| Basic Information | |
|---|---|
| Family ID | F085993 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPLLIFITT |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 47.27 % |
| % of genes near scaffold ends (potentially truncated) | 95.50 % |
| % of genes from short scaffolds (< 2000 bps) | 90.09 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.099 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.315 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.324 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.757 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF01066 | CDP-OH_P_transf | 16.22 |
| PF01148 | CTP_transf_1 | 6.31 |
| PF00730 | HhH-GPD | 1.80 |
| PF02670 | DXP_reductoisom | 1.80 |
| PF02163 | Peptidase_M50 | 0.90 |
| PF13366 | PDDEXK_3 | 0.90 |
| PF08436 | DXP_redisom_C | 0.90 |
| PF01553 | Acyltransferase | 0.90 |
| PF01926 | MMR_HSR1 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 16.22 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 16.22 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 16.22 |
| COG0743 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase | Lipid transport and metabolism [I] | 2.70 |
| COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.80 |
| COG0177 | Endonuclease III | Replication, recombination and repair [L] | 1.80 |
| COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 1.80 |
| COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 1.80 |
| COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 1.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.10 % |
| Unclassified | root | N/A | 0.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1017713 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1072 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10100458 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 610 | Open in IMG/M |
| 3300004479|Ga0062595_101922835 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300005179|Ga0066684_10830011 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 609 | Open in IMG/M |
| 3300005179|Ga0066684_11111667 | All Organisms → cellular organisms → Bacteria → PVC group | 505 | Open in IMG/M |
| 3300005180|Ga0066685_10130077 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300005187|Ga0066675_10252289 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300005294|Ga0065705_10275674 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300005294|Ga0065705_10374579 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300005363|Ga0008090_14585436 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005434|Ga0070709_11631757 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 525 | Open in IMG/M |
| 3300005471|Ga0070698_101745010 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005471|Ga0070698_102007705 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005557|Ga0066704_10722017 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 626 | Open in IMG/M |
| 3300005559|Ga0066700_10074728 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
| 3300005764|Ga0066903_101805051 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300005764|Ga0066903_104673259 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 729 | Open in IMG/M |
| 3300005764|Ga0066903_106341269 | All Organisms → cellular organisms → Bacteria → PVC group | 617 | Open in IMG/M |
| 3300005937|Ga0081455_10861049 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005983|Ga0081540_1096139 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1289 | Open in IMG/M |
| 3300006175|Ga0070712_100362100 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300006797|Ga0066659_10672785 | All Organisms → cellular organisms → Bacteria → PVC group | 844 | Open in IMG/M |
| 3300006852|Ga0075433_10930993 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300006904|Ga0075424_101575662 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300007076|Ga0075435_100277299 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300009012|Ga0066710_103834445 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 564 | Open in IMG/M |
| 3300009098|Ga0105245_10921068 | All Organisms → cellular organisms → Bacteria → PVC group | 916 | Open in IMG/M |
| 3300009137|Ga0066709_101282221 | All Organisms → cellular organisms → Bacteria → PVC group | 1075 | Open in IMG/M |
| 3300009792|Ga0126374_10614958 | All Organisms → cellular organisms → Bacteria → PVC group | 804 | Open in IMG/M |
| 3300010038|Ga0126315_10624411 | All Organisms → cellular organisms → Bacteria → PVC group | 698 | Open in IMG/M |
| 3300010043|Ga0126380_10446002 | All Organisms → cellular organisms → Bacteria → PVC group | 976 | Open in IMG/M |
| 3300010043|Ga0126380_10649723 | All Organisms → cellular organisms → Bacteria → PVC group | 839 | Open in IMG/M |
| 3300010048|Ga0126373_12001298 | All Organisms → cellular organisms → Bacteria → PVC group | 642 | Open in IMG/M |
| 3300010303|Ga0134082_10079351 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1284 | Open in IMG/M |
| 3300010322|Ga0134084_10454387 | All Organisms → cellular organisms → Bacteria → PVC group | 511 | Open in IMG/M |
| 3300010333|Ga0134080_10703908 | All Organisms → cellular organisms → Bacteria → PVC group | 501 | Open in IMG/M |
| 3300010337|Ga0134062_10089489 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1309 | Open in IMG/M |
| 3300010361|Ga0126378_12721038 | All Organisms → cellular organisms → Bacteria → PVC group | 565 | Open in IMG/M |
| 3300010362|Ga0126377_11439425 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 762 | Open in IMG/M |
| 3300010364|Ga0134066_10224774 | All Organisms → cellular organisms → Bacteria → PVC group | 636 | Open in IMG/M |
| 3300010373|Ga0134128_11972521 | All Organisms → cellular organisms → Bacteria → PVC group | 643 | Open in IMG/M |
| 3300010398|Ga0126383_11425084 | All Organisms → cellular organisms → Bacteria → PVC group | 782 | Open in IMG/M |
| 3300010398|Ga0126383_13087457 | All Organisms → cellular organisms → Bacteria → PVC group | 544 | Open in IMG/M |
| 3300011003|Ga0138514_100034695 | All Organisms → cellular organisms → Bacteria → PVC group | 970 | Open in IMG/M |
| 3300012201|Ga0137365_10083761 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2402 | Open in IMG/M |
| 3300012285|Ga0137370_10477007 | All Organisms → cellular organisms → Bacteria → PVC group | 762 | Open in IMG/M |
| 3300012349|Ga0137387_11329333 | All Organisms → cellular organisms → Bacteria → PVC group | 501 | Open in IMG/M |
| 3300012354|Ga0137366_10323672 | All Organisms → cellular organisms → Bacteria → PVC group | 1131 | Open in IMG/M |
| 3300012361|Ga0137360_11086812 | All Organisms → cellular organisms → Bacteria → PVC group | 691 | Open in IMG/M |
| 3300012891|Ga0157305_10029524 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300012914|Ga0157297_10125961 | All Organisms → cellular organisms → Bacteria → PVC group | 804 | Open in IMG/M |
| 3300012925|Ga0137419_11455763 | All Organisms → cellular organisms → Bacteria → PVC group | 579 | Open in IMG/M |
| 3300012938|Ga0162651_100092240 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 513 | Open in IMG/M |
| 3300012944|Ga0137410_10922424 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 740 | Open in IMG/M |
| 3300012948|Ga0126375_11122090 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 649 | Open in IMG/M |
| 3300012958|Ga0164299_10387158 | All Organisms → cellular organisms → Bacteria → PVC group | 893 | Open in IMG/M |
| 3300012960|Ga0164301_11818476 | All Organisms → cellular organisms → Bacteria → PVC group | 512 | Open in IMG/M |
| 3300012961|Ga0164302_10976748 | All Organisms → cellular organisms → Bacteria → PVC group | 658 | Open in IMG/M |
| 3300012971|Ga0126369_11218873 | All Organisms → cellular organisms → Bacteria → PVC group | 842 | Open in IMG/M |
| 3300012972|Ga0134077_10398017 | All Organisms → cellular organisms → Bacteria → PVC group | 594 | Open in IMG/M |
| 3300012987|Ga0164307_10430254 | All Organisms → cellular organisms → Bacteria → PVC group | 980 | Open in IMG/M |
| 3300013105|Ga0157369_12472294 | All Organisms → cellular organisms → Bacteria → PVC group | 526 | Open in IMG/M |
| 3300014150|Ga0134081_10276562 | All Organisms → cellular organisms → Bacteria → PVC group | 595 | Open in IMG/M |
| 3300015357|Ga0134072_10082547 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 957 | Open in IMG/M |
| 3300015372|Ga0132256_103197842 | All Organisms → cellular organisms → Bacteria → PVC group | 551 | Open in IMG/M |
| 3300016270|Ga0182036_10315184 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1194 | Open in IMG/M |
| 3300016341|Ga0182035_10254057 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300016357|Ga0182032_11431469 | All Organisms → cellular organisms → Bacteria → PVC group | 599 | Open in IMG/M |
| 3300016371|Ga0182034_10098952 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2084 | Open in IMG/M |
| 3300017654|Ga0134069_1109299 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 905 | Open in IMG/M |
| 3300017659|Ga0134083_10216534 | All Organisms → cellular organisms → Bacteria → PVC group | 794 | Open in IMG/M |
| 3300018054|Ga0184621_10249201 | All Organisms → cellular organisms → Bacteria → PVC group | 633 | Open in IMG/M |
| 3300018431|Ga0066655_11000316 | All Organisms → cellular organisms → Bacteria → PVC group | 578 | Open in IMG/M |
| 3300018465|Ga0190269_11711459 | All Organisms → cellular organisms → Bacteria → PVC group | 531 | Open in IMG/M |
| 3300018482|Ga0066669_10172163 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300019361|Ga0173482_10554061 | All Organisms → cellular organisms → Bacteria → PVC group | 569 | Open in IMG/M |
| 3300019866|Ga0193756_1035124 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 707 | Open in IMG/M |
| 3300019879|Ga0193723_1011114 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2873 | Open in IMG/M |
| 3300019885|Ga0193747_1094198 | All Organisms → cellular organisms → Bacteria → PVC group | 730 | Open in IMG/M |
| 3300020010|Ga0193749_1005428 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → Singulisphaera acidiphila | 2460 | Open in IMG/M |
| 3300020015|Ga0193734_1024847 | All Organisms → cellular organisms → Bacteria → PVC group | 1130 | Open in IMG/M |
| 3300020018|Ga0193721_1022267 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
| 3300021445|Ga0182009_10007240 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 3662 | Open in IMG/M |
| 3300021560|Ga0126371_12800710 | All Organisms → cellular organisms → Bacteria → PVC group | 591 | Open in IMG/M |
| 3300025910|Ga0207684_10867105 | All Organisms → cellular organisms → Bacteria → PVC group | 760 | Open in IMG/M |
| 3300025927|Ga0207687_10576339 | All Organisms → cellular organisms → Bacteria → PVC group | 946 | Open in IMG/M |
| 3300025932|Ga0207690_10124827 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300025933|Ga0207706_11112388 | All Organisms → cellular organisms → Bacteria → PVC group | 660 | Open in IMG/M |
| 3300025934|Ga0207686_10550091 | All Organisms → cellular organisms → Bacteria → PVC group | 902 | Open in IMG/M |
| 3300025939|Ga0207665_10993818 | All Organisms → cellular organisms → Bacteria → PVC group | 667 | Open in IMG/M |
| 3300025961|Ga0207712_10027717 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 3784 | Open in IMG/M |
| 3300026310|Ga0209239_1199562 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 722 | Open in IMG/M |
| 3300026317|Ga0209154_1010482 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 4554 | Open in IMG/M |
| 3300026327|Ga0209266_1163728 | All Organisms → cellular organisms → Bacteria → PVC group | 878 | Open in IMG/M |
| 3300026334|Ga0209377_1265220 | All Organisms → cellular organisms → Bacteria → PVC group | 566 | Open in IMG/M |
| 3300026550|Ga0209474_10512904 | All Organisms → cellular organisms → Bacteria → PVC group | 607 | Open in IMG/M |
| 3300026770|Ga0207537_103590 | All Organisms → cellular organisms → Bacteria → PVC group | 591 | Open in IMG/M |
| 3300027876|Ga0209974_10406105 | All Organisms → cellular organisms → Bacteria → PVC group | 535 | Open in IMG/M |
| 3300031469|Ga0170819_12605102 | All Organisms → cellular organisms → Bacteria → PVC group | 617 | Open in IMG/M |
| 3300031744|Ga0306918_11371201 | All Organisms → cellular organisms → Bacteria → PVC group | 542 | Open in IMG/M |
| 3300031890|Ga0306925_10101978 | All Organisms → cellular organisms → Bacteria | 3055 | Open in IMG/M |
| 3300031890|Ga0306925_11659602 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 619 | Open in IMG/M |
| 3300032076|Ga0306924_10866075 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1002 | Open in IMG/M |
| 3300032180|Ga0307471_100518511 | All Organisms → cellular organisms → Bacteria → PVC group | 1342 | Open in IMG/M |
| 3300032180|Ga0307471_102422911 | All Organisms → cellular organisms → Bacteria → PVC group | 663 | Open in IMG/M |
| 3300032421|Ga0310812_10077120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 1336 | Open in IMG/M |
| 3300033412|Ga0310810_11017951 | All Organisms → cellular organisms → Bacteria → PVC group | 705 | Open in IMG/M |
| 3300033433|Ga0326726_12188120 | All Organisms → cellular organisms → Bacteria → PVC group | 538 | Open in IMG/M |
| 3300033475|Ga0310811_10178782 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
| 3300033805|Ga0314864_0126692 | All Organisms → cellular organisms → Bacteria → PVC group | 638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.01% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.21% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.31% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.80% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.80% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.90% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.90% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.90% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
| 3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026770 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10177131 | 3300000579 | Forest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLMLAPLL |
| AF_2010_repII_A001DRAFT_101004581 | 3300000793 | Forest Soil | MNETTWQRLFGYRHAFDHPVTVVVTMTAVVLLVLAPLLIFIT |
| Ga0062595_1019228351 | 3300004479 | Soil | MNDTTWQRLFGFRHAFNHPVTVVVTLTAVALLVLAPLLIFVTTRAAKSTAEKRKELW |
| Ga0066684_108300111 | 3300005179 | Soil | MNNTAWQPLFGFRHAFDDRVTIVLTVTAAVLLTLAPLLIFVTTRNSTAEKRKELWDRYRSWIW |
| Ga0066684_111116672 | 3300005179 | Soil | MNLTTRERLFAFHHAFDNGVTVVLTATAAGSLILAPLLILIAT |
| Ga0066685_101300771 | 3300005180 | Soil | MNDTTWQRLFGFRHAFDHPVTVMVTLTAVVLLVLAPLLIFI |
| Ga0066675_102522893 | 3300005187 | Soil | MNNATWQRLFGFRHAFDDPVTVVLTLAVAALLLLAPLLIFI |
| Ga0065705_102756741 | 3300005294 | Switchgrass Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVVVTLSAVVLLLLAPLLIFITTRAAKSTA |
| Ga0065705_103745792 | 3300005294 | Switchgrass Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVVLTLTAVVLLILAPLLILITTRAAKSSAEKQK |
| Ga0008090_145854362 | 3300005363 | Tropical Rainforest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVILLILAPLLILITTRAAKSSAEKQKEL* |
| Ga0070709_116317571 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MTNATWQRLFGFRHAFDDPVTVVLTLAVAALLLLAPLLIFSTTRAAKSTA |
| Ga0070698_1017450101 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNNTTWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPLLIFITARKSTAEKRKELWDRYRSWIWLSLCILI |
| Ga0070698_1020077051 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDTTWQRLFGFRHAFDYPVTVVVALTAVVLLVLAPLLIFITTRAGERAA |
| Ga0066704_107220171 | 3300005557 | Soil | MNDTTWQRLFGFRHAFDHRVTMVLTLAVVVLLVLAPLLIFITTRAAKSTAEKRKELW |
| Ga0066700_100747281 | 3300005559 | Soil | MNNTMWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPLLIFITA |
| Ga0066903_1018050513 | 3300005764 | Tropical Forest Soil | MNDSTWQRLFGFRHAFDSPVTVVVLLTAVVLLVLAPLLIFITTRAAKSTAEK |
| Ga0066903_1046732592 | 3300005764 | Tropical Forest Soil | MNNTTWQRLFGFRHAFDDRVTVVLTVTAVVLLVFAPLLIFIATRAANSTAEKRKEL |
| Ga0066903_1063412692 | 3300005764 | Tropical Forest Soil | MNDTTWQRLFGFRHAFDQPVTVVITLTAVVFLGLAP |
| Ga0081455_108610491 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNDTTWQRLFGFRHAFDQPVTVVVTLTAFVLLVLAPLLIF |
| Ga0081540_10961391 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MNDPSWQRLFAFRHAFDHPVTVAVMVTAIVLLVLAPLLIFIT |
| Ga0070712_1003621001 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDTTWQRLFGFRHAFDYPVTVVVTLTAVVLLVLAPLLIF |
| Ga0066659_106727851 | 3300006797 | Soil | MNNTAWQRLFGFRHAFDDRVTIVLTVTAVVLLSVTPL |
| Ga0075433_109309932 | 3300006852 | Populus Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVVVTVTAVALLVLAPLLIFITTRAAKSTAEK |
| Ga0075424_1015756622 | 3300006904 | Populus Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVIVTLTAVVLLVLAPLLIFITTRAAKSTDEKRKELWD |
| Ga0075435_1002772993 | 3300007076 | Populus Rhizosphere | MNDTTWQRLFGFRHAFDHPVTIVLTLTAVVLLALAPLLIFITTRAAKS |
| Ga0066710_1038344451 | 3300009012 | Grasslands Soil | MNNTMWQRLFGFRHAFDDRVTIVLTVTAVVLLSVTPLLIFITARKTTAEKRRELWDRYRSWIWLSLCILIPILA |
| Ga0105245_109210682 | 3300009098 | Miscanthus Rhizosphere | MNDTIWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPL |
| Ga0066709_1012822213 | 3300009137 | Grasslands Soil | MRLEMNNTTWQRLFGFRHAFDDRVTVVLTMAAVGLLVLTPLLIFITTRSPSSTS |
| Ga0126374_106149581 | 3300009792 | Tropical Forest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLILAP |
| Ga0126315_106244112 | 3300010038 | Serpentine Soil | MNDTTWQRLFGFRHAFDHSVTVVLTLTAVVLLFLAPFLIFITTRT |
| Ga0126380_104460021 | 3300010043 | Tropical Forest Soil | MNDTTWQRLFGFRHAFDHPVTIVVTLTAVVLLVLAPLLILITTRAAKS |
| Ga0126380_106497232 | 3300010043 | Tropical Forest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTVTAIVLLILAPLLIFITTRALKSTS |
| Ga0126373_118029381 | 3300010048 | Tropical Forest Soil | MSNTTWQRLFGFRQAFDDRVTIVLTITAVVLLTLAPLLIFITTRKSSAGKRKELWDRYRSWIWLSLCILIPIL |
| Ga0126373_120012982 | 3300010048 | Tropical Forest Soil | MNDTIWQRLFGFRHAFDQPVTVVVTVTAVVLLGLAPVLIFITTRGAKSTPEKRKELWDRY |
| Ga0134082_100793513 | 3300010303 | Grasslands Soil | MNNTAWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPLLIFITAQKSTAEKRK |
| Ga0134084_104543872 | 3300010322 | Grasslands Soil | MNNATWQRLFRFRHAFDDPVTVVLTLAVAALLLLAPLLIFITTRAARSTA |
| Ga0134080_107039082 | 3300010333 | Grasslands Soil | MNNVTWQRLFGFRHAFDHQVTVVLTFAVLTLLLLAPLLIFI |
| Ga0134062_100894891 | 3300010337 | Grasslands Soil | MNDTTWQRLFGFRHAFDHPVTVMVTLTAVVLLVLAPLLIFITTRAATSTAEKRK |
| Ga0126378_127210382 | 3300010361 | Tropical Forest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPLLIFITT* |
| Ga0126377_114394252 | 3300010362 | Tropical Forest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLILAPLLILITTR |
| Ga0134066_102247741 | 3300010364 | Grasslands Soil | MNNTAWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPLLIFITTRKSTAEKRRELWDR |
| Ga0134128_119725211 | 3300010373 | Terrestrial Soil | MNGTTWQRLFGFRHAFDYPVTVVVTLTAVVLLVLAPLLIFITTRAGER |
| Ga0126383_114250841 | 3300010398 | Tropical Forest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLILAPLLILITTRATKSGAEKQKEL |
| Ga0126383_130874571 | 3300010398 | Tropical Forest Soil | MNNTTWQRLFGFRHAFDDRVTTVLTVTAVVLLTLAPFLIFITTRNSTADKRKELWDRYRS |
| Ga0138514_1000346953 | 3300011003 | Soil | MNDATWQRLFGFRHAFDHPVTVIVTLTAVVLLVLAPLLIFITTRAAKS |
| Ga0137365_100837611 | 3300012201 | Vadose Zone Soil | MNDTTWQRLFGFRHAFDHRVTVVVALTVAVLLVLAPLL |
| Ga0137370_104770072 | 3300012285 | Vadose Zone Soil | MNNVTWQRLFGLRHAFDDPVTVILTLAVAALLLLAPLLIFITTR |
| Ga0137387_113293332 | 3300012349 | Vadose Zone Soil | MNNATWQRLFGFRHAFDDPVTLVLTLAVAALLLLAPLLIF |
| Ga0137366_103236721 | 3300012354 | Vadose Zone Soil | MNNATWQRLFGFRHAFDDRVTVVLTLAVAALLLLAP |
| Ga0137360_110868121 | 3300012361 | Vadose Zone Soil | MNNTAWQRLFGFRHAFDDRVTIVLTVTAVVLLSVTPLLIFITARKTTAEKRRELWDRYR |
| Ga0157305_100295243 | 3300012891 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTTVGLLVLAPLLIF |
| Ga0157297_101259612 | 3300012914 | Soil | MNDTTWQRLFGFRHAFDPPVTVVVTLTAVVLLALAPLLIFMTTRGAKTT |
| Ga0137419_114557631 | 3300012925 | Vadose Zone Soil | MNDTTWQRLFGFRHAFDHPVTIIVTLTAVVLLLLAPLLI |
| Ga0162651_1000922402 | 3300012938 | Soil | MNDTTWQRLFGFRHAFDHSVTVIVTLTATILLVLAPLLIFITTRAAKSTAEKRKELWDRY |
| Ga0137410_109224242 | 3300012944 | Vadose Zone Soil | MNNTAWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPLLIFITAQKSTAEKRKELWDRY |
| Ga0126375_111220901 | 3300012948 | Tropical Forest Soil | MNHPTWQRLFGFRHAFDDRVTVILTLAVLALFLLAPLLIFITTRAAGSTPEKKKEL |
| Ga0164299_103871582 | 3300012958 | Soil | MNDTTWQRLFGFRHAFDYPVTVVVTLTAVVLLVLA |
| Ga0164301_118184762 | 3300012960 | Soil | MNDTTWQRLFGFRHAFDYPVTVVVTLTAVVLLVLAPLLIFITTRAA |
| Ga0164302_109767481 | 3300012961 | Soil | MNDTTWQRLFGFRHAFDHAVTVIVMLTAFVLLVLAPLLIFITTRAAKSTA |
| Ga0126369_112188731 | 3300012971 | Tropical Forest Soil | MNNTTWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPFLIFITTRNSTADKRKEL |
| Ga0134077_103980171 | 3300012972 | Grasslands Soil | MNNVTWQRLFGFRHAFDHQVTVVLTFAVLTLLLLAPLLIFITTR |
| Ga0164307_104302543 | 3300012987 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAGVLLLLAPLL |
| Ga0157369_124722941 | 3300013105 | Corn Rhizosphere | MNDTIWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPPL |
| Ga0134081_102765621 | 3300014150 | Grasslands Soil | MNNVTWQRLFGFRHAFDHQVTVVLTFAVLTLLLLAPLLIFITTRAAKSAADKRKELWDRY |
| Ga0134072_100825472 | 3300015357 | Grasslands Soil | MNNTMWQRLFGFRHAFDDRVTIVLTVTAVVLLSVTPLLIFITARKTTAEKRRELWDRYRSWIWLSLC |
| Ga0132256_1031978422 | 3300015372 | Arabidopsis Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVVLTLTAVVLLILAPLLILITTRAAKSSAEK |
| Ga0182036_103151842 | 3300016270 | Soil | GFRHAFDDRITVVLTVAAVGLPVLAPLLIFIITRSASSSAEKRKDLWNRYPS |
| Ga0182035_102540573 | 3300016341 | Soil | MNDTTWQRLFGFRHAFDHPVTVVLTLTAVVLLILAPLLILITTRAA |
| Ga0182032_114314691 | 3300016357 | Soil | MNNATWQRLFGFRHAFDHPVTVVLTLAVAALLLLA |
| Ga0182034_100989521 | 3300016371 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTVTAVVLLVLAP |
| Ga0134069_11092992 | 3300017654 | Grasslands Soil | MNNATWQRLFGFRHAFDDRVTVVLTLAVAALLLLAPLLIFSTTRAAKST |
| Ga0134083_102165342 | 3300017659 | Grasslands Soil | MNDTTWQRLFGFRHAFDHPVTVGVTLTVTILLVLAPLLIFITTRAANSTAEKRKE |
| Ga0184621_102492012 | 3300018054 | Groundwater Sediment | MNDTTWQRLFGFRHAFDHPVTIVVTLTAVVLLILAPLLIFITTRAA |
| Ga0066655_110003162 | 3300018431 | Grasslands Soil | MNDTTWQRLFGFRHAFDHPVTVMVTLTAVVLLVLAPLLIFITTRAATSTAEK |
| Ga0190269_117114592 | 3300018465 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAAVLLVLAPLLIFITTRAAKSTAE |
| Ga0066669_101721631 | 3300018482 | Grasslands Soil | MNNVTWQRLFGFRHAFDHQVTVVLTFAVLTLLLLAPL |
| Ga0173482_105540611 | 3300019361 | Soil | MNDMTWQRLFGFRHAFDHPVTVVVTVTAVVLLILTPLLIL |
| Ga0193756_10351242 | 3300019866 | Soil | MNDTTWQRLFGFRHAFDHPVTVFVTLTAVGLLVLAPLLIFAATRAAKSTA |
| Ga0193723_10111145 | 3300019879 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAFVLLVLAPLLIFITTR |
| Ga0193747_10941982 | 3300019885 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPLL |
| Ga0193749_10054283 | 3300020010 | Soil | MNDATWQRLFGFRHAFDHRVTVVVTLTVAVLLALSPLLIFITTRAAKSTAEKRKELWDRYRSWIWWRSAF |
| Ga0193734_10248473 | 3300020015 | Soil | MNNATWQRLFGFRHAFDDPVTVVLTLAVAALLLLAPLLIFITT |
| Ga0193721_10222671 | 3300020018 | Soil | MNDTTWQRLFGFRHAFDHSVTVVLTLTAVVLLVLAPLLIFIT |
| Ga0182009_100072404 | 3300021445 | Soil | MNDTSWQRLFGFRHAFDDSLTVVVTVSAVVLLFLAPFLVF |
| Ga0126371_128007101 | 3300021560 | Tropical Forest Soil | MNHPTWQRLFGFRHAFDDPVTVVLTLAVAALLLLAPLLIFIT |
| Ga0207684_108671051 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDTIWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPPLIFITTR |
| Ga0207687_105763392 | 3300025927 | Miscanthus Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVVVTLTAIVLLALAPLQIFITTRAAKSTAEKRKE |
| Ga0207690_101248274 | 3300025932 | Corn Rhizosphere | MNNVIWQRLFGFRHAFDDPVTVVLTLAIVALLLLAPLL |
| Ga0207706_111123881 | 3300025933 | Corn Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVAVTLTAVVLLVLA |
| Ga0207686_105500912 | 3300025934 | Miscanthus Rhizosphere | MNDTIWQRLFGFRHAFDHPVTVVVTLTAVVLLILAPLLIFITTRAA |
| Ga0207665_109938181 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDTTWQRLFGFRHAFDHGVTIVVTLTAVVLLVLAPLLIFITTRAAESTAEKRKEIWDRY |
| Ga0207712_100277175 | 3300025961 | Switchgrass Rhizosphere | MNDTIWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPPLIFITTRAAKSTAEQR |
| Ga0209239_11995622 | 3300026310 | Grasslands Soil | MNNTAWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPLLIFITAQKSTAEK |
| Ga0209154_10104821 | 3300026317 | Soil | MNNTMWQRLFGFRHAFDDRVTIVLTVTAVVLLSVT |
| Ga0209266_11637281 | 3300026327 | Soil | MNDTTWQRLFGFRHAFDHRVTIVLTLTAVVLLLFAPLLIFITTRAAK |
| Ga0209377_12652202 | 3300026334 | Soil | MNDTTWQRLFGFRHAFDHRVTMVLTLAVVVLLVLAPLLI |
| Ga0209474_105129042 | 3300026550 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPLLIFITTRAGKSTAE |
| Ga0207537_1035902 | 3300026770 | Soil | MNDTIWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAP |
| Ga0209974_104061052 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLVLAPLLIFMTTRGAKTTVE |
| Ga0170819_126051021 | 3300031469 | Forest Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAFVLLALAPLLIFIATRAGKSSAEE |
| Ga0306918_113712011 | 3300031744 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTVTAVALLILAPLLILITTRAAKSTAEK |
| Ga0306925_101019785 | 3300031890 | Soil | MNNTTWQRLFGFRHAFDDRITVVLTVAAVGLPVLAPLLIFIITRSASSSAEKRKDLWNRYPS |
| Ga0306925_116596022 | 3300031890 | Soil | MNNTTWQRLFGFRHAFDDRVTIALTVTAVGLLVLAPLLI |
| Ga0306924_108660752 | 3300032076 | Soil | MNDTTWQRLFGFRHAFDHPVTVVVTLTAVVLLILAPLLILITTRAAKSSAEKQKE |
| Ga0307471_1005185113 | 3300032180 | Hardwood Forest Soil | MNNATWQRLFGFHHAFDDPVTVVLTLTVAALLLLAPLLIFITTRAANS |
| Ga0307471_1024229111 | 3300032180 | Hardwood Forest Soil | MNDTTWQRLFGFRHAFDHPVTVLVTLTAVVLLVLAPLLIFITTRAAKST |
| Ga0310812_100771201 | 3300032421 | Soil | MNDTSWQRLFGFRHAFDDSVTVVVTVSAVVLLLLAPF |
| Ga0310810_110179512 | 3300033412 | Soil | MNDMTWQRLFGFRHAFDHPVTVVVALTAVVLLVLAPLLIFITTRAAKSTAEK |
| Ga0326726_121881201 | 3300033433 | Peat Soil | MNNTTWQRLFGFRHAFDDRVTIVLTVTAVVLLTLAPLLI |
| Ga0310811_101787824 | 3300033475 | Soil | MNDTSWQRLFGFRHAFDDSLTVVVTVSAVVLLFLAPFLVFITTRSANSTAEKRKELWDRYRSWIW |
| Ga0314864_0126692_526_636 | 3300033805 | Peatland | MNNTTWQRLFGFRHAFDDRVTVILTLAAVSLLALAPL |
| ⦗Top⦘ |