NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F085998

Metagenome Family F085998

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F085998
Family Type Metagenome
Number of Sequences 111
Average Sequence Length 43 residues
Representative Sequence MAGTLLFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAK
Number of Associated Samples 99
Number of Associated Scaffolds 111

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 2.70 %
% of genes near scaffold ends (potentially truncated) 91.89 %
% of genes from short scaffolds (< 2000 bps) 97.30 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (54.955 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.117 % of family members)
Environment Ontology (ENVO) Unclassified
(41.441 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(46.847 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 30.00%    Coil/Unstructured: 70.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 111 Family Scaffolds
PF13847Methyltransf_31 23.42
PF08241Methyltransf_11 5.41
PF10049DUF2283 5.41
PF02353CMAS 5.41
PF13649Methyltransf_25 1.80
PF00156Pribosyltran 0.90
PF13473Cupredoxin_1 0.90
PF01850PIN 0.90
PF00144Beta-lactamase 0.90
PF13449Phytase-like 0.90
PF02775TPP_enzyme_C 0.90
PF17147PFOR_II 0.90
PF02626CT_A_B 0.90
PF13772AIG2_2 0.90
PF07927HicA_toxin 0.90
PF03848TehB 0.90
PF01804Penicil_amidase 0.90
PF02604PhdYeFM_antitox 0.90

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 111 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 5.41
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 5.41
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 5.41
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.90
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.90
COG1724Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase familyGeneral function prediction only [R] 0.90
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.90
COG2366Acyl-homoserine lactone (AHL) acylase PvdQSecondary metabolites biosynthesis, transport and catabolism [Q] 0.90
COG2367Beta-lactamase class ADefense mechanisms [V] 0.90
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A54.95 %
All OrganismsrootAll Organisms45.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02F24CIAll Organisms → cellular organisms → Bacteria520Open in IMG/M
3300000890|JGI11643J12802_12241152All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300000955|JGI1027J12803_101305892Not Available683Open in IMG/M
3300000955|JGI1027J12803_101619630All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium703Open in IMG/M
3300000955|JGI1027J12803_102300328All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300000955|JGI1027J12803_102415794All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300000956|JGI10216J12902_117099759All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia549Open in IMG/M
3300002099|JGI24808J26613_1029698Not Available796Open in IMG/M
3300002128|JGI24036J26619_10008787Not Available1810Open in IMG/M
3300004480|Ga0062592_101616106Not Available627Open in IMG/M
3300005167|Ga0066672_10901599All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia547Open in IMG/M
3300005175|Ga0066673_10696027All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005179|Ga0066684_10407197Not Available914Open in IMG/M
3300005290|Ga0065712_10266491Not Available920Open in IMG/M
3300005294|Ga0065705_10320399Not Available1012Open in IMG/M
3300005339|Ga0070660_100573865All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300005365|Ga0070688_100313904Not Available1137Open in IMG/M
3300005434|Ga0070709_11297191Not Available587Open in IMG/M
3300005439|Ga0070711_100341457All Organisms → cellular organisms → Bacteria1202Open in IMG/M
3300005457|Ga0070662_100900166Not Available755Open in IMG/M
3300005548|Ga0070665_100848583Not Available926Open in IMG/M
3300005598|Ga0066706_10135715All Organisms → cellular organisms → Bacteria1834Open in IMG/M
3300005713|Ga0066905_100755392Not Available839Open in IMG/M
3300005764|Ga0066903_106490846Not Available609Open in IMG/M
3300005843|Ga0068860_101387743Not Available724Open in IMG/M
3300005937|Ga0081455_10159159All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1733Open in IMG/M
3300005937|Ga0081455_10580826All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium734Open in IMG/M
3300006175|Ga0070712_100281048Not Available1341Open in IMG/M
3300006800|Ga0066660_10190979All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1554Open in IMG/M
3300006844|Ga0075428_101052230Not Available860Open in IMG/M
3300006852|Ga0075433_10565567All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia999Open in IMG/M
3300006871|Ga0075434_102285257All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia544Open in IMG/M
3300009012|Ga0066710_101891496Not Available894Open in IMG/M
3300009012|Ga0066710_102773106All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300009098|Ga0105245_12171374Not Available609Open in IMG/M
3300009147|Ga0114129_11871095Not Available728Open in IMG/M
3300009802|Ga0105073_1054151All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300010040|Ga0126308_10552640Not Available782Open in IMG/M
3300010046|Ga0126384_10332659All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1260Open in IMG/M
3300010047|Ga0126382_10489810All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300010047|Ga0126382_11087996Not Available708Open in IMG/M
3300010323|Ga0134086_10322929All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium604Open in IMG/M
3300010326|Ga0134065_10220064All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300010337|Ga0134062_10818365Not Available500Open in IMG/M
3300010362|Ga0126377_11728018Not Available701Open in IMG/M
3300010371|Ga0134125_12225985Not Available596Open in IMG/M
3300010373|Ga0134128_11876224Not Available659Open in IMG/M
3300010399|Ga0134127_13580732Not Available509Open in IMG/M
3300012199|Ga0137383_10423185Not Available976Open in IMG/M
3300012199|Ga0137383_11276093All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012200|Ga0137382_10878496Not Available646Open in IMG/M
3300012207|Ga0137381_11808921All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300012211|Ga0137377_10877924Not Available829Open in IMG/M
3300012211|Ga0137377_11459695Not Available611Open in IMG/M
3300012349|Ga0137387_11146038Not Available552Open in IMG/M
3300012358|Ga0137368_10247041All Organisms → cellular organisms → Bacteria1235Open in IMG/M
3300012359|Ga0137385_11148895Not Available637Open in IMG/M
3300012582|Ga0137358_10307046All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1077Open in IMG/M
3300012683|Ga0137398_10405529Not Available928Open in IMG/M
3300012683|Ga0137398_10816487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium652Open in IMG/M
3300012922|Ga0137394_10642409All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia896Open in IMG/M
3300012923|Ga0137359_10860249All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia783Open in IMG/M
3300012924|Ga0137413_10684247Not Available777Open in IMG/M
3300012929|Ga0137404_12177403All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium518Open in IMG/M
3300012948|Ga0126375_11525917Not Available572Open in IMG/M
3300012976|Ga0134076_10214009Not Available812Open in IMG/M
3300012976|Ga0134076_10364391Not Available638Open in IMG/M
3300013102|Ga0157371_11602748Not Available510Open in IMG/M
3300013296|Ga0157374_10705913Not Available1022Open in IMG/M
3300015053|Ga0137405_1151094All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia530Open in IMG/M
3300015371|Ga0132258_10449953All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_3_54_173210Open in IMG/M
3300015373|Ga0132257_101289025All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300015374|Ga0132255_103903583Not Available633Open in IMG/M
3300017657|Ga0134074_1385664Not Available520Open in IMG/M
3300018054|Ga0184621_10267281All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300018056|Ga0184623_10430634Not Available574Open in IMG/M
3300018066|Ga0184617_1028610Not Available1302Open in IMG/M
3300018076|Ga0184609_10049216All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1795Open in IMG/M
3300019879|Ga0193723_1087244Not Available890Open in IMG/M
3300019881|Ga0193707_1033307Not Available1681Open in IMG/M
3300019881|Ga0193707_1043339All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300019882|Ga0193713_1114916All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia744Open in IMG/M
3300019886|Ga0193727_1190609All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300020005|Ga0193697_1024443Not Available1506Open in IMG/M
3300021080|Ga0210382_10209412All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium848Open in IMG/M
3300021086|Ga0179596_10331906Not Available762Open in IMG/M
3300021510|Ga0222621_1034297Not Available1049Open in IMG/M
3300022534|Ga0224452_1115019All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium825Open in IMG/M
3300024330|Ga0137417_1388850All Organisms → cellular organisms → Bacteria4263Open in IMG/M
3300025315|Ga0207697_10212370Not Available853Open in IMG/M
3300025908|Ga0207643_10479478All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300025926|Ga0207659_10559018Not Available973Open in IMG/M
3300025930|Ga0207701_10087199All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium 13_1_20CM_3_54_172814Open in IMG/M
3300025932|Ga0207690_11309648Not Available605Open in IMG/M
3300025936|Ga0207670_11356856Not Available603Open in IMG/M
3300025937|Ga0207669_11029208Not Available693Open in IMG/M
3300025986|Ga0207658_11089713All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300026035|Ga0207703_11290232Not Available702Open in IMG/M
3300026142|Ga0207698_12696427Not Available506Open in IMG/M
3300026326|Ga0209801_1067444All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1591Open in IMG/M
3300026326|Ga0209801_1265385Not Available635Open in IMG/M
3300026702|Ga0208708_102090All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium554Open in IMG/M
3300028707|Ga0307291_1173819Not Available552Open in IMG/M
3300028793|Ga0307299_10039965All Organisms → cellular organisms → Bacteria1717Open in IMG/M
3300028878|Ga0307278_10476295All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia546Open in IMG/M
3300028885|Ga0307304_10334193Not Available675Open in IMG/M
3300031231|Ga0170824_109759321Not Available516Open in IMG/M
3300031720|Ga0307469_11204030All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium716Open in IMG/M
3300031943|Ga0310885_10392017Not Available738Open in IMG/M
3300032000|Ga0310903_10267373Not Available829Open in IMG/M
3300032261|Ga0306920_103148336All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia619Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.01%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.41%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.70%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.70%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.70%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.70%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.80%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.80%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.80%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.80%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.90%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.90%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.90%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.90%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.90%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300002128Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009802Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026702Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN593 (SPAdes)EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_084862302170459010Grass SoilMSGAVSFSKGDGQSVSLTYSDTPIAPSEVSLSAMRAELERR
JGI11643J12802_1224115213300000890SoilAGTILFSKEDGPSLNITYSDTGFMPTEVSVSAFRAELEAAK*
JGI1027J12803_10130589223300000955SoilIFSKGDGQSVNITYSDTGFMPTEVSLSAMRAELEAAK*
JGI1027J12803_10161963023300000955SoilAGTLLFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAK*
JGI1027J12803_10230032823300000955SoilSKEGGGSVTVTYSDTGFMPTEVSVSAFRAELEAAK*
JGI1027J12803_10241579413300000955SoilFSKEGGPSVTITYSDTGFMPTEVSLSAMRAELEAAK*
JGI10216J12902_11709975913300000956SoilKEDVASLERMAGTILLSKEDGKSVNITYSDTGFMPSEVSVSAMRVEFEAAR*
JGI24808J26613_102969813300002099SoilWKEDVASLERMAGTVLLSKDNGQSVTITYSDTGFMPSEVSVSAMRVEFEAAR*
JGI24036J26619_1000878713300002128Corn, Switchgrass And Miscanthus RhizosphereKEDVASLERMAGTLLFSKDGQSLNITYSDTGFMPTEVSLSAMRAELEAAK*
Ga0062592_10161610613300004480SoilEDVASLERMAGTLLFSKDGQSLNITYSDTGFMPTEVSLSAMRAELEAAK*
Ga0066672_1090159923300005167SoilMAGTILLSKEDGQSVNITYSDTGFMPSEVSVSAMRVEFEAAR*
Ga0066673_1069602723300005175SoilSVTGMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK*
Ga0066684_1040719713300005179SoilGMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRAELEAAK*
Ga0065712_1026649113300005290Miscanthus RhizosphereGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR*
Ga0065705_1032039913300005294Switchgrass RhizosphereASVTGMSGVVSVSKEGGPSATITYSDTGFLPTELSVSAFRAELEAAK*
Ga0070660_10057386513300005339Corn RhizosphereVASLERMAGTLIFSKGDGQSVNITYSDTGFMPTEVSLSAMRAELEAAK*
Ga0070688_10031390433300005365Switchgrass RhizosphereTMEKMAGTLLFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR*
Ga0070709_1129719123300005434Corn, Switchgrass And Miscanthus RhizosphereMAGTLSFSKEGGQSVTITYSDTGFMPSEVTVSLVRAEFEAAR*
Ga0070711_10034145713300005439Corn, Switchgrass And Miscanthus RhizosphereMEKMAGTLSFSKEGGQSVTITYSDTGFMPTEVSVSTFRGELEAAK*
Ga0070662_10090016613300005457Corn RhizosphereGVVSVSKEGGPSATITYTDTGFLPTELSVSAFRAELEAAK*
Ga0070665_10084858323300005548Switchgrass RhizosphereLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR*
Ga0066706_1013571533300005598SoilMAGTLLFSKENGQSVNVTYSDTGFMPTEVSLSAMRAELEAAK*
Ga0066905_10075539223300005713Tropical Forest SoilSLEAMAGTLLLSKGEGQSVTITYSDTGFMPSEVSVSAMRAELEAAK*
Ga0066903_10649084623300005764Tropical Forest SoilEDVAALDGMAGALSFSKEGGQSVTINYTDTGFMPSEVTVSVMRGELEAAK*
Ga0068860_10138774323300005843Switchgrass RhizosphereATMEKMAGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAR*
Ga0081455_1015915913300005937Tabebuia Heterophylla RhizosphereASLERMAGTLSFSKEGQSVTITYSDTGFMPTEVSLSAFRAELEAAK*
Ga0081455_1058082633300005937Tabebuia Heterophylla RhizosphereMAGTLKFSKEDGPSVTVTYSDTGFMPTEVSVSAFRAELEAAR*
Ga0070712_10028104823300006175Corn, Switchgrass And Miscanthus RhizosphereDVASVTGMSGVVSVSKEGGPSVTVTYTDTPIMPSEVSLSAMRAELEAAK*
Ga0066660_1019097923300006800SoilMSGVVSVSKEGGPSVTITYSDTGFMPTEVSVSAMRAELEAAK*
Ga0075428_10105223013300006844Populus RhizosphereSFSKEDGQSVTVTYTDTPISPSEVSLSAMRAELEAAK*
Ga0075433_1056556713300006852Populus RhizosphereSAMAGTLLLSKEDQSVNITYSDTGFMPSEVTLSAMRAELEAAK*
Ga0075434_10228525723300006871Populus RhizosphereWKEDVASMSAMAGTLLLSKEDQSVNITYSDTGFMPSEVTLSAMRAELEAAK*
Ga0066710_10189149613300009012Grasslands SoilGMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRAELEAAK
Ga0066710_10277310633300009012Grasslands SoilMAGTLLFSKDGGQSVNITYSDTGFMPTEVSVSAMRGELEAAK
Ga0105245_1217137413300009098Miscanthus RhizosphereKEGGGSINVTYSDTGFMPTEVSVSAFRAELEAAR*
Ga0114129_1187109513300009147Populus RhizosphereIASLERMAGTLLLSKENGQSLTITYSDTGFMPSEVSVSAMRAELEAAR*
Ga0105073_105415113300009802Groundwater SandEDVASMAAMAGTLSFSKEDQSVTITYSDTGFLPTEVSLSAMRAELEAAK*
Ga0126308_1055264013300010040Serpentine SoilASLERMAGTLLFSKGDGQSVNITYSDTGFMPTEVSLSAMRVEFEAAK*
Ga0126384_1033265913300010046Tropical Forest SoilLSFSKEGGQSLTITYSDTGFMPTEVSVSAFRGELEAAK*
Ga0126382_1048981013300010047Tropical Forest SoilMAGTLLLSKGEGQSVTITYSDTGFMPSEVSVSAMRAELEAPK*
Ga0126382_1108799623300010047Tropical Forest SoilLERMAGTVLLSKGDQSVTITYSDTGFMPSEISVSAMHVEFEAAR*
Ga0134086_1032292933300010323Grasslands SoilSKGDGQSVNITYSDTGFMPTEISLSGMRVEFEAAK*
Ga0134065_1022006423300010326Grasslands SoilTLLFSKGDGQSVNITYSDTGFLPTEVSLSAMRIEFEAAK*
Ga0134062_1081836513300010337Grasslands SoilKGDGQRVNITYSDTGFMPTEVSLSAMRAELEADK*
Ga0126377_1172801823300010362Tropical Forest SoilKEDVASVEHMAGTVLLSKDNGQSVTITYSDTGFMPSEVSVSAMRVEFEAAR*
Ga0134125_1222598513300010371Terrestrial SoilKHASMSAMAGTLSFSKEGGGSVTVTYSDTGFMPTEISLSAFRAELEAAR*
Ga0134128_1187622413300010373Terrestrial SoilMEKMAGTLLFSKEGGGSINITYSATGFMPTEVSVSAFRAELEAAR*
Ga0134127_1358073223300010399Terrestrial SoilLFSKDGQSLNITYSDTGFMPTEVSLSAMRAELEAAK*
Ga0137383_1042318523300012199Vadose Zone SoilVASVTGMSGVVSVSKEGGPSVTITYTDTGFLPTELSVSAMRAELERR*
Ga0137383_1127609313300012199Vadose Zone SoilVSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK*
Ga0137382_1087849613300012200Vadose Zone SoilRMAGTLLFSKGDGQRVNITYSDTGFMPTEVSLSAMRVELEATK*
Ga0137381_1180892113300012207Vadose Zone SoilAAVTGMSGAVSVSKEGGQSVSITYTDTGFLPTELSISGMRVELERH*
Ga0137377_1087792413300012211Vadose Zone SoilGVVSVSKEGGPSVTITYTDTGFLPTELSVSAMRAELEATK*
Ga0137377_1145969513300012211Vadose Zone SoilSKGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAAR*
Ga0137387_1114603813300012349Vadose Zone SoilKGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAPR*
Ga0137368_1024704143300012358Vadose Zone SoilFSKGDGQSVSLTYTDTGFLPTEVSLSAMRAELERR*
Ga0137385_1114889513300012359Vadose Zone SoilMAGTLLFSKGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAAR*
Ga0137358_1030704633300012582Vadose Zone SoilSFSKEGGQSVTITYSDTGFMPTEVSVSAFRGELEAAK*
Ga0137398_1040552923300012683Vadose Zone SoilVTGMSGVVSVSKEGGPSATVTYTDTGFLPTELSVSAMRADLEAAESKK*
Ga0137398_1081648733300012683Vadose Zone SoilASVTGMSGVVSVSTEGGPSVTITYTDTGFLPTELSISAMRAELEAAK*
Ga0137394_1064240933300012922Vadose Zone SoilSGAASFSKEDGQNVTVTYTDTPISPSEVSLSAMRAELEAAK*
Ga0137359_1086024913300012923Vadose Zone SoilEDVTAIEKMAGTLSFSKEGGQSVTITYSDTGFMPTEVSVSAFRGELEAAK*
Ga0137413_1068424713300012924Vadose Zone SoilTLLFSKGDGQRVNITYSDTGFMPTEVSLSAMRVEFEAAK*
Ga0137404_1217740313300012929Vadose Zone SoilAGTLSFSKEGGGRVTVTYSDTGFMPTEVSVSAFRAELEAAR*
Ga0126375_1152591723300012948Tropical Forest SoilLSFSKEGGQSVTINYTDTGFMPSEVTVSVMRGELEAAK*
Ga0134076_1021400913300012976Grasslands SoilSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRAELEATK*
Ga0134076_1036439123300012976Grasslands SoilSKEGGPSATITYTDTGFLPTELSVSAMRAELEATESKK*
Ga0157371_1160274813300013102Corn RhizosphereHATMEKMAGTLLFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR*
Ga0157374_1070591343300013296Miscanthus RhizosphereWKEDVASLERMAGTLIFSKGDGQSMNITYSDTGFMPTEVSLSAFRAELEAAR*
Ga0137405_115109423300015053Vadose Zone SoilFSKEDGQSVTLTYSDTPISPSEVSLSAMRAELERR*
Ga0132258_1044995343300015371Arabidopsis RhizosphereVASLERMAGTLLFSKGDGQSVNITYSDTGFMPTEVSVSAMRVEFEAAR*
Ga0132257_10128902543300015373Arabidopsis RhizosphereKEEHASMEKMAGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAK*
Ga0132255_10390358313300015374Arabidopsis RhizosphereATMEKMAGTLLFSKEGGGSINITYSDTGFMPTEVSVSAFRAELEAAR*
Ga0134074_138566423300017657Grasslands SoilFSKEDGQSVTVTYTDTPISPSEVSLSAMRAELEAAK
Ga0184621_1026728133300018054Groundwater SedimentMVSVSKEGGPSVTITYSDTGFMPTELSVSAFRAELEAQQQK
Ga0184623_1043063423300018056Groundwater SedimentLFSKGDGQSVNITYSDTGFMPTEVSLSSMRVELEAAK
Ga0184617_102861013300018066Groundwater SedimentVSVSKEGGPSATITYTDTGFLPTELSVSTMHAELEAAK
Ga0184609_1004921643300018076Groundwater SedimentSGVVHVSKEGGPSVSITYSDTGFMPTELSVSAFRAELEAQQER
Ga0193723_108724423300019879SoilVASMAGMSGTLLFSKEDGHLTITYSDTGFMPTEVSLSAFRAELEATK
Ga0193707_103330713300019881SoilKEDVASVTGMSGMVSVSKEGGPSVTITYTDTGFMPTELSVSAFRAELEAAK
Ga0193707_104333913300019881SoilSVSKEGGPSATITYTDTGFMPTELSVSAMRAELEAAK
Ga0193713_111491613300019882SoilLFSKENGQSVNITYSDTGFMPTEVSVSAMRVEFEAAR
Ga0193727_119060923300019886SoilKENVASVTGMSGMVSVSKEGGPSATITYTDTGFMPTELSVSAFRAELEITK
Ga0193697_102444333300020005SoilSGVVSVSKEGGPSATITYSDTGFLPTELSVSAFRAELEAAK
Ga0210382_1020941233300021080Groundwater SedimentFSKEDGQSLTVTYSDTPISPSEVSLSAFRAELEAAK
Ga0179596_1033190613300021086Vadose Zone SoilDVASVTGMTGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK
Ga0222621_103429713300021510Groundwater SedimentMAGTLSFSKEGGGSVTVTYSDTGFMPTEVSLSAFRAELEAAK
Ga0224452_111501923300022534Groundwater SedimentAAMAGMSGAVSFSKGDGQSVSLTYSDTPIAPSEVSLSAMRAELERR
Ga0137417_138885043300024330Vadose Zone SoilMSASVTGMSGVVSVSKEGGPSATITYTDTGFLPTELSVSAMRADLEAAESKK
Ga0207697_1021237033300025315Corn, Switchgrass And Miscanthus RhizosphereMEKMAGTLLFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR
Ga0207643_1047947823300025908Miscanthus RhizosphereMAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR
Ga0207659_1055901823300025926Miscanthus RhizosphereERMAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR
Ga0207701_1008719913300025930Corn, Switchgrass And Miscanthus RhizosphereDHATMEKMAGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAK
Ga0207690_1130964813300025932Corn RhizosphereEDVASLERMAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR
Ga0207670_1135685623300025936Switchgrass RhizosphereTLLFSKDDQHVTITYSDTGFMPTEVSLSAMRTELEAAK
Ga0207669_1102920823300025937Miscanthus RhizosphereMAGTLLFSKGDGQSVNITYSDTGFMPTEVSVSAMRAELEAAR
Ga0207658_1108971313300025986Switchgrass RhizosphereIFSKGDGQSVNITYSDTGFMPTEVSLSAMRAELEAAK
Ga0207703_1129023233300026035Switchgrass RhizosphereLFSKEGGGSVNITYSDTGFMPTEVSVSAFRAELEAAR
Ga0207698_1269642723300026142Corn RhizosphereDVASLERMAGTLAFSKDDQHVTITYSDTGFMPTEVSLSAMRAELEAAR
Ga0209801_106744413300026326SoilGAASFSKEDGQSVTITYTDTGIMPSEISLSAMRAELERR
Ga0209801_126538523300026326SoilGTLLFSKGDGQRVNITYSDTGFMPSEVSVSAMRVEFEAAR
Ga0208708_10209013300026702SoilLSKEDQSVTITYSDTGFMPSEVSVSAMRAELEAAK
Ga0307291_117381913300028707SoilAGTLLFSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAK
Ga0307299_1003996513300028793SoilFSKEDGQSVTVTYSDTPISPSEVSLSAFRAELEAAK
Ga0307278_1047629513300028878SoilGAASFSKEDGQSVTVTYTDTPISPSEVSLSAFRAELERR
Ga0307304_1033419313300028885SoilSKEGGGSVNVTYSDTGFMPTEVSVSAFRAELEAAR
Ga0170824_10975932123300031231Forest SoilFSKDDQHVTITYSDTGFMPTEVSVSAMRAELEAAR
Ga0307469_1120403013300031720Hardwood Forest SoilLSFKKEGGGSVTITYSDTGFMPTEVSVSAFRAELEAAR
Ga0310885_1039201713300031943SoilMAGTLLFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAK
Ga0310903_1026737323300032000SoilLFSKENGQSVNITYSDTGFMPTEVSLSAMRAELEAAR
Ga0306920_10314833613300032261SoilFSKEGGQNVTINYTDTGFMPSEVSVSAMRVEFEAAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.