| Basic Information | |
|---|---|
| Family ID | F085900 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MNKKIFAQLLGYSQNDLDKITQPYILETFGVEVDRCDTLEQ |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 11.71 % |
| % of genes near scaffold ends (potentially truncated) | 99.10 % |
| % of genes from short scaffolds (< 2000 bps) | 98.20 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.955 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (22.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (72.072 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.288 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.88% β-sheet: 0.00% Coil/Unstructured: 68.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF01970 | TctA | 1.80 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1784 | TctA family transporter | General function prediction only [R] | 1.80 |
| COG3333 | TctA family transporter | General function prediction only [R] | 1.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.95 % |
| All Organisms | root | All Organisms | 45.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10092057 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10198626 | Not Available | 619 | Open in IMG/M |
| 3300001450|JGI24006J15134_10256311 | Not Available | 500 | Open in IMG/M |
| 3300001969|GOS2233_1111808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1904 | Open in IMG/M |
| 3300005912|Ga0075109_1253431 | Not Available | 531 | Open in IMG/M |
| 3300005914|Ga0075117_1070845 | Not Available | 1074 | Open in IMG/M |
| 3300005914|Ga0075117_1198738 | Not Available | 559 | Open in IMG/M |
| 3300006025|Ga0075474_10044119 | All Organisms → Viruses → Predicted Viral | 1526 | Open in IMG/M |
| 3300006190|Ga0075446_10045871 | Not Available | 1367 | Open in IMG/M |
| 3300006193|Ga0075445_10190411 | Not Available | 721 | Open in IMG/M |
| 3300006565|Ga0100228_1072661 | All Organisms → Viruses → Predicted Viral | 1290 | Open in IMG/M |
| 3300006737|Ga0098037_1058783 | All Organisms → Viruses → Predicted Viral | 1374 | Open in IMG/M |
| 3300006737|Ga0098037_1153191 | Not Available | 773 | Open in IMG/M |
| 3300006789|Ga0098054_1174129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 789 | Open in IMG/M |
| 3300006810|Ga0070754_10215101 | Not Available | 890 | Open in IMG/M |
| 3300006924|Ga0098051_1065895 | Not Available | 989 | Open in IMG/M |
| 3300006928|Ga0098041_1193635 | Not Available | 651 | Open in IMG/M |
| 3300007236|Ga0075463_10071028 | All Organisms → Viruses → Predicted Viral | 1124 | Open in IMG/M |
| 3300007236|Ga0075463_10203407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 638 | Open in IMG/M |
| 3300007538|Ga0099851_1158847 | Not Available | 838 | Open in IMG/M |
| 3300007542|Ga0099846_1074931 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
| 3300009001|Ga0102963_1182759 | Not Available | 839 | Open in IMG/M |
| 3300009425|Ga0114997_10135556 | Not Available | 1468 | Open in IMG/M |
| 3300009425|Ga0114997_10661255 | Not Available | 548 | Open in IMG/M |
| 3300009435|Ga0115546_1131223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 893 | Open in IMG/M |
| 3300009447|Ga0115560_1166945 | Not Available | 867 | Open in IMG/M |
| 3300009449|Ga0115558_1304038 | Not Available | 634 | Open in IMG/M |
| 3300009703|Ga0114933_10897086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 563 | Open in IMG/M |
| 3300010149|Ga0098049_1221730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 577 | Open in IMG/M |
| 3300010368|Ga0129324_10212442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 782 | Open in IMG/M |
| 3300010389|Ga0136549_10378455 | Not Available | 577 | Open in IMG/M |
| 3300011258|Ga0151677_1145771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 614 | Open in IMG/M |
| 3300012928|Ga0163110_10200748 | All Organisms → Viruses → Predicted Viral | 1413 | Open in IMG/M |
| 3300012936|Ga0163109_10905664 | Not Available | 644 | Open in IMG/M |
| 3300012954|Ga0163111_10264479 | All Organisms → Viruses → Predicted Viral | 1514 | Open in IMG/M |
| 3300016747|Ga0182078_10618379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 748 | Open in IMG/M |
| 3300017697|Ga0180120_10376932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 559 | Open in IMG/M |
| 3300017720|Ga0181383_1130512 | Not Available | 674 | Open in IMG/M |
| 3300017720|Ga0181383_1173866 | Not Available | 575 | Open in IMG/M |
| 3300017731|Ga0181416_1014483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1860 | Open in IMG/M |
| 3300017743|Ga0181402_1127526 | Not Available | 650 | Open in IMG/M |
| 3300017745|Ga0181427_1150867 | Not Available | 563 | Open in IMG/M |
| 3300017753|Ga0181407_1182434 | Not Available | 512 | Open in IMG/M |
| 3300017758|Ga0181409_1226277 | Not Available | 535 | Open in IMG/M |
| 3300017760|Ga0181408_1185035 | Not Available | 531 | Open in IMG/M |
| 3300017762|Ga0181422_1227624 | Not Available | 556 | Open in IMG/M |
| 3300017764|Ga0181385_1137257 | Not Available | 744 | Open in IMG/M |
| 3300017767|Ga0181406_1155826 | Not Available | 684 | Open in IMG/M |
| 3300017783|Ga0181379_1297040 | Not Available | 549 | Open in IMG/M |
| 3300017824|Ga0181552_10296847 | Not Available | 798 | Open in IMG/M |
| 3300017951|Ga0181577_10878001 | Not Available | 536 | Open in IMG/M |
| 3300017956|Ga0181580_11017883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 512 | Open in IMG/M |
| 3300017958|Ga0181582_10446832 | Not Available | 814 | Open in IMG/M |
| 3300017958|Ga0181582_10765104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 577 | Open in IMG/M |
| 3300018039|Ga0181579_10336103 | Not Available | 833 | Open in IMG/M |
| 3300018049|Ga0181572_10569241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 691 | Open in IMG/M |
| 3300018049|Ga0181572_10633069 | Not Available | 648 | Open in IMG/M |
| 3300018049|Ga0181572_10822637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 553 | Open in IMG/M |
| 3300018415|Ga0181559_10238957 | Not Available | 1029 | Open in IMG/M |
| 3300018424|Ga0181591_11017175 | Not Available | 562 | Open in IMG/M |
| 3300019459|Ga0181562_10559341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 538 | Open in IMG/M |
| 3300020165|Ga0206125_10374287 | Not Available | 522 | Open in IMG/M |
| 3300020189|Ga0181578_10175355 | All Organisms → Viruses → Predicted Viral | 1096 | Open in IMG/M |
| 3300020279|Ga0211634_1124750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 551 | Open in IMG/M |
| 3300020315|Ga0211589_1029450 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300020346|Ga0211607_1039953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 992 | Open in IMG/M |
| 3300020366|Ga0211489_10233811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 518 | Open in IMG/M |
| 3300020374|Ga0211477_10135835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 885 | Open in IMG/M |
| 3300020379|Ga0211652_10157127 | Not Available | 692 | Open in IMG/M |
| 3300020404|Ga0211659_10181416 | Not Available | 949 | Open in IMG/M |
| 3300020414|Ga0211523_10057911 | All Organisms → Viruses → Predicted Viral | 1659 | Open in IMG/M |
| 3300020414|Ga0211523_10266001 | Not Available | 705 | Open in IMG/M |
| 3300020416|Ga0211644_10037029 | All Organisms → Viruses → Predicted Viral | 1979 | Open in IMG/M |
| 3300020417|Ga0211528_10263863 | Not Available | 649 | Open in IMG/M |
| 3300020436|Ga0211708_10167806 | Not Available | 876 | Open in IMG/M |
| 3300020436|Ga0211708_10427509 | Not Available | 543 | Open in IMG/M |
| 3300020442|Ga0211559_10057142 | All Organisms → Viruses → Predicted Viral | 1911 | Open in IMG/M |
| 3300020442|Ga0211559_10205267 | Not Available | 930 | Open in IMG/M |
| 3300020461|Ga0211535_10195501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 888 | Open in IMG/M |
| 3300020463|Ga0211676_10302785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 911 | Open in IMG/M |
| 3300020463|Ga0211676_10405745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 744 | Open in IMG/M |
| 3300020463|Ga0211676_10637459 | Not Available | 539 | Open in IMG/M |
| 3300020467|Ga0211713_10262534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 832 | Open in IMG/M |
| 3300020469|Ga0211577_10650937 | Not Available | 622 | Open in IMG/M |
| 3300020470|Ga0211543_10516682 | Not Available | 567 | Open in IMG/M |
| 3300021365|Ga0206123_10149886 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1069 | Open in IMG/M |
| 3300021960|Ga0222715_10427475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 718 | Open in IMG/M |
| 3300022198|Ga0196905_1145060 | Not Available | 613 | Open in IMG/M |
| 3300022927|Ga0255769_10087687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 1635 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10098542 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
| 3300023084|Ga0255778_10314089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 713 | Open in IMG/M |
| 3300023175|Ga0255777_10275022 | Not Available | 966 | Open in IMG/M |
| 3300023229|Ga0222661_1043814 | Not Available | 577 | Open in IMG/M |
| 3300023294|Ga0222670_1056673 | Not Available | 567 | Open in IMG/M |
| 3300025120|Ga0209535_1131547 | Not Available | 828 | Open in IMG/M |
| 3300025151|Ga0209645_1200911 | Not Available | 588 | Open in IMG/M |
| 3300025502|Ga0208903_1075410 | Not Available | 790 | Open in IMG/M |
| 3300025590|Ga0209195_1139046 | Not Available | 505 | Open in IMG/M |
| 3300025769|Ga0208767_1043184 | All Organisms → Viruses → Predicted Viral | 2177 | Open in IMG/M |
| 3300025809|Ga0209199_1256255 | Not Available | 569 | Open in IMG/M |
| 3300025876|Ga0209223_10079349 | Not Available | 1868 | Open in IMG/M |
| 3300026182|Ga0208275_1073489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 664 | Open in IMG/M |
| 3300027687|Ga0209710_1097521 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
| 3300027752|Ga0209192_10082090 | Not Available | 1366 | Open in IMG/M |
| 3300027779|Ga0209709_10246686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 795 | Open in IMG/M |
| 3300027788|Ga0209711_10286687 | Not Available | 718 | Open in IMG/M |
| 3300027847|Ga0209402_10364566 | Not Available | 881 | Open in IMG/M |
| 3300029319|Ga0183748_1019643 | All Organisms → Viruses → Predicted Viral | 2433 | Open in IMG/M |
| 3300031606|Ga0302119_10242100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 687 | Open in IMG/M |
| 3300031623|Ga0302123_10133102 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300032278|Ga0310345_10757012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37 | 943 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 22.52% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.02% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 15.32% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 10.81% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.21% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.50% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 3.60% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.70% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.80% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.80% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.80% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.80% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.90% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.90% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.90% |
| Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300005912 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKD | Environmental | Open in IMG/M |
| 3300005914 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009449 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016747 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018415 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020279 | Marine microbial communities from Tara Oceans - TARA_B100000482 (ERX555939-ERR599017) | Environmental | Open in IMG/M |
| 3300020315 | Marine microbial communities from Tara Oceans - TARA_B100000405 (ERX555948-ERR598972) | Environmental | Open in IMG/M |
| 3300020346 | Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556057-ERR599069) | Environmental | Open in IMG/M |
| 3300020366 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX556091-ERR599146) | Environmental | Open in IMG/M |
| 3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020461 | Marine microbial communities from Tara Oceans - TARA_B100000401 (ERX556127-ERR599150) | Environmental | Open in IMG/M |
| 3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| 3300023229 | Saline water microbial communities from Ace Lake, Antarctica - #551 | Environmental | Open in IMG/M |
| 3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025502 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKJ (SPAdes) | Environmental | Open in IMG/M |
| 3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300026182 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031606 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax | Environmental | Open in IMG/M |
| 3300031623 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100920571 | 3300000117 | Marine | MNKKIFSRLLGDTQNDLTKISQPYIMETFGVKVDRCDTIEQYVEAIDT |
| DelMOWin2010_101986261 | 3300000117 | Marine | MNKKIFAQLLAHSQNDLTKITQPYILETFGVEVERCDTLEQYVEAIDDAC |
| JGI24006J15134_102563112 | 3300001450 | Marine | MNKKIFAQLLGHSQNDIDKITQPYIMETFGVEVARCDTLE |
| GOS2233_11118085 | 3300001969 | Marine | MNKKIFARLVADTHNDVEKVTQPYILETFGVEVSRCETLEKYSELIDD |
| Ga0075109_12534311 | 3300005912 | Saline Lake | MNKKIFAQLLGYSQNDLDKVTQPYILETFGVEVDRCDTL |
| Ga0075117_10708452 | 3300005914 | Saline Lake | MNKKIFAELLAYSQNDLDKITQPYILETFGVNVDRCDTLEQYA |
| Ga0075117_11987382 | 3300005914 | Saline Lake | MNKKIFAELLVHSENDLNKINMPYIQETFGVEVDRCDT |
| Ga0075474_100441191 | 3300006025 | Aqueous | MNKKIFSQLLSYSQNNLDRITQPYIKETFGVQVDRCETL |
| Ga0075446_100458711 | 3300006190 | Marine | MNKKIFAELLAYSQNDLDKITQPYVLETFGVEVTRCETLEKYAEAIDVA |
| Ga0075445_101904111 | 3300006193 | Marine | MNKKIFAQLLGHSQNDLTKITLPYIKETFGVEVDRYDTLEQ |
| Ga0100228_10726613 | 3300006565 | Marine | MNKKIFAKLLGHSQNDLSKITQPFIKETFGVEVKRCDTL |
| Ga0098037_10587833 | 3300006737 | Marine | MNKKIFSKLLGHSQNDLTKITQPYIKETFGVEVKRCDTLEQYVE |
| Ga0098037_11531912 | 3300006737 | Marine | MNKKIFARLLAQSQNDLSKITQPFIKETFGVEVKRCDTIEQYVEAIDDA |
| Ga0098054_11741293 | 3300006789 | Marine | MNKKIFAKLLGHSQNDLTKVTQPFIKETFGVEVKHCD |
| Ga0070754_102151012 | 3300006810 | Aqueous | MNKRIFAQLLADSQNDLEKITQPYILETFGVEVKRCE |
| Ga0098051_10658951 | 3300006924 | Marine | MNKKIFSKLLGYSQNDLTKITQPFIKETFGVEVKRCDTIEEYVEAIDNA |
| Ga0098041_11936352 | 3300006928 | Marine | MNKKIFSKLLGYSQNDLTKITQPFIKETFGVEVKRCDTIEEYVEAIDN |
| Ga0075463_100710281 | 3300007236 | Aqueous | MNKKIFAQLLAHSQNDLTKITQPYILETFDVEVKRCDTIEQYVEA |
| Ga0075463_102034072 | 3300007236 | Aqueous | MNKKIFAQLLTHSQNDLAKITDPYIRETFGVTVKRCDTL |
| Ga0099851_11588471 | 3300007538 | Aqueous | MNKKIFARLLAHSENNIEKITQPYILETFGVEVKRCETIEQ |
| Ga0099846_10749313 | 3300007542 | Aqueous | MNKKIFAQLLAYSQNDLDKITQPYIQETFGVVVKRCETLEEYTQVIDDA* |
| Ga0102963_11827591 | 3300009001 | Pond Water | MNKKIFAQLLAHSQNDLTKITQPYILETFGVEVKRCDTIEQYVEAIDDAC |
| Ga0114997_101355563 | 3300009425 | Marine | MNKKIFAQLLGHSQNDLDKVTQPYIQETFVVEVARCDTLEQYVEAIDVAC |
| Ga0114997_106612552 | 3300009425 | Marine | MNKKIFAQLLGHSQNELDKISQPYILETFGVEVDRCNTLEQYAEAISIACL |
| Ga0115546_11312231 | 3300009435 | Pelagic Marine | MNKKIFAQLLSYSQNNIDKITQPYIKEKFGVDVKRCDTIEQYVEVID |
| Ga0115560_11669451 | 3300009447 | Pelagic Marine | MNKKIFAQLLGYSQNDLDKITQPWIMETFGVEVKR |
| Ga0115558_13040381 | 3300009449 | Pelagic Marine | MNKKIFAQLLAHSQNDLTKITQPYILETFGVEVKRCDTLEQYTDAIDNAC |
| Ga0114933_108970862 | 3300009703 | Deep Subsurface | MNKKIFAKLLGHSQNDLSKITQPFIKETFGVEVKRCDTLEQYTDAID |
| Ga0098049_12217302 | 3300010149 | Marine | MNKKIFAKLLRHSQNDLSKITQPFIKETFGVEVKRCDTLEQ |
| Ga0129324_102124423 | 3300010368 | Freshwater To Marine Saline Gradient | MNKKIFAQLLAHSQNDMDRITQPYIQETFGVSVERCETLE |
| Ga0136549_103784552 | 3300010389 | Marine Methane Seep Sediment | MNKKIFSQLLSYSQNDLGKITDPYIQETFGVSVTRCETLE |
| Ga0151677_11457711 | 3300011258 | Marine | MNKKIFARLLGYSQNDLTKITQPWIKETFGVEVERCDTLEQYTD |
| Ga0163110_102007483 | 3300012928 | Surface Seawater | MNNKIFAELINHSQKDISKITLPYIQETFGVEVSRCDSIEKYAEA |
| Ga0163109_109056642 | 3300012936 | Surface Seawater | MNNKIFAELIHHSQKDISKITSPYIQETFGVEVSRCDSIEKYAEAIDNACLHK |
| Ga0163111_102644794 | 3300012954 | Surface Seawater | MNKKIFAKLLGHSQNDLTKITQPFIKETFGVDVKRCDTLEQYAEAI |
| Ga0182078_106183792 | 3300016747 | Salt Marsh | MNKKIFAQLLAYSQNDLDKITQPYVMETFGVVVKRCETLEEYT |
| Ga0180120_103769322 | 3300017697 | Freshwater To Marine Saline Gradient | MNKKIFAQLLAYSQNDLDKITQPYIQETFGVAVKRCETLEE |
| Ga0181383_11305122 | 3300017720 | Seawater | MNKRIFAKLLGHSQNDLTKITQPFIKETFGVDVKRCDTLEQYSEAIDD |
| Ga0181383_11738661 | 3300017720 | Seawater | MNKKIFARLLAHSENNLDKITLPYISETFGVEVNRCETIEQYVEAI |
| Ga0181416_10144833 | 3300017731 | Seawater | MNKKIFAKLLGHSQNDLSKITQPFIKETFGVVVERCDT |
| Ga0181402_11275262 | 3300017743 | Seawater | MNKKIFAQLLAHSQNDLEKITQPYIMETFGVEVKRCETLEQYVEAIDS |
| Ga0181427_11508672 | 3300017745 | Seawater | MNKKIFAQLLTYSQNNLDKITQPYIKQTFGVDVKRCD |
| Ga0181407_11824342 | 3300017753 | Seawater | MNKKIFAKLLTHSENNLDKITQPFILETFGVKVKRCDTI |
| Ga0181409_12262772 | 3300017758 | Seawater | MNKRIFAKLLGHSQNDLTKITQPFIKETFGVDVKRCDTLEQYS |
| Ga0181408_11850352 | 3300017760 | Seawater | MNKKIFAKLLGHSQNDLTKITQPYIKETFGVEVKRCDTLEQYAENI |
| Ga0181422_12276242 | 3300017762 | Seawater | MNKKILSKLILDSKNDLTKISQPYIMETFGVEVDRCDTLEQYVKSIDS |
| Ga0181385_11372571 | 3300017764 | Seawater | MNKKIFARLLAHSENNLDKITLPYISETFGVEVNRCETIEQYVEAID |
| Ga0181406_11558262 | 3300017767 | Seawater | MNKKIFARLLAHSENNLDKITLPYISETFGVEVNRCET |
| Ga0181379_12970402 | 3300017783 | Seawater | MNKKIFAKLLAHSQNNLDKITQPYIQDTFGVEVKRCDTI |
| Ga0181552_102968471 | 3300017824 | Salt Marsh | MNKKIFARLLGHSQNDLRLITDPWIQETFGVSVKRY |
| Ga0181577_108780012 | 3300017951 | Salt Marsh | MNKKIFAKLLGHSQNDLSKITQPFIKETFGVEVKRCDTLEQYAEAID |
| Ga0181580_110178832 | 3300017956 | Salt Marsh | MNKKIFAQLLTHSQNDLAKITDPYIRETFGVTVKR |
| Ga0181582_104468322 | 3300017958 | Salt Marsh | MNKKIFAQLLAHSQNDLDKITQPYIQEMFGVTVKRCNT |
| Ga0181582_107651042 | 3300017958 | Salt Marsh | MNKKIFAKLLAYSENNLDKITQPYIQETFGVEVKRCDTIE |
| Ga0181579_103361032 | 3300018039 | Salt Marsh | MNKKIFAQLLAHSQNDLTKITDPYVRETFGVEVKRCET |
| Ga0181572_105692411 | 3300018049 | Salt Marsh | MNKKIFAQLLAYSQNDLTKVTQPWIKETFGVEVKRCDTLEQYTDAI |
| Ga0181572_106330692 | 3300018049 | Salt Marsh | MNKKIFAQLLAYSQNDLDKITQPYVMETFGVVVKRCETLEEYTQVI |
| Ga0181572_108226372 | 3300018049 | Salt Marsh | MNKKIFSQLLGYSQNDLDKITQPYILETFGVEVKRC |
| Ga0181559_102389573 | 3300018415 | Salt Marsh | MNKKIFARLLGHSQNDLRLITDPWIQETFGVSVKRYDTI |
| Ga0181591_110171752 | 3300018424 | Salt Marsh | MNKKIFAQLLAYSQNDLDKITQPYIQETFGVEVKRCE |
| Ga0181562_105593411 | 3300019459 | Salt Marsh | MNKKIFAQLLAHSQNDLDKITQPYIQETFGVVVKRCETLEEYTRVIDDA |
| Ga0206125_103742872 | 3300020165 | Seawater | MNKKIFAQLLGYSQNDLDKITQPYILETFGVEVDRCDTLEQ |
| Ga0181578_101753553 | 3300020189 | Salt Marsh | MNKKIFAQLLAHSQNDLAKITDPYIQETFGVTVKRC |
| Ga0211634_11247503 | 3300020279 | Marine | MNKKIFAKLLGYSQNNLDKITQPYILETFGVEVKRC |
| Ga0211589_10294501 | 3300020315 | Marine | MNKKIFAKLLGHSQNDLSKITQPFIKETFGVEVNRCDTLEQYSEA |
| Ga0211607_10399533 | 3300020346 | Marine | MNKKIFAKLLGYSQNNLSKITQPWIKETFGVEVKRCDTLEQYSEAIDDACL |
| Ga0211489_102338112 | 3300020366 | Marine | MNKKIFTKLLGYSQNDLTKITQPFIKETFGVEVKRCDSIEEYVNVIDDA |
| Ga0211477_101358351 | 3300020374 | Marine | MNKKIFAKLLRHSQNDISKITLPWIKETFGVEVKRCDTLEQYSEAI |
| Ga0211652_101571272 | 3300020379 | Marine | MNKKIFAELLAYSQNDTNKITQPYIKEKFGVEVDRCDTIEQYEET |
| Ga0211659_101814161 | 3300020404 | Marine | MNKKILGQLLAHSQNDLDKITQPYILETFGVEVKRCDTLEEYS |
| Ga0211523_100579111 | 3300020414 | Marine | MNKKIFARLLAHSENNLEKITQPYILETFGVEVQRCDTIEQYVDAIDDAC |
| Ga0211523_102660011 | 3300020414 | Marine | MNKKIFAKLLAYSENNLDKITQPYIQETFGVSVERCDTIEQY |
| Ga0211644_100370291 | 3300020416 | Marine | MNKKIFEKLSQDTNQDPSKVTAPYIKETFGVDVPRCETLEQ |
| Ga0211528_102638631 | 3300020417 | Marine | MNKKIFAKLLAYSQNDLTKITQPYIKETFGVEVNRCETLEKY |
| Ga0211708_101678061 | 3300020436 | Marine | MNKKIFAKLLGHSQNDLTKITQPFIKETFGVDVKRCDTLEQYVEAI |
| Ga0211708_104275091 | 3300020436 | Marine | MNRKVFAELLSYSKNDITKITQPYIKEKFGVDVKRCDS |
| Ga0211559_100571424 | 3300020442 | Marine | MNKKIFAKLLAHSQNDLSKITQPYIKETFGVEVKRC |
| Ga0211559_102052671 | 3300020442 | Marine | MNNKIFAELINHSQKDISKITLPYIQETFGVEVSRCDSIEKYA |
| Ga0211535_101955013 | 3300020461 | Marine | MNKKIFAKLLGHSQNDLSKITQPFIKETFGVEVNRCDTL |
| Ga0211676_103027853 | 3300020463 | Marine | MNNKIFAELVKHSHNDVSKITLPYIKEKFGVEVKRCDTIEQYADTIDDACL |
| Ga0211676_104057452 | 3300020463 | Marine | MNKKIFAKLLGHSQNDLTKITQPWIKETFGVDVKRCD |
| Ga0211676_106374591 | 3300020463 | Marine | MNKKIFARLLGQSQNDLGEITQPWIKETFGVEVKR |
| Ga0211713_102625343 | 3300020467 | Marine | MNKKIFAKLLQHSQNDLSKITQPFIKETFGVDVKRCDTLEQYTDAIDDASL |
| Ga0211577_106509371 | 3300020469 | Marine | MNKKIFARLLAHSENNLDKITLPYISETFGVEVNRCETIEQYVE |
| Ga0211543_105166822 | 3300020470 | Marine | MNKKIFAKLLGHSQNDLSKITQPFIKETFGVEVKRCD |
| Ga0206123_101498861 | 3300021365 | Seawater | MNKKIFARLLAHSQNDLSKITQPYILDTFGVEVKRCDTLEQYSKAIDDA |
| Ga0222715_104274751 | 3300021960 | Estuarine Water | MNKKIFAKLLAYSENNLGKITQPYIQETFGVEVKRCDTIEQY |
| Ga0196905_11450601 | 3300022198 | Aqueous | MNKKIFAQLLAYSQNDLDKITQPYIQETFGVEVKRCETLEEYTQ |
| Ga0255769_100876874 | 3300022927 | Salt Marsh | MNKKIFSQLLAYSQNDLTKISQPYIMETFGVEVERCESL |
| (restricted) Ga0233433_100985423 | 3300022931 | Seawater | MNKKIFAQLLAHSQNDLEKITQPYIMETFGVEVKRCDT |
| Ga0255778_103140891 | 3300023084 | Salt Marsh | MNKKIFAQLLAHSQNDLAKITDPYIQETFGVTVKRCETLEEY |
| Ga0255777_102750223 | 3300023175 | Salt Marsh | MNKKIFARLLTHSENNLDKITQPWIMETFGVEVARCDTIEQYVE |
| Ga0222661_10438141 | 3300023229 | Saline Water | MNKKIFAQLLGHSQNDLDKVTHPYILETFGVEVDRCDTLEQYA |
| Ga0222670_10566731 | 3300023294 | Saline Water | MNKKIFAQLLGHSQNDIDKITQPYILETFGVEVDRRDTLEQ |
| Ga0209535_11315472 | 3300025120 | Marine | MNKKILSKLILDSKNDLTKISQPYIMETFGVEVDRCDTLEQYVKSIDSACL |
| Ga0209645_12009112 | 3300025151 | Marine | MNKKIFARLLAHSENDLDKITQPYILETFGVEVKRCETIEQY |
| Ga0208903_10754101 | 3300025502 | Saline Lake | MNKKIFAELLAYSQNDLDKITQPYILETFGVNVDRCDTLEQYAEAIDV |
| Ga0209195_11390461 | 3300025590 | Pelagic Marine | MNKKIFARLLAHSQNDLSKITQPYILDTFGVEVKRC |
| Ga0208767_10431844 | 3300025769 | Aqueous | MNKKIFAQLLAHSQNDLTKITQPYILETFGVEVKRCDTIEQYVEA |
| Ga0209199_12562551 | 3300025809 | Pelagic Marine | MNKKIFAQLLGHSQNDLNKITQPYIMETFGVEVDR |
| Ga0209223_100793494 | 3300025876 | Pelagic Marine | MNKKILSKLILDSKNDLTKISQPYIMETFGVEVDRCDTLEQYVK |
| Ga0208275_10734892 | 3300026182 | Marine | MNKRIFAELLTHSENNLEKITQPYIKEKFDVDIKRYDTL |
| Ga0209710_10975213 | 3300027687 | Marine | MNKKIFAQLLGYSQNDLNKITQPYILETFGVKVDRCDTL |
| Ga0209192_100820901 | 3300027752 | Marine | MNKKIFAQLLGHSQNDLDKVTQPYIQETFGVEVARCDTLEQY |
| Ga0209709_102466861 | 3300027779 | Marine | MNKRIFAELLTHSQNNLDKISQLYIKEKFGVEVDRCDTLEQY |
| Ga0209711_102866872 | 3300027788 | Marine | MNKKIFAQLLGHSQNDLDKITQPYILETFGVEVKRCDTLEQYAEAIDVAC |
| Ga0209402_103645662 | 3300027847 | Marine | MNKKIFAELLVHSQNEIEKITQPYVLETFGVEVDRCDTLEQYVE |
| Ga0183748_10196434 | 3300029319 | Marine | MNKKIFTKLLGYSQNDLTKITQPFIKETFGVEVKRCDSI |
| Ga0302119_102421002 | 3300031606 | Marine | MNKRIFAELLTHSQNNLDKISQLYIKEKFGVEVDRCDTLE |
| Ga0302123_101331021 | 3300031623 | Marine | MNKKIFAQLLGYSQNDLDKVTQPYILETFGVEVARCDTLEQYVEAIDVACL |
| Ga0310345_107570123 | 3300032278 | Seawater | MNKRIFAELLTHSQNNLDKISQLYIKEKFGVEVKRCNTLEEY |
| ⦗Top⦘ |