| Basic Information | |
|---|---|
| Family ID | F086013 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIK |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.45 % |
| % of genes near scaffold ends (potentially truncated) | 98.20 % |
| % of genes from short scaffolds (< 2000 bps) | 92.79 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (88.288 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (38.739 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.865 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.459 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.27% β-sheet: 0.00% Coil/Unstructured: 72.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13560 | HTH_31 | 4.50 |
| PF02796 | HTH_7 | 1.80 |
| PF13403 | Hint_2 | 1.80 |
| PF13481 | AAA_25 | 0.90 |
| PF09339 | HTH_IclR | 0.90 |
| PF16363 | GDP_Man_Dehyd | 0.90 |
| PF00196 | GerE | 0.90 |
| PF13817 | DDE_Tnp_IS66_C | 0.90 |
| PF00226 | DnaJ | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 88.29 % |
| All Organisms | root | All Organisms | 11.71 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 38.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.83% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AF_2010_repII_A001DRAFT_100379201 | 3300000793 | Forest Soil | MMAPMAQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGD |
| AP72_2010_repI_A100DRAFT_10221763 | 3300000837 | Forest Soil | DMTHIDQDLSAALYLLGFSLLRGDLGEIAEIRGAT* |
| JGI10216J12902_1208862111 | 3300000956 | Soil | MQIDQDLYAALYVLGFNFLDGHLVSGEIAEIKGDMTIKLV |
| Ga0066388_1005018971 | 3300005332 | Tropical Forest Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLVHPPG |
| Ga0066388_1057296691 | 3300005332 | Tropical Forest Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLV |
| Ga0066903_1004667621 | 3300005764 | Tropical Forest Soil | MDNTQIDQELRAALYLLSFNILGGDLLSAEIAEIKGNMTRTYLKIA* |
| Ga0066903_1011856886 | 3300005764 | Tropical Forest Soil | MQIDQTLFATLYLLGFNFLGGDLFSGEIAEIKGDMTIK |
| Ga0066903_1019393422 | 3300005764 | Tropical Forest Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKG |
| Ga0066903_1024773352 | 3300005764 | Tropical Forest Soil | MMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDMT |
| Ga0066903_1033877513 | 3300005764 | Tropical Forest Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIKL |
| Ga0066903_1037295843 | 3300005764 | Tropical Forest Soil | MHIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDMAIKLVHPP |
| Ga0066903_1042568952 | 3300005764 | Tropical Forest Soil | MATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIK |
| Ga0066903_1044913871 | 3300005764 | Tropical Forest Soil | MTHIDQDLSAALYMLGFKLLGGDLLSEEIAEIKGDMTIKL |
| Ga0066903_1054483332 | 3300005764 | Tropical Forest Soil | MGNTQIDQNLFAALYMLGFNFSGRDLSSGEIAEIKGNM |
| Ga0070712_1000365501 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MCNTQIDQELRAALYLLGFNFLGGDFLSGEIAEIKGNMTIK |
| Ga0066660_115386791 | 3300006800 | Soil | MANTQIDQNLCAALYLLGFNFLVGDLFSGEIAEIS |
| Ga0126374_102878591 | 3300009792 | Tropical Forest Soil | MQIDQDLHAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLVHRPG |
| Ga0126384_118361151 | 3300010046 | Tropical Forest Soil | MTHIDQDLSAALYLLGFSLLRGDLGEIAEIKGEMII |
| Ga0126384_118845361 | 3300010046 | Tropical Forest Soil | MMQIDQDLYAALYVLGFNFLEGDLVEIAEIKGDMTIKLVHPPGEE |
| Ga0126382_108309803 | 3300010047 | Tropical Forest Soil | MDNAQIDQELRAALYWLGFNFLGGDLFSGEIAEIKGDMTIKLVH |
| Ga0126373_126793711 | 3300010048 | Tropical Forest Soil | MAQIDQNLSAALYMLGFKLLGGDLLSEKIAEIKGDMTIT |
| Ga0126372_114632211 | 3300010360 | Tropical Forest Soil | MGNTQIDQDLRAALYLLGFNFLGGDLLSGEIAEIKGDMTIK |
| Ga0126372_122443902 | 3300010360 | Tropical Forest Soil | MDNAQIDQELRAALYLLGFNFLGGDPFSGEIAEIKG |
| Ga0126378_112856564 | 3300010361 | Tropical Forest Soil | MMRIDQNLFAALYVLGFNFLGGDRLSGEIAEIKGDMTIKLVHPPG |
| Ga0126378_120353331 | 3300010361 | Tropical Forest Soil | MDNTQIDQDLSAALYLLGFSLLRGDLGEIAEIKGDMTIK |
| Ga0126378_121149141 | 3300010361 | Tropical Forest Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDMT |
| Ga0126379_105081751 | 3300010366 | Tropical Forest Soil | MMQIDQNLSAALYMLGFKLSGGDLLRGEIAEIKGD |
| Ga0126383_122038711 | 3300010398 | Tropical Forest Soil | MDNTQIDQDLRATLYLLGFNFLGGDLLSGEIAEIKGDMTIKLVHPP |
| Ga0126369_112114581 | 3300012971 | Tropical Forest Soil | MQIDQDLCAALYLLGFNSLDGDLVSGEIAEIKGEMTIKLVHPPGEE |
| Ga0126369_122790961 | 3300012971 | Tropical Forest Soil | MDNAQTDQELRAALYLLGFNFLGGDLFRGEIAEIKG |
| Ga0126369_122919293 | 3300012971 | Tropical Forest Soil | MMRIDQNLFAALYVLGFNFLDSDHFSGEIAEIKGDMTIKLVHPP |
| Ga0182036_105990692 | 3300016270 | Soil | MVNTQSDQDLFATLYLLGFNFLGGDSGEIAEIKGDMTIKLVHSPGE |
| Ga0182036_109326211 | 3300016270 | Soil | MTHIDQDLSAALYMLGFKLLGGDLLSEEIAEIKGDMTIKLVHPRGDP |
| Ga0182041_111965112 | 3300016294 | Soil | MQIDQDLHAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLVHPPG |
| Ga0182033_106664012 | 3300016319 | Soil | MQIDQDLYAALYLLGFNFLGGDSGEIAEIKGDMTIKLVHSP |
| Ga0182033_117684931 | 3300016319 | Soil | MTHVDQDLSAALYLLGFSLLRGDLGEIAEIKGDMTIKLVH |
| Ga0182033_118225131 | 3300016319 | Soil | MGNTQSDQDLFAALYLLGFNFLGGDSGEIAEIKGDMTIK |
| Ga0182035_118890821 | 3300016341 | Soil | MMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDM |
| Ga0182035_119915151 | 3300016341 | Soil | MGNTQSDQDLFAALYLLGFNFLGGDSGEIAEIKGDMTIKLVH |
| Ga0182040_101568473 | 3300016387 | Soil | MQIDQDLCAALYVLGFNSLDGDLVSGEIAEIKGEMTI |
| Ga0182037_109851351 | 3300016404 | Soil | MVNTQSDQDLFATLYLLGFNFLGGDSGEIAEIKGD |
| Ga0182039_100617547 | 3300016422 | Soil | MMQIDQNLFAALYVLGFNFLDGDLFSGEIAEIKGDMTIK |
| Ga0182039_107594421 | 3300016422 | Soil | MVNTQSDQDLFATLYLLGFNFLGGDSGEIAEIKGDMTIKLVH |
| Ga0182038_112846941 | 3300016445 | Soil | MQTDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLMHP |
| Ga0066669_112704981 | 3300018482 | Grasslands Soil | MGNTQIDQSLSAALYLLGFNFLGGDHFGGEIAEIKGDMT |
| Ga0210403_109473381 | 3300020580 | Soil | MGNTQIDQNLFAALYMLGFNFLDGDLSSGEIAEIKGDMTIKLVRPP |
| Ga0210408_104107591 | 3300021178 | Soil | MANTQIDQNLSAALYLLGFNFLGGDLFSGEIAEIRGDMTV |
| Ga0210387_108148011 | 3300021405 | Soil | MGNTQIDQNLFAALYMLGFNFLDGDLSSGEIAEIKGDM |
| Ga0179589_100633261 | 3300024288 | Vadose Zone Soil | MGNTQIDQNLFAALYMLGFNFLDGDLSSGEIAEIK |
| Ga0207685_104425252 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNAQIDQELRAALYLLGFNFLGGDFLSGEIAEIKGNMT |
| Ga0207699_103344731 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDNAQIDQELRAALYLLGFNFLGGDFLSGEIAEIKGNMTIKLVHPP |
| Ga0207664_106235803 | 3300025929 | Agricultural Soil | MGNTQIDQELRAALYLLGFNFLGGDFLSGEIAEIKGNMTIK |
| Ga0318541_106158921 | 3300031545 | Soil | MQIDQDLCAALYVLGFNFLEGDLVSGEIAEIKGEM |
| Ga0318538_101260391 | 3300031546 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTI |
| Ga0318528_101376742 | 3300031561 | Soil | MTHIDQDLSAALYMLGFKLLGGDPLSEEIAEIKGD |
| Ga0318573_106492021 | 3300031564 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGVIAEIKGDMTIKLVH |
| Ga0310915_104730492 | 3300031573 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMT |
| Ga0318574_100812383 | 3300031680 | Soil | MQIDQNLFATLYLLGFNFLGGDLFSGEIAGIKGDMTIKLVHPP |
| Ga0318493_105044851 | 3300031723 | Soil | MTQIDQNLLAALYVLGFNFLGGDLFSGEIAEIKGDM |
| Ga0318501_103184721 | 3300031736 | Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDM |
| Ga0306918_102571982 | 3300031744 | Soil | MQIDQDLYAALYLLGFNFLGGDSGEIAEIKGDMTIKLVHSPGEE |
| Ga0306918_106219051 | 3300031744 | Soil | MQIDQDLYAALYLLGFNFMGGDLVSGEIAQIKGDMTIKLVHPPG |
| Ga0318509_105091611 | 3300031768 | Soil | MMRIDQNLFAALYVLGFNFLDSDHFSGEIAEIKGDMTIK |
| Ga0318521_108519571 | 3300031770 | Soil | MTHIDQDLSAALYMLGFSLLRGDLSSGEIAEIKGDMTIKLVH |
| Ga0318543_104007921 | 3300031777 | Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEVKGDMTIKLVHP |
| Ga0318529_100116281 | 3300031792 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDLTI |
| Ga0318548_104737951 | 3300031793 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIK |
| Ga0318557_105216621 | 3300031795 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGVIAEIKGDMTI |
| Ga0318576_104753721 | 3300031796 | Soil | MGNTQIDQTLLATLHLLGFNFLGGDLLSGEIAEIKGDMTIKLV |
| Ga0310917_102188152 | 3300031833 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLVHR |
| Ga0310917_104278801 | 3300031833 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGVIAEIKGDMTIKLVHRPGEEL |
| Ga0310917_105478481 | 3300031833 | Soil | MMRIDQNLFAALYVLGFNFLDGDHFSGEIAEIKDDMTI |
| Ga0310917_106227502 | 3300031833 | Soil | MDNTQIDQDLSAALYLLGFSLLRGDLGEIAEIKGDMTI |
| Ga0310917_107900301 | 3300031833 | Soil | MQIDQDLHAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLVHPPGEE |
| Ga0306919_114965891 | 3300031879 | Soil | MQIDQDLYAALYVLGFNFLEGDLVEIAEIKGDMTI |
| Ga0318544_101318722 | 3300031880 | Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIK |
| Ga0318544_102206841 | 3300031880 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGVIAEIKGDMTIKLVHR |
| Ga0306925_101722431 | 3300031890 | Soil | MMQIDQNLFAALYVLGFNFLDGDLFSGEIAEIKGDMTIKL |
| Ga0306925_103448995 | 3300031890 | Soil | MQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDMAIK |
| Ga0306925_112513252 | 3300031890 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLVH |
| Ga0318536_105500141 | 3300031893 | Soil | LLYDNHGATMMATMMQIDQNLSAALYMLGFKLLGGDLLSGEMAEIK |
| Ga0306923_100955615 | 3300031910 | Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEMAEIKGDMTIK |
| Ga0306923_102939921 | 3300031910 | Soil | MMQIDQNLFAALYVLGFNFLDGDLFSGEIAEIKGD |
| Ga0306923_114407971 | 3300031910 | Soil | MGNTQTDQNLFAALQLLGFNFLGGDFLSGEIAEIKGD |
| Ga0306921_100809711 | 3300031912 | Soil | MMQIDQNLFAALYVLGFNFLDGDLFSGEIAEIKGDMT |
| Ga0306921_109049561 | 3300031912 | Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDMTIKL |
| Ga0306921_110966861 | 3300031912 | Soil | MQIDQDLYAALYVLGFNFLDGDLVCGEIAEIKGDMT |
| Ga0306921_119880041 | 3300031912 | Soil | MGNTQIDQTLLATLHLLGFNFLGGDFFSGAIAEIKGD |
| Ga0310912_106437831 | 3300031941 | Soil | MGNTQSDQDLFAALYLLGFNFLGGDSGEIAEIKGDM |
| Ga0310912_109204662 | 3300031941 | Soil | MGNTQIDQTLLATLHLLGFNFLGSDLLSGEIAEIKGDM |
| Ga0310913_106488601 | 3300031945 | Soil | MMQIDQNLFAALYVLGFNFLDGDLFSGEIAEIKGDMTI |
| Ga0310910_105211391 | 3300031946 | Soil | MQIDQNLSAALYMLGFKLLGGSAEIAEIKGDMTIKLVH |
| Ga0310909_106376303 | 3300031947 | Soil | MQIDQDLYAALYLLGFNFLGGDSGEIAEIKGDMTIK |
| Ga0306926_119146041 | 3300031954 | Soil | MQIDQDLHAALYVLGFNFLDGDLVSGEIAEIKGDMTIKLV |
| Ga0306926_120680871 | 3300031954 | Soil | MMQIDQNLFAALYLLGFNFLGGDRFSGEIAEIKGDMTI |
| Ga0306922_109920711 | 3300032001 | Soil | MMRIDQNLFAALYVLGFNFLDGDHFSGEIAEIKGDMTIKLVHPPG |
| Ga0310911_103757891 | 3300032035 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDM |
| Ga0318559_106126821 | 3300032039 | Soil | MGNTQTDQNLFAALQLLGFNFLGGDFLSGEIAEIK |
| Ga0318545_101532531 | 3300032042 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGVIAEIKGDMT |
| Ga0318532_101364302 | 3300032051 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGVIAEIKGDM |
| Ga0318575_106586021 | 3300032055 | Soil | MGNTQIDQTLLATLHLLGFNFLGSDLLSGEIAEIKGDMTIKLVHP |
| Ga0318504_101631381 | 3300032063 | Soil | MQIDQDLYAALYVLGFNFLDGDLVCGEIAEIKGDMTI |
| Ga0318553_100290461 | 3300032068 | Soil | MQIDQNLFATLYLLGFNFLGGDLFSGEIAGIKGDMTIK |
| Ga0318553_101095943 | 3300032068 | Soil | MQIDQDLYAALYVLGFNFLDGDLVSGEIAEIKGDLTIK |
| Ga0306924_107739932 | 3300032076 | Soil | MMQIDQISAALYMLGFKLLGGDLSSGEIAEIKGDMTIK |
| Ga0318577_103230401 | 3300032091 | Soil | MMQIDQNLFAALYLLGFNFLGGDRFSGEIAEIKGDMT |
| Ga0306920_1013065061 | 3300032261 | Soil | MMATMMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGD |
| Ga0306920_1018425131 | 3300032261 | Soil | MQIDQDLIAALYVLGFNFLGGDLVSGEIAEIKGDITIKLVHPPGE |
| Ga0310914_105636371 | 3300033289 | Soil | MMQIDQNLSAALYMLGFKLLGGDLLSGEIAEIKGDMAIKLV |
| Ga0310914_114105151 | 3300033289 | Soil | MTHTDQDLSAALYLLGFSLLRGDLGEIAEIRGDMTIKGTGLG |
| Ga0318519_109989211 | 3300033290 | Soil | MQIDQDLYAALYVLGFNFLDGDRVSGEIAEIKGDMTIK |
| ⦗Top⦘ |