| Basic Information | |
|---|---|
| Family ID | F085927 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MGKFILGVIVTLLVLILGGLGIAMLGFLPTNANVAPPHLEH |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 96.40 % |
| % of genes near scaffold ends (potentially truncated) | 98.20 % |
| % of genes from short scaffolds (< 2000 bps) | 93.69 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.360 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.622 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.027 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.360 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF02780 | Transketolase_C | 72.07 |
| PF03747 | ADP_ribosyl_GH | 6.31 |
| PF08282 | Hydrolase_3 | 1.80 |
| PF00248 | Aldo_ket_red | 0.90 |
| PF02604 | PhdYeFM_antitox | 0.90 |
| PF00155 | Aminotran_1_2 | 0.90 |
| PF00676 | E1_dh | 0.90 |
| PF13442 | Cytochrome_CBB3 | 0.90 |
| PF13857 | Ank_5 | 0.90 |
| PF02357 | NusG | 0.90 |
| PF04389 | Peptidase_M28 | 0.90 |
| PF01553 | Acyltransferase | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1397 | ADP-ribosylglycohydrolase | Posttranslational modification, protein turnover, chaperones [O] | 6.31 |
| COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 1.80 |
| COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 1.80 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 1.80 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.80 |
| COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 1.80 |
| COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.90 |
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 0.90 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 0.90 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.90 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.36 % |
| All Organisms | root | All Organisms | 39.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.62% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.31% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.41% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.41% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.41% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.70% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.70% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.80% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.90% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.90% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300003352 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027370 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028574 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029919 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030759 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Host-Associated | Open in IMG/M |
| 3300033888 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_100547573 | 3300000567 | Peatlands Soil | MGKFLLGVIVTVLVLILGGLGFAMLGFFPTAANVTPPRLEHRL |
| JGI26345J50200_10365131 | 3300003352 | Bog Forest Soil | MRKFILGVIVTLLALILGGLGFAALGFLPTHANVPPPRWEHHL |
| JGI26337J50220_10346931 | 3300003370 | Bog Forest Soil | MGKFILGVIVTVLVVILGGLGLAMLGFIPTTANVDPPHLERRIANGAVD |
| Ga0062387_1016377692 | 3300004091 | Bog Forest Soil | MRKFLLGVIVTLLILILGGLGFAMLGFFPTPANVPPPHLERRLAMGAV |
| Ga0062386_1013356621 | 3300004152 | Bog Forest Soil | MGKFILGIIVTVLVLILGGLGFAMLGLFPTNANVAPPHLEKRIAN |
| Ga0070697_1004255762 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKFILGVIVTLLVLVLGGLGFAMLGFFPTNANVAPPHIEER |
| Ga0070732_103909361 | 3300005542 | Surface Soil | MGKFAVGVIVTLLVVILGGLGFAMLGFFPTAANVEPPHIE |
| Ga0066661_100984951 | 3300005554 | Soil | MSKFLLGVIVTLLVLILGGLGFALLGFFPTAANVEPPHWEQHFAMG |
| Ga0066654_102989463 | 3300005587 | Soil | MGKFLLGIIVTLVLLALIGFGVLSLGFFPTAANVP |
| Ga0066789_104473411 | 3300005994 | Soil | MGKFILGVIVTLLVLVLGGLGFAMLGFFPTPANVEPPH |
| Ga0070765_1010764241 | 3300006176 | Soil | MRKFILGVIVTLLALILGGLGFATLGFIPTHANVAPPRWEH |
| Ga0116214_10019531 | 3300009520 | Peatlands Soil | MGKFILGVIITLLVLVLGGLGFAMLGFIPTNANVPPPHL |
| Ga0116222_11638981 | 3300009521 | Peatlands Soil | MGKFVLGVIVTILILVLGGLGFAMLGFIPTNANVAPPHLERRIAM |
| Ga0116116_11549602 | 3300009621 | Peatland | MGKFILGVIVTVLVLVLGGLGLAMLGFIPTNANVAPPHLERR |
| Ga0116133_10644362 | 3300009623 | Peatland | MGKFILGVIVALLVVVLGGLGLATLGFIPTAANVAPPHWERHLAN |
| Ga0116117_11181511 | 3300009635 | Peatland | MGKFVLGVIVTLAVLTLGVLGAAMLGFLPTYANVAP |
| Ga0116135_14959932 | 3300009665 | Peatland | MGKFLLGVIVTVLVLILGGLGIAMLGFIPTTANVPPSH |
| Ga0116215_13561292 | 3300009672 | Peatlands Soil | MGKFVLGVIVTILILVLGGLGFAMLGFIPTNANVAPPHLERRIAMG |
| Ga0116223_105370282 | 3300009839 | Peatlands Soil | MGKFILGIIATLLIVILGGLGFAMLGFVPTAANVEPPHFERRFAMGAV |
| Ga0126384_121430572 | 3300010046 | Tropical Forest Soil | MGKFLLGMIVTLLVLILGGLGFALLGFFPTNANVDPPH* |
| Ga0126381_1023110841 | 3300010376 | Tropical Forest Soil | MGKFLVGVIITLLILVFGGLGFALLGFFSTTANVEPPHWEQH |
| Ga0150983_129499701 | 3300011120 | Forest Soil | MGKFALGVVVTLLVLVLGGLGFAMLGFFPTAANVEPPHLEH |
| Ga0137372_111742801 | 3300012350 | Vadose Zone Soil | MGKFLLGVVVTLLVLILGGLGLAMLGFFPTAANVPPPHIESR |
| Ga0137390_102529273 | 3300012363 | Vadose Zone Soil | MGKFILGVVLTLLMLILGGLGFAMLGFFPTAANVAPPRLEQR |
| Ga0182037_119967392 | 3300016404 | Soil | MGKFLLGVIVTLLVLILGGLGFALLGFFPTTANVE |
| Ga0187819_103700152 | 3300017943 | Freshwater Sediment | MSKFIFGIIFTLLVLILGGLGFAMLGFFPTNANVVPPHLEKRIANGAID |
| Ga0187817_108544932 | 3300017955 | Freshwater Sediment | MGKFLLGVILTLLILVLGVLGIGMLGFLPTTANVE |
| Ga0187780_106911983 | 3300017973 | Tropical Peatland | MGKFLLGIIVTLLVLVLGGLGFVMLGFFPTAANVTPP |
| Ga0187782_115903691 | 3300017975 | Tropical Peatland | MGKFLLGVIVTLIVLVLGGLGYALFGFIPTDANVEPPKMERHLANGSMD |
| Ga0187865_10800652 | 3300018004 | Peatland | MGKFILGVIVTVLVLVLGGLGLAMLGFIPTNADVAPPHLERRIANGAVD |
| Ga0187804_104393382 | 3300018006 | Freshwater Sediment | MGKFIIGVIITLIVLILGGLGFAMFGFMPTQANVAPP |
| Ga0187890_102831991 | 3300018044 | Peatland | MGKFLLGVIVTLLVLILGGLGVAMLGFITTNDKNATSNME |
| Ga0187766_112229661 | 3300018058 | Tropical Peatland | MGKFLLGIIVTLLALILGGLGFVMLGFFPTAANVTPPRLE |
| Ga0187772_109031732 | 3300018085 | Tropical Peatland | MGKFLFGVIITLLILVLGGIGAAILGLIPTYANIAPPHWETHFA |
| Ga0187769_114625572 | 3300018086 | Tropical Peatland | MGKFLLGVIVTLVVLILGGLGLGLLGFIPTAANVAPSHLESRVAMASLD |
| Ga0187770_115336372 | 3300018090 | Tropical Peatland | VGKFFFGVIITLLVIVLGFLGAAMLGFIPTNANVAPP |
| Ga0193729_11053342 | 3300019887 | Soil | MGKFILGIVLTLLVLILGGLGFAMLGFFPTTANVAPPKLEQRIAN |
| Ga0210403_107482001 | 3300020580 | Soil | MGKFILGVIVTVLVLILGGLGIAMLGFIPTTANVALSH |
| Ga0210400_101584243 | 3300021170 | Soil | MGKFILGVIITLLVLILGGLGMAMLGFIPTNANAIPPRWETRIANTAVD |
| Ga0210400_108909122 | 3300021170 | Soil | MGKFALGVVVTLLILILGGLGFAMLGFFPTAANVEPPRVER |
| Ga0210405_109956152 | 3300021171 | Soil | MGKFALGVIVTLLVLVLGGLGLAMLGFFPTAANVEPPHLERRLAMGA |
| Ga0210408_113620902 | 3300021178 | Soil | MGKFILGVIVTFLVLILGGLGFAMLGFFPTNANVVP |
| Ga0210388_106053601 | 3300021181 | Soil | MGKFVLGVIITFLILILCGLGFAMLGFFPTPANVAPPRWERRLANTAVD |
| Ga0210388_115712441 | 3300021181 | Soil | MGKFILGVIVTVLVLILGGLGIAMLGFIPTTANVAPSHLELHLANTAMDA |
| Ga0210385_104731131 | 3300021402 | Soil | MGKFILGVIVTLLVLVLGGLGYAMLGFFPTAANVEPGHMER |
| Ga0210385_104798281 | 3300021402 | Soil | MGKFILGVIVTLLVLILGGLGFATLGFLPTHANVEP |
| Ga0210387_104567581 | 3300021405 | Soil | MRKFILGIIFTLLVLILGGLGLASLGFLPTQANVPPPRWE |
| Ga0210387_111867802 | 3300021405 | Soil | MGKFILGVIVTLLVLVLGGLGYAMLGFFPTAANVEPGHMERHFSM |
| Ga0210386_109114041 | 3300021406 | Soil | VGKFILGVIITLAVLILGGLGLAMLGFIPTNANVA |
| Ga0210394_101011544 | 3300021420 | Soil | MGKFILGVIITLLVLVLGGLGYAMLGFIPTNANVAPSHLEHRL |
| Ga0210394_112612392 | 3300021420 | Soil | MRKFILGVIVTLLVVILGGLGFATLGYMPTSANVAPPRWEHQLAN |
| Ga0210394_113582551 | 3300021420 | Soil | MGKFALGVIVTLLVLVLGGLGLAMLGFFPTAANVEPPH |
| Ga0210391_104369542 | 3300021433 | Soil | MRKFILGVIVTLLVVILGGLGFATLGYMPTSANVAPPRW |
| Ga0210398_102682541 | 3300021477 | Soil | MGKFILGVIVTVLVLILGGLGIAMLGFIPTTANVAPSHLEQPLA |
| Ga0210398_112321501 | 3300021477 | Soil | MGKFILGVIVTLLVLILGVLGYAMLGFFPTAANVEPG |
| Ga0210409_115237751 | 3300021559 | Soil | MKKFILGVIVTLLVIILGGLGVAMLGFIPTAANVEPPHLERHLAMG |
| Ga0242657_11107182 | 3300022722 | Soil | GKFALGVVVTLLILILGGLGFAMLGFFPTAANVEPPPVERR |
| Ga0224556_10647051 | 3300024295 | Soil | MGKFILGVIVTVLVIVLGGLGFAMLGFIPTNANVAPPHLE |
| Ga0208936_10126912 | 3300025404 | Peatland | MGKFILGVIVTLLVLILGGLGIAMLGFLPTNANVAPPHLEHRIAMGAVDAE |
| Ga0208848_10882901 | 3300025509 | Arctic Peat Soil | MGKFILGVIVTLLVLVLGGLGFAMLGFFPTPANVEPPHMERRL |
| Ga0207699_101332542 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKFTLGVIVTLVVLILGALGFATLGFLPTKANVEPPHF |
| Ga0207663_111888971 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKFTLGVIVTLLVLVLGGLGFAMLGFFPTAPNVEP |
| Ga0207664_107394201 | 3300025929 | Agricultural Soil | MGKFLLGVIVTLVALILVTLGVATMGLFPTPANVEPSHLERH |
| Ga0207665_115525952 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MGKFLLGVIVTLLVLILGGLGFAMLGFFPTAANVEPPRFESHLAMGAV |
| Ga0209839_102114642 | 3300026294 | Soil | MGKFTLGAIVMLLVIILGGLGFATLGFLPTVANVVPPHM |
| Ga0257181_10810731 | 3300026499 | Soil | MGKFILGVVLTLLVLILGGLGFAMLGFFPTAANVAP |
| Ga0179587_109459011 | 3300026557 | Vadose Zone Soil | MRRFILGVVVTLLVLILGALGFAMLGFFPTAANVEPPHLGRNLAMYAAC |
| Ga0209010_10686892 | 3300027370 | Forest Soil | MGKFALGVMVTLLVLILGGLGLAMLGFFPTAANVEPPHMER |
| Ga0209222_10196751 | 3300027559 | Forest Soil | MGKFILGVMVTVLVIVLGGLGFAMLGFLPTTANTAPPH |
| Ga0209527_10182161 | 3300027583 | Forest Soil | MGKFILGVVLTLLVLILGGLGFAMLGFFPTTANVAPPRFEQRI |
| Ga0209038_101914742 | 3300027737 | Bog Forest Soil | MRKFILGVIVTLLVLILGGLGFATLGFLPTNANVAPPRWERQLANAAVD |
| Ga0209656_105233162 | 3300027812 | Bog Forest Soil | MGKFILGFIVACLAVIFGGLGLATLGFIPTTANVAPPHW |
| Ga0209060_105447902 | 3300027826 | Surface Soil | MGKFLLGVVITLLVLILGGLGFAMLGFFPTAANVEPP |
| Ga0209274_105164422 | 3300027853 | Soil | VGKFILGVIITAAVLVIGGLSFAMLGFLPTEATTAPPRFEQRLAHG |
| Ga0209275_100283051 | 3300027884 | Soil | VGKFILGVILTTAVLVLGGLGIATLGFFPTEANTAPPRLE |
| Ga0209624_104581102 | 3300027895 | Forest Soil | MGKFILGVIITLLVLILCALGFAMLGFFPTPANVPPP |
| Ga0209624_110408161 | 3300027895 | Forest Soil | MGKFILGVIVTIVVLILSGLAFARLGFFPTAANVEPPYL |
| Ga0302153_101842272 | 3300028574 | Bog | MGKFILGVIVTLLVLILGGLGIAMLGFLPTNANVAPPHLEH |
| Ga0222749_102244062 | 3300029636 | Soil | MGKFTLGVIVTLLVLLLGGLGFAMLGFLPTAANVEPPHLERRLAMGAVD |
| Ga0311368_101717031 | 3300029882 | Palsa | MGKFLLGVIVTVLVLILGGLGIAMLGFIPTTANVP |
| Ga0311327_103435142 | 3300029883 | Bog | MGKFILGVIVTLLVLVLGGLGLAMLGFLPTNANEAPPH |
| Ga0311341_102696272 | 3300029908 | Bog | MGKFILGVIVTLLVLILGGLGIAMLGFLPTNANVAPPHLEHRI |
| Ga0311359_103432222 | 3300029914 | Bog | MGKFILGVIVTLLVLILGGLGFAMLGFFPTRANVAPPHLESRIAMEAV |
| Ga0302141_11311982 | 3300029919 | Bog | MGKFLLGVIVTLLVLILGGLGLAMLGFLPTRANVSPPQLEKRIAMGAVD |
| Ga0311371_115710901 | 3300029951 | Palsa | MGKFILGVIVTLIVIILGGLGIATLGFLPTKANVPPP |
| Ga0311371_120444252 | 3300029951 | Palsa | MGKFILGIIVTLLALILGALGFAMLGFFPTRADVAPPGWEHHL |
| Ga0302196_104793651 | 3300030225 | Bog | MGKFLLGVIVTLLVLILGGLGLAMLGFLPTRANVSPPQLE |
| Ga0311353_113958661 | 3300030399 | Palsa | MGKFILGVIVTVLVLILGGLGIAMLGFLPTNANVAP |
| Ga0311357_111544361 | 3300030524 | Palsa | MGKFILGVIVTLLVLILGGLGFAMLGFFPTNANVAPPHIEKRIAN |
| Ga0265745_10308452 | 3300030759 | Soil | VSKFILGVIITLAVLILGGLGLAMLGFIPTNANVAPPHLEH |
| Ga0265746_10311282 | 3300030815 | Soil | MGKFILGVIVTVLVLILGGLGIAMLGFIPTTANVAPSHLEQHLANTA |
| Ga0265746_10399911 | 3300030815 | Soil | VGKFILGVILTTAVLVLGGLGIATLGFFPTEANTAPPRLEQRVAQAAL |
| Ga0265760_101848292 | 3300031090 | Soil | VGKFILGVIVTAAFLVLGGLGVGMLGFLPTKANSAPPRLEQR |
| Ga0302324_1001341901 | 3300031236 | Palsa | MGKFILGVIVTLVVLILCGLGFAVLGFFPTPANVAPPRWEHRLANT |
| Ga0265340_103232041 | 3300031247 | Rhizosphere | MGKFILGVIVTLLVLLLGGLGIATLGFFPTPANVEPGHLERRLAM |
| Ga0170818_1053754412 | 3300031474 | Forest Soil | MIKFILGIIVTLAVLVLCVLGFAMLGFFPTAANVPPPQFERRFAMGAVD |
| Ga0318542_101131582 | 3300031668 | Soil | MRSFILGIIFTLAILILGGLSAALLGFIPTTANVE |
| Ga0310686_10192040013 | 3300031708 | Soil | MGKFILGIIVTLLVLILGGLGFAMLGFFPTAANVDPPHMESHLLMSAVD |
| Ga0310686_1066849291 | 3300031708 | Soil | MGKFILGVIVTLLVLILGGLGIAMLGFIPTTANVAPSHLEQHLANTA |
| Ga0307474_102727701 | 3300031718 | Hardwood Forest Soil | MGKFIFGVVVTLLILVLGGLGFAMLGFFHTAANVEPPHMEHHMMMGA |
| Ga0307474_109928722 | 3300031718 | Hardwood Forest Soil | MGKFILGVIITLLVLILCALGFAMLGFFPTPANVPPPRWEH |
| Ga0307475_107145531 | 3300031754 | Hardwood Forest Soil | MGKFLLGIIVTLLVLVLGGLGFAMLGFFPTNANVAPPPLEKRIA |
| Ga0307478_110804382 | 3300031823 | Hardwood Forest Soil | MGKFALGVVVTLLILILGGLGFAMLGFFPTAANVEPP |
| Ga0318533_105059461 | 3300032059 | Soil | MRNFMLGVIVTLGVLVLGGLGLGLLGFLPSAANADPPS |
| Ga0307470_104981571 | 3300032174 | Hardwood Forest Soil | MGKILLGIIVAVLVLVLCGLGFALLGFFPTAANVEPPH |
| Ga0335078_115445932 | 3300032805 | Soil | MGKFILGFIIAIAVLILGALGFLVLGLFPTAANVAPPSWEHHIAL |
| Ga0335081_116673413 | 3300032892 | Soil | MGKFLLGIIVTLLVLVLGGLCFVMLGFFPTAANVTPPRLENRLANT |
| Ga0335071_117827601 | 3300032897 | Soil | MGKFLLGVIVTLLVLVLGGLGYAMLGFFPTAGNKKPPDWET |
| Ga0316214_10428392 | 3300033545 | Roots | MGKFILGVIVTILVLILGGLGIAMLGFIPTTANVAPSHLELHLANTAMD |
| Ga0334792_019844_3_152 | 3300033888 | Soil | MSGGFMGKFILGVVVTLLVLALGALGFAMLGFFPTPANVEPGHMERRLAM |
| Ga0370483_0327783_3_134 | 3300034124 | Untreated Peat Soil | MGKFILGVIVTLLVLILGGLGIAMLGFLPTNANVAPPHLEHRIA |
| ⦗Top⦘ |