICGSLIGPRPAQAVAREIIELQRDVTTL |
| Ga0182037_107997271 | 3300016404 | Soil | MRIRNIAAFSAAILAGAICGSLIGPRPVEAVAREI |
| Ga0134069_13648381 | 3300017654 | Grasslands Soil | MRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARELIEL |
| Ga0134083_105536491 | 3300017659 | Grasslands Soil | MRMRNVAMFSAAILAGALAGSLVGPRPAEAVAREI |
| Ga0187809_101241882 | 3300017937 | Freshwater Sediment | MRLRNIVIFGAVMLAAAIAGSLVGPRPAEAVAREIVEL |
| Ga0193755_12247801 | 3300020004 | Soil | MRFRNLAGFAAALLIGALCGSLIGPRPAEAVAREIIELQRDV |
| Ga0179592_102654261 | 3300020199 | Vadose Zone Soil | MRVRNIAIFSAAVLAGALGGSLIGPRPAEAVARELIELQHDVTSLLQ |
| Ga0210407_102378002 | 3300020579 | Soil | MRVRNIAIFSAAVLAGALGGSLVGPRPAEAVARELIELQHDVTSLLQ |
| Ga0210403_115229432 | 3300020580 | Soil | MRIRNVVVFSAAIFAGASAGSLVGPRPAEAVAREMIEL |
| Ga0210399_108025732 | 3300020581 | Soil | MRIRHIAVFGAAVLFGALAGSLLGPRPAEAVAREILDLQRD |
| Ga0210401_114199372 | 3300020583 | Soil | MRLRNIAIFSAFILIAAICGSLVGPRPAEAVAREI |
| Ga0210406_106320761 | 3300021168 | Soil | MRHRNIAIFSAAALAGIIAGSAVGPRPAEAVARELIELQRDVSTLL |
| Ga0210400_111229402 | 3300021170 | Soil | MRVRNIAIFSAAVLAGALGGSLVGPRPAEAVAREIIELQHDVTSLLQ |
| Ga0210405_108134711 | 3300021171 | Soil | MRIRNIAILGAAVLAGALAGSLAGPRPAEAVNREIVDLQRDV |
| Ga0179585_11864121 | 3300021307 | Vadose Zone Soil | MRIRHIAIFSAAVLAGTLAGSLVGPRPAEAVARELIELQRDV |
| Ga0210385_111985812 | 3300021402 | Soil | MKIRTIAIFAAAVFAGAIAGNLVGPRPAEAVAREIIDLQRDV |
| Ga0210394_105924311 | 3300021420 | Soil | MKIRTIVIFAAAVFAGALGGSLIGPRPAEAVAREI |
| Ga0210384_101879181 | 3300021432 | Soil | MRIRNVVVFSAALMAGALAGSLVGPRTAEAVAREMIEL |
| Ga0210402_110976772 | 3300021478 | Soil | MRIRNIAIFSAVILASALGGSLVGPRPAEAVARELIELQRDVT |
| Ga0210409_115759552 | 3300021559 | Soil | MRTRHIAVFGAAALAGLIAGSLMGPRPVQAVAREII |
| Ga0126371_118468471 | 3300021560 | Tropical Forest Soil | MRIRDIAIFSAAVFSSAICGSLVGPRPAEAVAREIIDLQRDLT |
| Ga0242642_10342421 | 3300022504 | Soil | MRIRNVVVFSAALMAGALAGSLVGPRTAEAVAREMIELQRD |
| Ga0212123_109351441 | 3300022557 | Iron-Sulfur Acid Spring | MRYRNIAIFSAAALAGLIAGSAVGPRPAEAVARELIELQRDVSTLLQ |
| Ga0242654_100456882 | 3300022726 | Soil | MRIRHIAVFGAAVLFGALAGSLLGPRPAEAVAREILDL |
| Ga0247678_10276091 | 3300024325 | Soil | MRIRNIFIFAAAVFAGALGGSIIGPRPAEAVAREIIDL |
| Ga0137417_10118271 | 3300024330 | Vadose Zone Soil | MRIRHIVIFSAAVLAGALAGSLVGPRPAEAVAREMIEL |
| Ga0207684_102555663 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRYRNLAGFGAALVVGAICGSLVGPRPAAAVAREIIELQ |
| Ga0207684_111487991 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIRNIAIFGAAVLAGAIGGSLMGPRPVEAVAREIIDLQ |
| Ga0209438_12016221 | 3300026285 | Grasslands Soil | MRIRHIAIFSSAVLAGALAGSLIGPRPAEAVAREIIELQRD |
| Ga0209688_10339162 | 3300026305 | Soil | MRIRHIAIFSAAVLAGALAGSLVGPHPAEAVARELIELQRD |
| Ga0209471_12074341 | 3300026318 | Soil | MRIRHIAIFSAAVLAGALTGSLVGPRPAEAVARELIELQRDVT |
| Ga0209808_13076021 | 3300026523 | Soil | MRIRNIAIFSAVVLAGAICGSLMGPRPVEAVAREIID |
| Ga0209648_100086519 | 3300026551 | Grasslands Soil | MRIRHIAIFSAAVLAGALAGSLVGPRPAEAVARELI |
| Ga0179593_10742454 | 3300026555 | Vadose Zone Soil | MRVRNIAIFSAAVLAGALGGSLIGPRPAEAVARELIE |
| Ga0209219_11234081 | 3300027565 | Forest Soil | MQMRHIAIFSAAVLAGAVGGSLIGPRPAEAVARELIEL |
| Ga0209329_10565722 | 3300027605 | Forest Soil | MRHRNIAIFSAAALAGIIAGSAVGPRPAAAVARELIE |
| Ga0209076_10340162 | 3300027643 | Vadose Zone Soil | MRVRNIAIFSAAVLAGALGGSLVGPRPAEAVARELVELQHDVTSL |
| Ga0209139_102306831 | 3300027795 | Bog Forest Soil | MRLRNIAIFSAFILVAAICGSLVGPRPAQAVAREIIEL |
| Ga0209180_101086243 | 3300027846 | Vadose Zone Soil | MRLRNIAIFSAAVLAGALGGSLVGPHPAEAVARELVELQH |
| Ga0209180_102446722 | 3300027846 | Vadose Zone Soil | MRARNIAIFSAAVVAGAIVGSAVGPRPAQAVAREL |
| Ga0209701_100284385 | 3300027862 | Vadose Zone Soil | MRIRHIAIFSAAVLAGALAGNLVGPRPAEAVAREL |
| Ga0209275_100273031 | 3300027884 | Soil | MKIRTIVIFAAAVFAGALGGSLIGPRPAEAVAREIIDLQRD |
| Ga0265349_10040511 | 3300028037 | Soil | MKIRTIVLFAAAIFAGALGGSLIGPRPAEAVAREIIDLQRDVTTLL |
| Ga0247682_10848321 | 3300028146 | Soil | MRFRNVAMFGAAMLAGLMAGSLMGPAPVNAVARELIEL |
| Ga0222749_104436792 | 3300029636 | Soil | MRIRNIVIFSAAVLAGALGGSLIGPRPAEAVARELI |
| Ga0265462_103418752 | 3300030738 | Soil | MKIRTIVIFAAAVFAGALGGSLIGPRPAEAVAREIMK |
| Ga0265753_10390971 | 3300030862 | Soil | MKIRTIVLFAAAIFAGALGGSLIGPRPAEAVAREIIDLQRDV |
| Ga0170834_1049865381 | 3300031057 | Forest Soil | MRFRNLAGFAAALIIGALCGSLIGPKPAQAVAREIIELQRD |
| Ga0170822_119392172 | 3300031122 | Forest Soil | VDTEEEFFMRFRNLAGFAAALLIGALCGSLIGPRPAEAVAR |
| Ga0170824_1090950522 | 3300031231 | Forest Soil | MRVRNIAIFSGAILAGALGGSLIGPRPAEAVAREL |
| Ga0310915_109894081 | 3300031573 | Soil | MRFRNLAAFGAALVVGAICGSLIGPRPAHAVAREIIE |
| Ga0307469_119389441 | 3300031720 | Hardwood Forest Soil | MRYRNLAGFGAALVVGAICGSLIGPRPAAAVAREIIE |
| Ga0307477_102447182 | 3300031753 | Hardwood Forest Soil | MRIRHIAVFSAAVLAGALAGSLVGPRPAEAVARELILLQQDVTS |
| Ga0307477_108811192 | 3300031753 | Hardwood Forest Soil | MRLRNIAIFMAFIFVAAVAGSLVGPRPAQAVAREIIELQHDVTTLLQ |
| Ga0307475_102833542 | 3300031754 | Hardwood Forest Soil | MRYRNIAIFSAAALAGVIAGSAVGPRPAEAVARELIELQRDVST |
| Ga0318529_106055231 | 3300031792 | Soil | MRIRNIAVFSAAIFAGAVCGSLIGPRPVEAVAREIID |
| Ga0306921_1000506913 | 3300031912 | Soil | MRFRNLAAFGAALVVGAICGSLIGPRPAHAVAREIIELQRDVT |
| Ga0310916_108834681 | 3300031942 | Soil | MRFRNFAAFGCALMAGAICGSLIGPRPAQAVAREIIE |
| Ga0306926_106913652 | 3300031954 | Soil | MRFRNLAGFAAALLIGALCGSLIGPRPAQAVAREIIELQ |
| Ga0318562_104119872 | 3300032008 | Soil | MRFRNLAAFGAALVVGAICGSLIGPRPALAVAREIIELQRDVTTLL |
| Ga0318507_101223252 | 3300032025 | Soil | MRIRNIAVFSAAIFAGAVCGSLIGPRPVEAVAREII |
| Ga0310911_108751832 | 3300032035 | Soil | MRFRNLAAFGAALVVGAICGSLIGPRPALAVAREIIEL |
| Ga0307470_108780112 | 3300032174 | Hardwood Forest Soil | MRIRNIAIFSAAALGGLIAGSLMGPSPVHAVAREIIELQRVVTNI |
| Ga0307471_1038404441 | 3300032180 | Hardwood Forest Soil | MRYRNLAGFGAALLVGAICGNLIGPRPVNAVSREIVE |
| Ga0310810_110175642 | 3300033412 | Soil | MRIRNIAIFSGAALGGLVAGSLMGPSPVNAVAREIIELQRDV |
| ⦗Top⦘ |