| Basic Information | |
|---|---|
| Family ID | F085939 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 41 residues |
| Representative Sequence | DNGRGETINDTGVRHLRVEVQKNSPFSKLLERLSERMKKP |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.70 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 90.09 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.568 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.225 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.324 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.541 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.18% β-sheet: 5.88% Coil/Unstructured: 77.94% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF01432 | Peptidase_M3 | 24.32 |
| PF00005 | ABC_tran | 4.50 |
| PF00903 | Glyoxalase | 3.60 |
| PF01545 | Cation_efflux | 2.70 |
| PF03960 | ArsC | 1.80 |
| PF07617 | DUF1579 | 0.90 |
| PF13701 | DDE_Tnp_1_4 | 0.90 |
| PF13577 | SnoaL_4 | 0.90 |
| PF05114 | DUF692 | 0.90 |
| PF13578 | Methyltransf_24 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 24.32 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 24.32 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 2.70 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 2.70 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 2.70 |
| COG1393 | Arsenate reductase or related protein, glutaredoxin family | Inorganic ion transport and metabolism [P] | 1.80 |
| COG3220 | Uncharacterized conserved protein, UPF0276 family | Function unknown [S] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.57 % |
| Unclassified | root | N/A | 32.43 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001661|JGI12053J15887_10039680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2646 | Open in IMG/M |
| 3300003465|P52013CM_1066403 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 792 | Open in IMG/M |
| 3300005166|Ga0066674_10091879 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300005171|Ga0066677_10702852 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005179|Ga0066684_10938386 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005187|Ga0066675_11456158 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005542|Ga0070732_10282560 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300005586|Ga0066691_10320155 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 916 | Open in IMG/M |
| 3300005614|Ga0068856_101111495 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300005843|Ga0068860_102072357 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
| 3300005921|Ga0070766_10109354 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
| 3300006042|Ga0075368_10471794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 558 | Open in IMG/M |
| 3300006176|Ga0070765_100660292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 987 | Open in IMG/M |
| 3300006176|Ga0070765_101168937 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006358|Ga0068871_102084583 | Not Available | 540 | Open in IMG/M |
| 3300006755|Ga0079222_10352744 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 995 | Open in IMG/M |
| 3300006806|Ga0079220_11493790 | Not Available | 579 | Open in IMG/M |
| 3300007788|Ga0099795_10076787 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1270 | Open in IMG/M |
| 3300009143|Ga0099792_10001332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 9115 | Open in IMG/M |
| 3300009545|Ga0105237_10258269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1745 | Open in IMG/M |
| 3300009545|Ga0105237_10707867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1014 | Open in IMG/M |
| 3300009551|Ga0105238_10704042 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1022 | Open in IMG/M |
| 3300009551|Ga0105238_11301891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 753 | Open in IMG/M |
| 3300010358|Ga0126370_12223998 | Not Available | 541 | Open in IMG/M |
| 3300010362|Ga0126377_12929439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 551 | Open in IMG/M |
| 3300010396|Ga0134126_12704237 | Not Available | 538 | Open in IMG/M |
| 3300010403|Ga0134123_11423705 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300010877|Ga0126356_10117541 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 895 | Open in IMG/M |
| 3300012169|Ga0153990_1138076 | Not Available | 543 | Open in IMG/M |
| 3300012202|Ga0137363_11440927 | Not Available | 579 | Open in IMG/M |
| 3300012204|Ga0137374_11267544 | Not Available | 511 | Open in IMG/M |
| 3300012349|Ga0137387_11264429 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300012351|Ga0137386_10770296 | Not Available | 691 | Open in IMG/M |
| 3300012927|Ga0137416_10498557 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1048 | Open in IMG/M |
| 3300012929|Ga0137404_12321580 | Not Available | 502 | Open in IMG/M |
| 3300012988|Ga0164306_10778999 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300013105|Ga0157369_12274706 | Not Available | 549 | Open in IMG/M |
| 3300014325|Ga0163163_13284519 | Not Available | 504 | Open in IMG/M |
| 3300015264|Ga0137403_11291030 | Not Available | 576 | Open in IMG/M |
| 3300015356|Ga0134073_10071446 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300016294|Ga0182041_10465715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1089 | Open in IMG/M |
| 3300016319|Ga0182033_10573024 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300017961|Ga0187778_10239126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1164 | Open in IMG/M |
| 3300017972|Ga0187781_11426059 | Not Available | 513 | Open in IMG/M |
| 3300018086|Ga0187769_10544702 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 876 | Open in IMG/M |
| 3300018433|Ga0066667_10532547 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300019789|Ga0137408_1339681 | Not Available | 5308 | Open in IMG/M |
| 3300020199|Ga0179592_10505104 | Not Available | 517 | Open in IMG/M |
| 3300021088|Ga0210404_10853124 | Not Available | 521 | Open in IMG/M |
| 3300021358|Ga0213873_10308562 | Not Available | 512 | Open in IMG/M |
| 3300021377|Ga0213874_10059266 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
| 3300021384|Ga0213876_10205748 | Not Available | 1046 | Open in IMG/M |
| 3300021404|Ga0210389_11056124 | Not Available | 629 | Open in IMG/M |
| 3300021405|Ga0210387_10543689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1033 | Open in IMG/M |
| 3300021406|Ga0210386_10712514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
| 3300021406|Ga0210386_11552084 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300021441|Ga0213871_10229407 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021474|Ga0210390_10705441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 841 | Open in IMG/M |
| 3300021477|Ga0210398_11362167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300022724|Ga0242665_10265784 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300022917|Ga0247777_1117022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 889 | Open in IMG/M |
| 3300023079|Ga0247758_1009489 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2641 | Open in IMG/M |
| 3300023264|Ga0247772_1037056 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1004 | Open in IMG/M |
| 3300023270|Ga0247784_1022107 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1489 | Open in IMG/M |
| 3300024227|Ga0228598_1022996 | Not Available | 1226 | Open in IMG/M |
| 3300024249|Ga0247676_1066285 | Not Available | 594 | Open in IMG/M |
| 3300024330|Ga0137417_1076494 | Not Available | 2416 | Open in IMG/M |
| 3300025906|Ga0207699_10863014 | Not Available | 667 | Open in IMG/M |
| 3300025913|Ga0207695_10062685 | Not Available | 3837 | Open in IMG/M |
| 3300025924|Ga0207694_10324287 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1271 | Open in IMG/M |
| 3300025928|Ga0207700_10061024 | Not Available | 2858 | Open in IMG/M |
| 3300027516|Ga0207761_1045119 | Not Available | 860 | Open in IMG/M |
| 3300028573|Ga0265334_10268158 | Not Available | 586 | Open in IMG/M |
| 3300028794|Ga0307515_10240367 | Not Available | 1583 | Open in IMG/M |
| 3300028794|Ga0307515_10936516 | Not Available | 501 | Open in IMG/M |
| 3300030007|Ga0311338_11092400 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300030740|Ga0265460_13077865 | Not Available | 502 | Open in IMG/M |
| 3300030843|Ga0075392_10515003 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 821 | Open in IMG/M |
| 3300030862|Ga0265753_1012895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1133 | Open in IMG/M |
| 3300030906|Ga0302314_10328306 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1747 | Open in IMG/M |
| 3300031057|Ga0170834_107006795 | Not Available | 554 | Open in IMG/M |
| 3300031469|Ga0170819_16521377 | Not Available | 621 | Open in IMG/M |
| 3300031546|Ga0318538_10348666 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300031548|Ga0307408_101629320 | Not Available | 613 | Open in IMG/M |
| 3300031668|Ga0318542_10586621 | Not Available | 581 | Open in IMG/M |
| 3300031723|Ga0318493_10195386 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300031723|Ga0318493_10894587 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031753|Ga0307477_10616892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 730 | Open in IMG/M |
| 3300031754|Ga0307475_10526614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
| 3300031793|Ga0318548_10014452 | All Organisms → cellular organisms → Bacteria | 3196 | Open in IMG/M |
| 3300031796|Ga0318576_10458786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
| 3300031835|Ga0318517_10037216 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300031879|Ga0306919_11423560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300031890|Ga0306925_10375521 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1525 | Open in IMG/M |
| 3300031894|Ga0318522_10055775 | All Organisms → cellular organisms → Bacteria | 1405 | Open in IMG/M |
| 3300031894|Ga0318522_10082568 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1175 | Open in IMG/M |
| 3300031912|Ga0306921_10042804 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5116 | Open in IMG/M |
| 3300032009|Ga0318563_10000854 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12605 | Open in IMG/M |
| 3300032025|Ga0318507_10246059 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300032035|Ga0310911_10364902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300032042|Ga0318545_10023171 | All Organisms → cellular organisms → Bacteria | 1990 | Open in IMG/M |
| 3300032054|Ga0318570_10091142 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300032055|Ga0318575_10104857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1374 | Open in IMG/M |
| 3300032076|Ga0306924_12057438 | Not Available | 587 | Open in IMG/M |
| 3300032089|Ga0318525_10138631 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300032174|Ga0307470_10131570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1497 | Open in IMG/M |
| 3300032805|Ga0335078_12093568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 601 | Open in IMG/M |
| 3300032829|Ga0335070_10230458 | All Organisms → cellular organisms → Bacteria | 1827 | Open in IMG/M |
| 3300032895|Ga0335074_10229903 | Not Available | 2213 | Open in IMG/M |
| 3300033290|Ga0318519_10848152 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300033412|Ga0310810_10265272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1876 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.23% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.41% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 3.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.70% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.70% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.80% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 1.80% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Ore Pile And Mine Drainage Contaminated Soil | Environmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.90% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.90% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003465 | Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P5 sample | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Host-Associated | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022917 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5 | Environmental | Open in IMG/M |
| 3300023079 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L156-409C-4 | Environmental | Open in IMG/M |
| 3300023264 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6 | Environmental | Open in IMG/M |
| 3300023270 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027516 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 (SPAdes) | Environmental | Open in IMG/M |
| 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
| 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Host-Associated | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300030843 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12053J15887_100396803 | 3300001661 | Forest Soil | ASQLAIDDGTGETLNDSGVRHLRVEVQKNSPFMRLLERLSERMKKP* |
| P52013CM_10664033 | 3300003465 | Ore Pile And Mine Drainage Contaminated Soil | GASDLEIDNGRGEVLNDTGVRHLRVEVQKNTPFAKLLDRLSERVRRN* |
| Ga0066674_100918792 | 3300005166 | Soil | LTIDVGTGETLNDSGVRHLRVEVQKNSPFTRLLERLSERMKKL* |
| Ga0066677_107028521 | 3300005171 | Soil | IDNGTGETLNDTGVRHLRVEVQKNSPFTRLLERLSERMKKL* |
| Ga0066684_109383861 | 3300005179 | Soil | IDNGTGETLNDSGVRHLRVEVQKNSPFTRLLERLSERVKKL* |
| Ga0066675_114561581 | 3300005187 | Soil | LGASQLTIDNGTGETLNDSGVRHLRVEVQKNSPFTRLLERLSERVKKL* |
| Ga0070732_102825602 | 3300005542 | Surface Soil | ETLNESGVRHLRVEVQKNSPFSKLLERLSERMRKP* |
| Ga0066691_103201553 | 3300005586 | Soil | GETLNDTGVRHLRVQVQKNTPFTRLLERLSERIRKP* |
| Ga0068856_1011114951 | 3300005614 | Corn Rhizosphere | AGELEMDNGSGEALNETGVRHLRVEVQKNTPFGRLLERLSERVRKP* |
| Ga0068860_1020723571 | 3300005843 | Switchgrass Rhizosphere | GELEMDTGNGETMNESGVRHLRVEVQKNTPFGRLLERLSERVRKP* |
| Ga0070766_101093543 | 3300005921 | Soil | DTGSGEGLNDSGVRHLKVSIQKNSAFSRLLERLSERVGKS* |
| Ga0075368_104717942 | 3300006042 | Populus Endosphere | IDTGRGEIVNDTGVRHLRVQVQKNTPFTKLLDRLSERVRRN* |
| Ga0070765_1006602923 | 3300006176 | Soil | ETINDSGVRHLRIEVQKNSPFTKLLERLSERMKKP* |
| Ga0070765_1011689371 | 3300006176 | Soil | TLNESGVRHLRVEVQKNSPFSKLLERLSERMKKQ* |
| Ga0068871_1020845832 | 3300006358 | Miscanthus Rhizosphere | SQLSMDTGRGETINDSGVRHLRVEVQKNSPFSKLLERLSERMKKS* |
| Ga0079222_103527441 | 3300006755 | Agricultural Soil | IDAGRGETLNDTGVRHLRVEVQKNSPFSKLLERLSERMKKS* |
| Ga0079220_114937901 | 3300006806 | Agricultural Soil | IDSSTGESLNDTGVRHLRVELQKNTPFSRLLERLSERVKKS* |
| Ga0099795_100767873 | 3300007788 | Vadose Zone Soil | QLTIDDGTGETLNDSGVRHLRIEVQKNSPFTRLLERLSERMKKV* |
| Ga0099792_100013321 | 3300009143 | Vadose Zone Soil | GETLNDSGVRHLRIEVQKNSPFTRLLERLSERMKKV* |
| Ga0105237_102582693 | 3300009545 | Corn Rhizosphere | GELEMDGGNGVSMNESGVRHLRVEVQKNTPFGRLLERLSERVRKP* |
| Ga0105237_107078673 | 3300009545 | Corn Rhizosphere | ALNETGVRHLRVEVQKNTPFGRLLERLSERVRKP* |
| Ga0105238_107040423 | 3300009551 | Corn Rhizosphere | AGELEMDGGNGVSMNESGVRHLRVEVQKNTPFGRLLERLSERVRKP* |
| Ga0105238_113018912 | 3300009551 | Corn Rhizosphere | MTIDNGRGELLNDTGVRHLEVTVQKNSPFGRLLERITERVRLG* |
| Ga0126370_122239981 | 3300010358 | Tropical Forest Soil | EILNDTGVRHLQVSVKKETPFTRLLDRLSERMGKE* |
| Ga0126377_129294391 | 3300010362 | Tropical Forest Soil | SELEIDKGRGELLNDTGVRHLRVEVQKDTPFSRLLDRLSERVRKT* |
| Ga0134126_127042372 | 3300010396 | Terrestrial Soil | IDGGRGESINDTGVRHLRVEVQKNTPFSRLLERLSERTRKN* |
| Ga0134123_114237053 | 3300010403 | Terrestrial Soil | LGASELEIDRDRGATLNDTGVRHLRVQVSKNTPFAKLLDRLSERVRRG* |
| Ga0126356_101175411 | 3300010877 | Boreal Forest Soil | ILGAGELEVDNGNGESLNDTGVRHLRVEIQKNTPFSRLLERLSERTKKN* |
| Ga0153990_11380761 | 3300012169 | Attine Ant Fungus Gardens | TLNDSGVRHLRVEVQKNSPFSKLLERLSERLKKV* |
| Ga0137363_114409271 | 3300012202 | Vadose Zone Soil | ILGAGELEMDNGTGETMNESGVRHLRVEVQKNTPFSRLLERLSERVRKP* |
| Ga0137374_112675441 | 3300012204 | Vadose Zone Soil | NGRGELLNDTGVRHLRVEVQKNTPFAKLLDRISERVRKN* |
| Ga0137387_112644292 | 3300012349 | Vadose Zone Soil | DVGTGETLNDSGVRHLRVEVQKNSPFTRLLERLSERMKKL* |
| Ga0137386_107702961 | 3300012351 | Vadose Zone Soil | EMDNGNGETMNESGVRHLRVEVQKNTPFGRLLERLSERVRKP* |
| Ga0137416_104985571 | 3300012927 | Vadose Zone Soil | NGTGETLNDSGVRHLRVEVQKNSPFTRLLERLSERMKKV* |
| Ga0137404_123215801 | 3300012929 | Vadose Zone Soil | GETMNESGVRHLRVEVQKNTPFSRLLERLSERVRKP* |
| Ga0164306_107789991 | 3300012988 | Soil | AGELTIDTGNGETLNASGVRHLRVEVQKNSPFSKLLERLSERMKKP* |
| Ga0157369_122747062 | 3300013105 | Corn Rhizosphere | ESINDTGVRHLRVEIQKNTPFSRLLERLSERTRKN* |
| Ga0163163_132845191 | 3300014325 | Switchgrass Rhizosphere | ELEIDNGSGETLNDSGVRHLRVEVQKNTPFSRLLERLSERVKKP* |
| Ga0137403_112910303 | 3300015264 | Vadose Zone Soil | NGTGETMNESGVRHLRVEVQKNTPFSRLLERLSERVRKP* |
| Ga0134073_100714462 | 3300015356 | Grasslands Soil | YNGTGETLNDTGVRHLRVEVQKNSPFTRLLERLSERMKKL* |
| Ga0182041_104657151 | 3300016294 | Soil | DGRTATINDSGVRHLRVEVQKNSPFSRLLERLSDRLKKS |
| Ga0182033_105730242 | 3300016319 | Soil | ASQLTIDDGRGETINDSGVRHLRVEVQKNSPFSKLLERLSERLKKP |
| Ga0187778_102391261 | 3300017961 | Tropical Peatland | GADELEIDNGRGERLNDTGVRHLKVAVKKDTPFARLLDRLSDRVNRG |
| Ga0187781_114260592 | 3300017972 | Tropical Peatland | TLNDSGVRHLRVELRKNSPFSRLLERLSERLKKSP |
| Ga0187769_105447021 | 3300018086 | Tropical Peatland | RGELLNDTGVRHLKMSVKKDTPFTRLLDRLSDRINRG |
| Ga0066667_105325471 | 3300018433 | Grasslands Soil | TIDDGRGETINDTGVRHLRVEVQKNSPFTKLLERLSERLKKT |
| Ga0137408_13396811 | 3300019789 | Vadose Zone Soil | MDNGTGETMNESGVRHLRVEVQKNTPFSRLLERLSERVRKP |
| Ga0179592_105051042 | 3300020199 | Vadose Zone Soil | SQLTIDDGSGETLNDSGVRHLRIEVQKNSPFTRLLERLSERMKKV |
| Ga0210404_108531243 | 3300021088 | Soil | GEIVNDTGVRHLQVEVQKNSPFSRLLERLSERAKKS |
| Ga0213873_103085622 | 3300021358 | Rhizosphere | QLEIDNGRGESLNDSGVRHLRVQVQKNTPFSKLLDRLSERIRK |
| Ga0213874_100592661 | 3300021377 | Plant Roots | ASQLSIDNGRGETLNDSGVRHLRVEVQKNSPFSKLLERLSERLKKS |
| Ga0213876_102057481 | 3300021384 | Plant Roots | SQLSIDNGRGETLNDSGVRHLRVQVQKNSPFSRLLERLSERVKKT |
| Ga0210389_110561243 | 3300021404 | Soil | RGEVVNDTGVRHLRVEVQKNSPFSRLLERLSERVKKS |
| Ga0210387_105436891 | 3300021405 | Soil | ELEVDNGNVQTLNDTGVRHLRVEVQKNTPFSRLLERLSERTKKN |
| Ga0210386_107125141 | 3300021406 | Soil | GAGELEVDHGNSQSLNEAGVRHLRVEVQKNTPFSRLLERLSERTKKN |
| Ga0210386_115520842 | 3300021406 | Soil | DNGRGETLNDTGVRHLRVEIQKNTPFSRLLERLSERTKKN |
| Ga0213871_102294071 | 3300021441 | Rhizosphere | SIDTGTGETLNDSGVRHLRIEVQKDSPFARLLERLSERTKKT |
| Ga0210390_107054413 | 3300021474 | Soil | ELEVDNGRGETLNDTGVRHLRVEIQKNTPFSRLLERLSERSKKN |
| Ga0210398_113621672 | 3300021477 | Soil | LEVDNGRGETLNDTGVRHLRVEIQKNTPFSRLLERLSERSKKN |
| Ga0242665_102657842 | 3300022724 | Soil | ETLNDSGVRHLRVEVQKNSPFSRLLERLSERMKKA |
| Ga0247777_11170223 | 3300022917 | Plant Litter | LEMLGASDLEIDNGRGETLNDTGVRHLRVEVQKNTPFAKLLDRISERVRKN |
| Ga0247758_10094891 | 3300023079 | Plant Litter | DLEIDNGRGEILNDTGVRHLRVEVQKNTPFGKLLDRISERVRKN |
| Ga0247772_10370563 | 3300023264 | Plant Litter | LEILGASDLEIDNGRGEILNDTGVRHLRVEVQKNTPFGKLLDRISERVRKN |
| Ga0247784_10221073 | 3300023270 | Plant Litter | IDNGRGETLNDTGVRHLRVEVQKNTPFAKLLDRISERVRKN |
| Ga0228598_10229963 | 3300024227 | Rhizosphere | GRGEILNDTGVRHLRVEMQKNSPFSRLLERLSERVKKP |
| Ga0247676_10662851 | 3300024249 | Soil | ASQLSMDTGRGETINDSGVRHLRVEVQKNSPFSKLLERLSERMKKS |
| Ga0137417_10764941 | 3300024330 | Vadose Zone Soil | MDSGHGETMNESGVRHLRVEVQKNTPFGRLLERLSERVRKP |
| Ga0207699_108630141 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LSMDTGRGETINDSGVRHLRVEVQKNSPFSKLLERLSERMKKS |
| Ga0207695_100626853 | 3300025913 | Corn Rhizosphere | GASELEIDGGRGESINDTGVRHLRVEVQKNTPFGRLLERLSERVRKP |
| Ga0207694_103242871 | 3300025924 | Corn Rhizosphere | AGELEMDGGNGVSMNESGVRHLRVEVQKNTPFGRLLERLSERVRKP |
| Ga0207700_100610243 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DNGRGETINDTGVRHLRVEVQKNSPFSKLLERLSERMKKP |
| Ga0207761_10451191 | 3300027516 | Tropical Forest Soil | LGADQLEIDSGRELLNDTGVRHLKVTIQKNTPFTRLLDRLSERLNKS |
| Ga0265334_102681581 | 3300028573 | Rhizosphere | ILGASELEIDSGRGESINDTGVRHLRVEVQKNTPFSRLLERLSERTRKN |
| Ga0307515_102403671 | 3300028794 | Ectomycorrhiza | GERLNDTGVRHLKVSLQKNSPFSRLLDRLSDRVGK |
| Ga0307515_109365162 | 3300028794 | Ectomycorrhiza | DLEIDNGRGELLNDTGVRHLRVEVQKNTPFAKLLDRISERVRKN |
| Ga0311338_110924001 | 3300030007 | Palsa | GASQLSIDVGTGETINDSGVRHLQVEVQKNSPFSKLLERLSERLRKP |
| Ga0265460_130778652 | 3300030740 | Soil | SIDTGNGETLNDSGVRHLSVEVQKNSPFSRLLERLSERMRKPPAGR |
| Ga0075392_105150031 | 3300030843 | Soil | GASELEIDGGRGESINDTGVRHLRVEVQKNTPFSRLLERLSERTKKN |
| Ga0265753_10128953 | 3300030862 | Soil | SIDTGNGETLNESGVRHLRIEAQKGSPFARLLERLSERAKKA |
| Ga0302314_103283061 | 3300030906 | Palsa | NGRGETLNDTGVRHLRVEVQKNTPFSRLLERLSERSKKN |
| Ga0170834_1070067951 | 3300031057 | Forest Soil | ILGAGELEMDNGRGETINETGVRHLRVEVQKNTPFGRLLERLSERVRKP |
| Ga0170819_165213771 | 3300031469 | Forest Soil | GETMNESGVRHLRVEVQKNTPFGRLLERLSERVRKP |
| Ga0318538_103486661 | 3300031546 | Soil | NGTGETLNESGVRHLRVQVQKNSPFSRLLERLSERLRKT |
| Ga0307408_1016293201 | 3300031548 | Rhizosphere | DNGRGELLNDTAVRHLEVTVQKNSPFSRLLERLTERVRRG |
| Ga0318542_105866211 | 3300031668 | Soil | GETLNDTGVRHLRIEQQKNSPFGRLLERLSERVKKQ |
| Ga0318493_101953861 | 3300031723 | Soil | GETINDSGVRHLRVEVQRNSPFSKLLERLSERLKKP |
| Ga0318493_108945871 | 3300031723 | Soil | ILGASQLTIDDGRGETINDSGVRHLRVEVQKNSPFSKLLERLSERLKKP |
| Ga0307477_106168923 | 3300031753 | Hardwood Forest Soil | SELTIEDGSGEVVNDTGVRHLRVEVQRNSPFSRLLERLSERVKKS |
| Ga0307475_105266141 | 3300031754 | Hardwood Forest Soil | NGRGQNINDSGVRHLRVEVQKNSPFSKLLERLSERMKKS |
| Ga0318548_100144524 | 3300031793 | Soil | QLSIDSGRGETLNDTGVRHLRVQVQKNSPFSKLLERLSERLKKS |
| Ga0318576_104587862 | 3300031796 | Soil | DSGNGETLNESGVRHLRVEVQKNTPFRRLLERLSERVRKT |
| Ga0318517_100372161 | 3300031835 | Soil | ETLNDSGVRHLRVEVQKNSPFSKLLERLSERLKKS |
| Ga0306919_114235601 | 3300031879 | Soil | GESINDSAVRHLRVEVQKNSPFSKLLERLSERLKKS |
| Ga0306925_103755211 | 3300031890 | Soil | RGEIINDSGVRHLRVEVQKNSPFSKLLERLSERMKKS |
| Ga0318522_100557751 | 3300031894 | Soil | RGATINDSGVRHLRVEVQKNSPFSKLLERLSERLKKS |
| Ga0318522_100825681 | 3300031894 | Soil | LGASHLSMDTGRGEIINDSGVRHLRVEVQKNSPFSKLLERLSERMKKS |
| Ga0306921_100428041 | 3300031912 | Soil | PTINDSGVRHLRVEVQRNSPFSKLLERLSERMKKS |
| Ga0318563_1000085410 | 3300032009 | Soil | LTIEDGRTATINDSGVRHLRVEVQKNSPFSRLLERLSERMKKS |
| Ga0318507_102460592 | 3300032025 | Soil | GQNINDSGVRHLRVEVQKNSPFSKLLERLSERLKKP |
| Ga0310911_103649021 | 3300032035 | Soil | RTATINDSGVRHLRVEVQKNSPFSRLLERLSERMKKS |
| Ga0318545_100231711 | 3300032042 | Soil | TIDTGRGENINDSGVRHLRVEVQKNSPFSKLLERLSERLRKS |
| Ga0318570_100911421 | 3300032054 | Soil | GETLNDTGVRHLRVQVQKNSPFSKLLERLSERLKKS |
| Ga0318575_101048571 | 3300032055 | Soil | EILGASQLTIDSGRGETLNDTGVRHLRVEVQKNSPFSKLLERLSERMKKS |
| Ga0306924_120574382 | 3300032076 | Soil | GRELLNDTGVRHLKVTVQKNTPFTRLLDRLSERLNKS |
| Ga0318525_101386311 | 3300032089 | Soil | ASQLTIDTGRGATINDSGVRHLRVEVQKNSPFSKLLERLSERLKKS |
| Ga0307470_101315701 | 3300032174 | Hardwood Forest Soil | EDGRGEIVNDTGVRHLRVEVQKNSPFSRLLERLSERVKKP |
| Ga0335078_120935683 | 3300032805 | Soil | DDRGEIVNDTGVRHLQVEVQKNSPFSRLLERLSERAKKS |
| Ga0335070_102304582 | 3300032829 | Soil | QGSNELINESGVRHLRVEVQKNSPFSKLLDRLSERMKKP |
| Ga0335074_102299033 | 3300032895 | Soil | LAIDTGSGDSANDTGVRHLRVEVQKNTPFSRLLERLSERVKKA |
| Ga0318519_108481522 | 3300033290 | Soil | SGRGETLNDTGVRHLRVQVQKNSPFSKLLERLSERLKKS |
| Ga0310810_102652723 | 3300033412 | Soil | IDNGRGETINDTGVRHLRVEVQKNSPFSKLLERLSERMKKP |
| ⦗Top⦘ |