| Basic Information | |
|---|---|
| Family ID | F085967 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VSLERVGFIPIPAGAKPGFDHADTYRAGRRMYVAHTGADRVDV |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.55 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 94.59 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.198 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.126 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.838 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.054 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 14.08% Coil/Unstructured: 81.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF09828 | Chrome_Resist | 91.89 |
| PF02417 | Chromate_transp | 2.70 |
| PF09918 | DUF2148 | 0.90 |
| PF07690 | MFS_1 | 0.90 |
| PF06224 | HTH_42 | 0.90 |
| PF02424 | ApbE | 0.90 |
| PF13473 | Cupredoxin_1 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 2.70 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.20 % |
| Unclassified | root | N/A | 1.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_106353912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 731 | Open in IMG/M |
| 3300000956|JGI10216J12902_107038176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 711 | Open in IMG/M |
| 3300002908|JGI25382J43887_10442285 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 550 | Open in IMG/M |
| 3300004643|Ga0062591_101850903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 617 | Open in IMG/M |
| 3300005093|Ga0062594_100772413 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300005180|Ga0066685_10911496 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 587 | Open in IMG/M |
| 3300005181|Ga0066678_10243642 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1161 | Open in IMG/M |
| 3300005330|Ga0070690_101326376 | Not Available | 577 | Open in IMG/M |
| 3300005447|Ga0066689_10273161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
| 3300005540|Ga0066697_10613923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
| 3300005552|Ga0066701_10945750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 510 | Open in IMG/M |
| 3300005560|Ga0066670_10747089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
| 3300005561|Ga0066699_11146402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 535 | Open in IMG/M |
| 3300005574|Ga0066694_10551867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 537 | Open in IMG/M |
| 3300006032|Ga0066696_10890445 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 567 | Open in IMG/M |
| 3300006034|Ga0066656_11010184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300006175|Ga0070712_101908079 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006580|Ga0074049_10058679 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
| 3300006796|Ga0066665_10812692 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300006800|Ga0066660_10634971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 888 | Open in IMG/M |
| 3300006800|Ga0066660_11529336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300009012|Ga0066710_100167408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3085 | Open in IMG/M |
| 3300009012|Ga0066710_100772967 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300009038|Ga0099829_11500394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
| 3300009088|Ga0099830_11397539 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300009137|Ga0066709_100137166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3097 | Open in IMG/M |
| 3300009137|Ga0066709_101594941 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300009137|Ga0066709_101607897 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300009553|Ga0105249_11705829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
| 3300009792|Ga0126374_11819854 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300010038|Ga0126315_10402959 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300010039|Ga0126309_10227537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1045 | Open in IMG/M |
| 3300010041|Ga0126312_10354299 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300010041|Ga0126312_11361967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
| 3300010048|Ga0126373_10809468 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300010166|Ga0126306_10255903 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300010166|Ga0126306_10846822 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300010166|Ga0126306_11187902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 627 | Open in IMG/M |
| 3300010320|Ga0134109_10399126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 549 | Open in IMG/M |
| 3300010333|Ga0134080_10585296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 541 | Open in IMG/M |
| 3300010336|Ga0134071_10319674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 781 | Open in IMG/M |
| 3300010337|Ga0134062_10386392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 682 | Open in IMG/M |
| 3300010358|Ga0126370_10119860 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
| 3300010361|Ga0126378_11054164 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300010362|Ga0126377_12994153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 545 | Open in IMG/M |
| 3300010364|Ga0134066_10198122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 664 | Open in IMG/M |
| 3300011997|Ga0120162_1095660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 630 | Open in IMG/M |
| 3300012008|Ga0120174_1122676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 626 | Open in IMG/M |
| 3300012189|Ga0137388_11066866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 744 | Open in IMG/M |
| 3300012198|Ga0137364_10104833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1996 | Open in IMG/M |
| 3300012200|Ga0137382_10800327 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300012201|Ga0137365_10240745 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300012208|Ga0137376_11147451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 664 | Open in IMG/M |
| 3300012209|Ga0137379_10065684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3491 | Open in IMG/M |
| 3300012209|Ga0137379_11265491 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300012209|Ga0137379_11402117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
| 3300012285|Ga0137370_10809886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 581 | Open in IMG/M |
| 3300012351|Ga0137386_10647616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 760 | Open in IMG/M |
| 3300012354|Ga0137366_10095623 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300012355|Ga0137369_10408432 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300012355|Ga0137369_10518346 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300012355|Ga0137369_11060442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 533 | Open in IMG/M |
| 3300012356|Ga0137371_10460250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 984 | Open in IMG/M |
| 3300012358|Ga0137368_10191490 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300012359|Ga0137385_11009022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia phenoliruptrix | 686 | Open in IMG/M |
| 3300012359|Ga0137385_11228189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 611 | Open in IMG/M |
| 3300012360|Ga0137375_10232558 | All Organisms → cellular organisms → Bacteria | 1716 | Open in IMG/M |
| 3300012532|Ga0137373_10268123 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300012532|Ga0137373_10294361 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300012532|Ga0137373_11090225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 572 | Open in IMG/M |
| 3300012917|Ga0137395_10903179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 638 | Open in IMG/M |
| 3300012927|Ga0137416_11024399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 738 | Open in IMG/M |
| 3300012948|Ga0126375_10848626 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300012975|Ga0134110_10532308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 538 | Open in IMG/M |
| 3300012987|Ga0164307_10618239 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300014150|Ga0134081_10123770 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300014267|Ga0075313_1115705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 670 | Open in IMG/M |
| 3300014272|Ga0075327_1220663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 611 | Open in IMG/M |
| 3300014310|Ga0075331_1158252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 557 | Open in IMG/M |
| 3300015371|Ga0132258_12954522 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300015371|Ga0132258_13136593 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300017659|Ga0134083_10513254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 538 | Open in IMG/M |
| 3300018468|Ga0066662_12853049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 513 | Open in IMG/M |
| 3300018482|Ga0066669_10840057 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300018482|Ga0066669_11082017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 724 | Open in IMG/M |
| 3300018482|Ga0066669_12001867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
| 3300025472|Ga0208692_1109546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 532 | Open in IMG/M |
| 3300025961|Ga0207712_11248786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 663 | Open in IMG/M |
| 3300026309|Ga0209055_1308189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
| 3300026312|Ga0209153_1131881 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300026319|Ga0209647_1012596 | All Organisms → cellular organisms → Bacteria | 5588 | Open in IMG/M |
| 3300026528|Ga0209378_1300578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 514 | Open in IMG/M |
| 3300027882|Ga0209590_10263692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1101 | Open in IMG/M |
| 3300027882|Ga0209590_11057438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
| 3300028536|Ga0137415_11145340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 592 | Open in IMG/M |
| 3300028715|Ga0307313_10144164 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300031670|Ga0307374_10329725 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031680|Ga0318574_10375767 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031723|Ga0318493_10200476 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
| 3300031751|Ga0318494_10320043 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300031764|Ga0318535_10143199 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300031798|Ga0318523_10166301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1099 | Open in IMG/M |
| 3300031799|Ga0318565_10343891 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300031821|Ga0318567_10463012 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300031938|Ga0308175_101779212 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031938|Ga0308175_103263375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 503 | Open in IMG/M |
| 3300032066|Ga0318514_10281437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 878 | Open in IMG/M |
| 3300032090|Ga0318518_10690955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300032261|Ga0306920_103236886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
| 3300032261|Ga0306920_103564703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 574 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.13% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.31% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.31% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.80% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
| 3300012008 | Permafrost microbial communities from Nunavut, Canada - A39_80cm_12M | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014310 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025472 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1063539123 | 3300000956 | Soil | MSLERVGFISVPAGEKAGFDHADVYRPGRRMYVAHTGADR |
| JGI10216J12902_1070381761 | 3300000956 | Soil | VSLRRAGFIDVPPGARPGFDHADVYRAERRMYVAHTGADRVDVLDCERLEYL |
| JGI25382J43887_104422851 | 3300002908 | Grasslands Soil | VSLARVGFIPIPPGAKPGFDHADVYRAGRRMYVAHTGADRIEVLDCEAQTHL |
| Ga0062591_1018509031 | 3300004643 | Soil | MSLARAGFIPIPPGAKPGFDHADVFGVGRRMYVAHTGADRIDVLDC |
| Ga0062594_1007724133 | 3300005093 | Soil | MPLKAIGFVPLPAGEAAGFDHADVYAPERRIYVAHTGANRV |
| Ga0066685_109114962 | 3300005180 | Soil | VSLARVGFIAIAPGAKPGFDHADVHRQRRRIYVAHTGADRIEVLDCN |
| Ga0066678_102436422 | 3300005181 | Soil | MSLIRAGFISIPPGAKPGFDHADASARGRRMYVAHTGADRIDVLDCN |
| Ga0070690_1013263761 | 3300005330 | Switchgrass Rhizosphere | VTLRRLGFVEVPQGAKPGFDHADVLLRPAGSRMYVAHTGADRVDVFDC |
| Ga0066689_102731611 | 3300005447 | Soil | MSLIRAGFISIPPGAKPGFDHADASARGRRMYVAHTGADRIEV |
| Ga0066697_106139231 | 3300005540 | Soil | VSLARVGFVPLPAGAKPGFDHADTYRAGRRMYVAHIGAD |
| Ga0066701_109457502 | 3300005552 | Soil | VSLVRAGFIAIPPGAKPGFDHADIFRPGARMYVAHTG |
| Ga0066670_107470891 | 3300005560 | Soil | VSLARVGFIAIPSGEKPGFDHADVHRQRRRIYVAHTGADRIEVLDCN |
| Ga0066699_111464021 | 3300005561 | Soil | VSLVRAGFIDLPAGAEPGFDHADVYRPGRRMYVAHTGADRVD |
| Ga0066694_105518671 | 3300005574 | Soil | VSLTRVGFIAIPPGAKPGFDHADVHRQRRRIYVAHTGADRIEV |
| Ga0066696_108904451 | 3300006032 | Soil | VSLARVGFIAIPSGAKPGFDHADVHRQRRRIYVAHTGADRIEVL |
| Ga0066656_110101841 | 3300006034 | Soil | VSLARVGFIDLPAGAKPGFDHADVYRPGRRMYVAHTGADRVDVLDC |
| Ga0070712_1019080791 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLVKTAFIPVPPGARPGFDHADVYRDGLGGSRLYVAHTGADQVDVIDCSA |
| Ga0074049_100586791 | 3300006580 | Soil | VTLVATAFVPIPPGARPGFDHADVYRPARRLYVAHSGADRVDVIDCVTK |
| Ga0066665_108126921 | 3300006796 | Soil | LSLRRVGFITLPPGAKSGFDHADVDRARRRMYVAHAGADRIDVLD |
| Ga0066660_106349712 | 3300006800 | Soil | MSLIRAGFISIPPGAKPGFDHADASARGRRMYVAHTGADR |
| Ga0066660_115293362 | 3300006800 | Soil | MGLVRVGFIPIPPGAKPGFDHADVYLGETGQSRMYVA |
| Ga0066710_1001674086 | 3300009012 | Grasslands Soil | VSLARVGFIAIPPGAKPGFDHADVHRQRRRLYVAHTG |
| Ga0066710_1007729671 | 3300009012 | Grasslands Soil | VSLVRAGFIPIPAGEHAGFDHADLYRTGRRMYVAHTGADRVDVLDCDRR |
| Ga0099829_115003941 | 3300009038 | Vadose Zone Soil | VGLVRTGFIPIPPGSKPGFDHADVHRKGRRLYVAHTGADRID |
| Ga0099830_113975392 | 3300009088 | Vadose Zone Soil | MPLVTSGFIAIPPGPQPGYDHADVYRDAAGAARLYVAHTGADRV |
| Ga0066709_1001371666 | 3300009137 | Grasslands Soil | VSLARVGFIAIPPGAKPGFDHADVHRQRRRLYVAHTGADRI |
| Ga0066709_1015949413 | 3300009137 | Grasslands Soil | VALGRVGFIEIPPGAKPGFDHADVHRQRRRLYVAH |
| Ga0066709_1016078974 | 3300009137 | Grasslands Soil | MPLEPVGFVPLPSGKGAGFDHADVYTPKRRMYVAHTG |
| Ga0105249_117058291 | 3300009553 | Switchgrass Rhizosphere | MTFVRSGFIPVPPGAKPGFDHADVYHDRTTGATRLYVAHTGADRID |
| Ga0126374_118198541 | 3300009792 | Tropical Forest Soil | VPLVRSGFIAIPPGSRPGFDHADVYQDGFGAARLYVAHTGADR |
| Ga0126315_104029593 | 3300010038 | Serpentine Soil | VSLVRTGFIPIPDAAKPGFDHADVYRAGRRMYVAHTGADRVDVLDCEQRTFLRFIS |
| Ga0126309_102275373 | 3300010039 | Serpentine Soil | VSLAKVGFIAIPPEAKPGFDHADVHRQRRRIYVAHTGADRI |
| Ga0126312_103542991 | 3300010041 | Serpentine Soil | VSLVRTGFVPMPPGTRPGFDHADVHRAGRRIYVAHTGADRVDVL |
| Ga0126312_113619672 | 3300010041 | Serpentine Soil | MSLERGGFIAIPPGAQPGFDHADIYRARRRMYVAHTGADRVDVLDCRAQTFLRSL |
| Ga0126373_108094683 | 3300010048 | Tropical Forest Soil | VTLTRTGFISIPPGREPGFDHADVYRDGTGAARLYVAHTGADRVDV |
| Ga0126306_102559031 | 3300010166 | Serpentine Soil | VTLVRDGFISLPPGARPGFDHADTFRTGRRIYVGHTGADRV |
| Ga0126306_108468223 | 3300010166 | Serpentine Soil | VSLARVGFSAIPPGAKPGFDHADVHRQRRRIYVAHTGADRVD |
| Ga0126306_111879021 | 3300010166 | Serpentine Soil | VSLVRTGFVPMPPGTRPGFDHADVHRAGRRIYVAHTGADRVDVLDCERRTFLR |
| Ga0134109_103991261 | 3300010320 | Grasslands Soil | VSLHRVGFIPLPPGREPGFDHADVWLGDGAPRLYVAHTGADRVDVLVCRTEAFLG |
| Ga0134080_105852962 | 3300010333 | Grasslands Soil | MTLARVGFIPISPGAEPGFDHADVHRGSRRMYVAHTGAD |
| Ga0134071_103196742 | 3300010336 | Grasslands Soil | MSLVRAGFIPIPQGPKPGFDHADVYRTGRRIYVAHTGADR |
| Ga0134062_103863921 | 3300010337 | Grasslands Soil | VSLARVGFIAIPSGAKPGFDHADVHRQRRRIYDAHT |
| Ga0126370_101198601 | 3300010358 | Tropical Forest Soil | MPLTRTDFIAIPPGRGPGFDHADVYRSSSDGSRIYVAHTGAD |
| Ga0126376_126100881 | 3300010359 | Tropical Forest Soil | VPLTRTGHVEIPPGREPGFDHADIYLGEADRARLYVAHTG |
| Ga0126378_110541643 | 3300010361 | Tropical Forest Soil | MPLTRSGFIAIPPGRVPGFDHADVYRDGSGAARLYVAHTGAD |
| Ga0126377_129941531 | 3300010362 | Tropical Forest Soil | VSLRRASFVAISPGAKPGFDHADVYRPGRRMYVAHTG |
| Ga0134066_101981222 | 3300010364 | Grasslands Soil | VSLVRAGFIPIPAGEHAGFDHADLYRTGRRMYVAHTGADRVDVLDCDR |
| Ga0120162_10956602 | 3300011997 | Permafrost | VSLTRVGFIPVPAGAAPGFDHSDVYRPQRRLYLAHTGADRV |
| Ga0120174_11226763 | 3300012008 | Permafrost | VSLTRVGLIAIPPGAEPGFNHADVYRAGRRMYVAHTGADRVDVLDCEQRTFLRSLSD |
| Ga0137388_110668661 | 3300012189 | Vadose Zone Soil | VPLVRSGFIAIPPGPRPGFDHADVYRDGSGASRLYVAHTGADR |
| Ga0137364_101048335 | 3300012198 | Vadose Zone Soil | VSLVRAGFVPLPPGARPGFDHADVYQAGRRMYVAHTGADRVDV |
| Ga0137382_108003273 | 3300012200 | Vadose Zone Soil | VSLVHVGYIPVVSGTEPGFDHADVYRPGGRMYVAH |
| Ga0137365_102407453 | 3300012201 | Vadose Zone Soil | MSLVRAGFIPIPQGARPVFDHADVFAHGRRMYVAHTGADRI |
| Ga0137376_111474511 | 3300012208 | Vadose Zone Soil | VSLARTAFIPIPPGTRPGFDHADVYRAGRRMYVAHTGADRIDV |
| Ga0137379_100656847 | 3300012209 | Vadose Zone Soil | MSLVRTGFIPIPQGAKPGFDHADVFPRGRRMYVAHTGADRIEVLDC |
| Ga0137379_112654911 | 3300012209 | Vadose Zone Soil | VSLVRVGFIPVAPGTEPGFDHADVYRAGRRMYVAHT |
| Ga0137379_114021172 | 3300012209 | Vadose Zone Soil | VSLERAGFIAIPPGAKPGFDHADVYRSGRRLYVAHTGADRVDVI |
| Ga0137370_108098861 | 3300012285 | Vadose Zone Soil | VSLARVGFIAIPSGAKPGFDHADVHRQRRRIYVAHTGADRIEVLDCN |
| Ga0137386_106476162 | 3300012351 | Vadose Zone Soil | VSLARVGFIAIPPEAKPGFDHADVHRQLRRIYVAHTGADRI |
| Ga0137366_100956236 | 3300012354 | Vadose Zone Soil | VSLARVGFIAIPPGAKPGFDHADVHRQRRRIYVAHTGADRI |
| Ga0137369_104084321 | 3300012355 | Vadose Zone Soil | VSLARVGFIAIPPGAKPGFDHADVFRGRRRIYVAHTGADRVD |
| Ga0137369_105183461 | 3300012355 | Vadose Zone Soil | MSLERGGFIAIPPGAKPGFDHADVYRAGGRMYVAHTGADRVDVLDCKRRQFLRSLHDLAG |
| Ga0137369_110604422 | 3300012355 | Vadose Zone Soil | MSLERGGFIAIPPGAQPGFDHADIYRARRRMYVAHTGADRVDVLDCR |
| Ga0137371_104602502 | 3300012356 | Vadose Zone Soil | VSLTRVGFIPIPAGAQAGFDHADVYPTGRLMYVAHTAPTGST* |
| Ga0137368_101914901 | 3300012358 | Vadose Zone Soil | MSLVRAGFIAIPPGAKPGFDHADVFASGRRMYVAHTGADRIEV |
| Ga0137385_110090222 | 3300012359 | Vadose Zone Soil | MTLRRVGFVQVPAGDKPGFDHADIYRAGRRMYVAHTGADRVDILDCAE |
| Ga0137385_112281891 | 3300012359 | Vadose Zone Soil | VSLVRVGFIPMARGAEPGFDHADVDRWNRRMYVAHTGADRIDVLDCESRSYVRALR |
| Ga0137375_102325585 | 3300012360 | Vadose Zone Soil | MSLVRAGFIPLAPGERPGFDHADIYREGRRMYVAHTGADRVDVLDCRT |
| Ga0137373_102681231 | 3300012532 | Vadose Zone Soil | VSLARTGFIPLPAGTKPGFDHADVHRTGRRMYVAHTGADRVDVID |
| Ga0137373_102943611 | 3300012532 | Vadose Zone Soil | MSLVRTGFIPIPQGAKPGFDHADVFPGGRRMYVAHTGADRIEVLDC |
| Ga0137373_110902251 | 3300012532 | Vadose Zone Soil | VSLARVGFIAIPPGAKPGFDHADVFRGRRRIYVAHTGADRVDVLDCEARTYLY |
| Ga0137395_109031791 | 3300012917 | Vadose Zone Soil | VSLERLGVIPIPPGAEPGFDHADVCRRNRRMYVAHTGADRVDVLGCTERTFLRSLP |
| Ga0137416_110243991 | 3300012927 | Vadose Zone Soil | VSLTRVGFIAVAAGAEPGFDHADVYRAGRRMYVAHTGADR |
| Ga0126375_108486261 | 3300012948 | Tropical Forest Soil | MTLVRTGFVELPRGAAPGFDHADVDRPCRRLYVAHLGADR |
| Ga0134110_105323082 | 3300012975 | Grasslands Soil | VSLARVGFIAIPSGEKPGFDHADVHRQRRRIYVAHTG |
| Ga0164307_106182393 | 3300012987 | Soil | MPLEPVGFVPLPSGRAAGFDHADLYTPERRLYVAHTGADRV |
| Ga0134081_101237703 | 3300014150 | Grasslands Soil | VSLVRVGYIPVVSGTEPGFDHADVYRPGRRMYVAHTGVGRVDVLDCVQQRFLR |
| Ga0075313_11157052 | 3300014267 | Natural And Restored Wetlands | MSLERRGFIAIPPGAKPGFDHADVYRAGGRIYVAHTGADRVD |
| Ga0075327_12206631 | 3300014272 | Natural And Restored Wetlands | MSLERGGFIAIPPGAKPGFDHADVYRTGGRMYVAHTGADRVDVLDCKRR |
| Ga0075331_11582522 | 3300014310 | Natural And Restored Wetlands | MRLERGGFIAIPPGAKPGFDHADVYRAGGRMYVAHTGADRVD |
| Ga0132258_129545221 | 3300015371 | Arabidopsis Rhizosphere | VSLVRTGFVPLPTGAKPGFDHADVYRPDRRVYVAHTGADRVDVIDGEQQVF |
| Ga0132258_131365931 | 3300015371 | Arabidopsis Rhizosphere | MSLVPAGFIPLPAGGRPGFDHADIHRGTRRMFVAHTGGDRID |
| Ga0134083_105132542 | 3300017659 | Grasslands Soil | VSLVRTGFIPIPPGAKPGFDHADVFRGRRRLYVAHTGA |
| Ga0066662_128530491 | 3300018468 | Grasslands Soil | MSLERVGFIELQPGARPGFDHADLYRAGARMYVAHTGADRVDVLDC |
| Ga0066669_108400573 | 3300018482 | Grasslands Soil | VSLTRIGFIPLPPGAQAGFDHADVYQAGRLMYVAHTGAGRVDVLDCAQQTFLRSLPDLPG |
| Ga0066669_110820173 | 3300018482 | Grasslands Soil | MSLDRAGFIPIPPGAKPRFDHADVFPRARRMYVAHT |
| Ga0066669_120018672 | 3300018482 | Grasslands Soil | VSLARVGFIPLPPGPEPGFDHADIYRPRRRMYVAHTGANRVDVLDCEQQRLLGSLP |
| Ga0208692_11095461 | 3300025472 | Peatland | VALVRAGFIPIPPGAKPGFDHADVCRDAGRMYVAHTGAERIDVL |
| Ga0207712_112487863 | 3300025961 | Switchgrass Rhizosphere | MTFVRSGFIPVPPGAKPGFDHADVYHDRTTGATRLYVAHTGADRIDV |
| Ga0209055_13081891 | 3300026309 | Soil | MSLVRAGFIPIPPGVKPGFDHADIFLRKRRMYVAHTGA |
| Ga0209153_11318813 | 3300026312 | Soil | VSLTRVGFIAIPPGAAPGFDHADVYRAGRRMYVAHTGAD |
| Ga0209647_10125964 | 3300026319 | Grasslands Soil | MGLARTGFITVPPGARPGFDHADVYRDGAGAARLYVARTGADRVEVIATA |
| Ga0209378_13005781 | 3300026528 | Soil | MSLIRAGFISIPPGAKPGFDHADASARGRRMYVAHTGADRIEVLDCEA |
| Ga0209590_102636921 | 3300027882 | Vadose Zone Soil | RGFIPLAAGPKPGFDHADVYREGGTCRPYVAHTGADRVDVIDCTTNT |
| Ga0209590_110574381 | 3300027882 | Vadose Zone Soil | VGLVRTGFIPIPPGPKPGFDHADVLCGGRRMYVAHTGADRIDVLDCEARAYLH |
| Ga0137415_111453402 | 3300028536 | Vadose Zone Soil | VSLARVGFIAIPPGAKPGFDHADVDRQRRRIYVAHTGADRI |
| Ga0307313_101441643 | 3300028715 | Soil | VSLVRAGFVPLPPGARPGFDHADVYQAGRRMYVAHTGADRVDVLDC |
| Ga0307374_103297252 | 3300031670 | Soil | VTLQATGFIPIPPGASPGFDHADVYDAGETGQRIYVANTGADRIDVLDC |
| Ga0318574_103757673 | 3300031680 | Soil | VSLRRAAFVSIPAGAEPGFDHADVYRPACRMYVAHTGADRIDVLDCRSR |
| Ga0318493_102004763 | 3300031723 | Soil | VGLARTGFVPIPPGREPGFDHADVFRAGRRIYVAHTGADRIDILDCERRTFLR |
| Ga0318494_103200433 | 3300031751 | Soil | VALERVDFIPLAPGEEPGFDHADVYPRARRLYVAHTGANRVD |
| Ga0318535_101431991 | 3300031764 | Soil | VGLVRTGFIPILPGREPGFDHADVFRAGRRIYVAHTGADRMDVLDCETQSF |
| Ga0318523_101663011 | 3300031798 | Soil | VGLVRTGFIPILPGREPGFDHADVFRAGRRIYVAHTGA |
| Ga0318565_103438911 | 3300031799 | Soil | VSLRRAAFVSIPAGAEPGFDHADVYRPACRMYVAHTGADRID |
| Ga0318567_104630121 | 3300031821 | Soil | VSLRRAAFVSIPAGAEPGFDHADVYRPACRMYVAHTGADRIDVLD |
| Ga0308175_1017792123 | 3300031938 | Soil | VSLERVGFIPIPAGAKPGFDHADTYRAGRRMYVAHTGADRVDV |
| Ga0308175_1032633751 | 3300031938 | Soil | MSLQRVGLIPIPAGAKPGFDHADTYRAGSRMYVAHTGADRIDVLDCEQRGFLRSLPDLA |
| Ga0318514_102814373 | 3300032066 | Soil | VSLRRTGFIALPPGREPGFDHADVWLRDGGGRMYVAHTGADRV |
| Ga0318518_106909551 | 3300032090 | Soil | VSLQPAGFIPVPPGKEPGFDHADVWLGDQGARMYVAHTGADRVDVLDCNARTFLR |
| Ga0306920_1032368862 | 3300032261 | Soil | VGLVRTGFVPIPPGKEPGFDHADVFRPGRRIYVAHSGADRIDVLDCQQRT |
| Ga0306920_1035647032 | 3300032261 | Soil | VSLVRTDFIKVPPAARPGFDHADVYRPGRRVYVAHTG |
| ⦗Top⦘ |