| Basic Information | |
|---|---|
| Family ID | F085854 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 42 residues |
| Representative Sequence | TGVSYSDHYEEKGVFERLMDRLRRIAPRAQGYAPVMVPALR |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.56 % |
| % of genes near scaffold ends (potentially truncated) | 78.38 % |
| % of genes from short scaffolds (< 2000 bps) | 86.49 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.586 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.315 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.423 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.045 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.68% β-sheet: 0.00% Coil/Unstructured: 62.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13701 | DDE_Tnp_1_4 | 8.11 |
| PF01609 | DDE_Tnp_1 | 2.70 |
| PF08388 | GIIM | 2.70 |
| PF00106 | adh_short | 1.80 |
| PF14690 | zf-ISL3 | 1.80 |
| PF13495 | Phage_int_SAM_4 | 0.90 |
| PF13503 | DUF4123 | 0.90 |
| PF01433 | Peptidase_M1 | 0.90 |
| PF01663 | Phosphodiest | 0.90 |
| PF02687 | FtsX | 0.90 |
| PF12704 | MacB_PCD | 0.90 |
| PF12762 | DDE_Tnp_IS1595 | 0.90 |
| PF01610 | DDE_Tnp_ISL3 | 0.90 |
| PF06723 | MreB_Mbl | 0.90 |
| PF13751 | DDE_Tnp_1_6 | 0.90 |
| PF00158 | Sigma54_activat | 0.90 |
| PF04909 | Amidohydro_2 | 0.90 |
| PF13546 | DDE_5 | 0.90 |
| PF10503 | Esterase_PHB | 0.90 |
| PF10049 | DUF2283 | 0.90 |
| PF01807 | zf-CHC2 | 0.90 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.90 |
| PF05227 | CHASE3 | 0.90 |
| PF02195 | ParBc | 0.90 |
| PF04986 | Y2_Tnp | 0.90 |
| PF03544 | TonB_C | 0.90 |
| PF13620 | CarboxypepD_reg | 0.90 |
| PF14294 | DUF4372 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 2.70 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 2.70 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 2.70 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 2.70 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 2.70 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 2.70 |
| COG0308 | Aminopeptidase N, contains DUF3458 domain | Amino acid transport and metabolism [E] | 0.90 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.90 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.90 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.59 % |
| Unclassified | root | N/A | 14.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090004|P1_DRAFT_NODE_193764_len_1922_cov_11_606139 | All Organisms → cellular organisms → Bacteria | 1972 | Open in IMG/M |
| 2124908036|A5_v_NODE_38348_len_2383_cov_11_830046 | All Organisms → cellular organisms → Bacteria | 2433 | Open in IMG/M |
| 3300002549|JGI24130J36418_10084954 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300005530|Ga0070679_100094568 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300005538|Ga0070731_10896443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 588 | Open in IMG/M |
| 3300005559|Ga0066700_11013465 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300005576|Ga0066708_11031190 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300005938|Ga0066795_10001038 | All Organisms → cellular organisms → Bacteria | 6080 | Open in IMG/M |
| 3300005938|Ga0066795_10022844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1788 | Open in IMG/M |
| 3300005947|Ga0066794_10159630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 678 | Open in IMG/M |
| 3300005994|Ga0066789_10298687 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300006055|Ga0097691_1196529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 520 | Open in IMG/M |
| 3300006224|Ga0079037_101952502 | Not Available | 586 | Open in IMG/M |
| 3300006640|Ga0075527_10257840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 511 | Open in IMG/M |
| 3300006642|Ga0075521_10595870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 544 | Open in IMG/M |
| 3300006797|Ga0066659_10616898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300009012|Ga0066710_103877226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 561 | Open in IMG/M |
| 3300009029|Ga0066793_10181248 | Not Available | 1228 | Open in IMG/M |
| 3300009029|Ga0066793_10421654 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009029|Ga0066793_10654197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 598 | Open in IMG/M |
| 3300009053|Ga0105095_10867043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 506 | Open in IMG/M |
| 3300009088|Ga0099830_11071886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 668 | Open in IMG/M |
| 3300009088|Ga0099830_11622032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 539 | Open in IMG/M |
| 3300009090|Ga0099827_11583069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 571 | Open in IMG/M |
| 3300009645|Ga0116106_1196122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 643 | Open in IMG/M |
| 3300009645|Ga0116106_1299691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 512 | Open in IMG/M |
| 3300010048|Ga0126373_10602096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1151 | Open in IMG/M |
| 3300010048|Ga0126373_11531295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 732 | Open in IMG/M |
| 3300010048|Ga0126373_11616398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 713 | Open in IMG/M |
| 3300010322|Ga0134084_10170698 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010358|Ga0126370_11908261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300010361|Ga0126378_13275986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300010366|Ga0126379_13466530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 528 | Open in IMG/M |
| 3300010379|Ga0136449_103590975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 589 | Open in IMG/M |
| 3300010379|Ga0136449_103874228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 561 | Open in IMG/M |
| 3300010391|Ga0136847_10959011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7188 | Open in IMG/M |
| 3300010880|Ga0126350_11180590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 526 | Open in IMG/M |
| 3300012199|Ga0137383_11166250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 555 | Open in IMG/M |
| 3300012203|Ga0137399_11616757 | Not Available | 536 | Open in IMG/M |
| 3300012209|Ga0137379_10374311 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300012209|Ga0137379_11803592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 506 | Open in IMG/M |
| 3300012349|Ga0137387_11239810 | Not Available | 525 | Open in IMG/M |
| 3300012357|Ga0137384_10899367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300012361|Ga0137360_10605173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 938 | Open in IMG/M |
| 3300012361|Ga0137360_10837291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 792 | Open in IMG/M |
| 3300012363|Ga0137390_10850666 | Not Available | 868 | Open in IMG/M |
| 3300012923|Ga0137359_10159844 | All Organisms → cellular organisms → Bacteria | 2010 | Open in IMG/M |
| 3300012923|Ga0137359_11047511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 699 | Open in IMG/M |
| 3300012931|Ga0153915_11835688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 709 | Open in IMG/M |
| 3300013092|Ga0163199_1325621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 577 | Open in IMG/M |
| 3300013104|Ga0157370_11974404 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300014153|Ga0181527_1407898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 519 | Open in IMG/M |
| 3300014155|Ga0181524_10404891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 595 | Open in IMG/M |
| 3300014164|Ga0181532_10607440 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300014166|Ga0134079_10606168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 545 | Open in IMG/M |
| 3300014200|Ga0181526_10488355 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300014491|Ga0182014_10345717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 752 | Open in IMG/M |
| 3300014494|Ga0182017_10742248 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300014501|Ga0182024_11289950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300014502|Ga0182021_13105091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 555 | Open in IMG/M |
| 3300014502|Ga0182021_13167755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 550 | Open in IMG/M |
| 3300014839|Ga0182027_12347978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 503 | Open in IMG/M |
| 3300015051|Ga0137414_1239474 | Not Available | 4545 | Open in IMG/M |
| 3300015075|Ga0167636_1028430 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300015206|Ga0167644_1122803 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300015264|Ga0137403_11125505 | Not Available | 631 | Open in IMG/M |
| 3300016294|Ga0182041_10315246 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
| 3300016294|Ga0182041_11387242 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300016341|Ga0182035_10525722 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300017823|Ga0187818_10033057 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
| 3300018003|Ga0187876_1237380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 598 | Open in IMG/M |
| 3300018033|Ga0187867_10798917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 512 | Open in IMG/M |
| 3300018034|Ga0187863_10613517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 612 | Open in IMG/M |
| 3300018047|Ga0187859_10750687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 557 | Open in IMG/M |
| 3300019788|Ga0182028_1555847 | Not Available | 2323 | Open in IMG/M |
| 3300020221|Ga0194127_10125192 | All Organisms → cellular organisms → Bacteria | 1875 | Open in IMG/M |
| 3300021090|Ga0210377_10278732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300021861|Ga0213853_10559532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 518 | Open in IMG/M |
| 3300025912|Ga0207707_11656240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 502 | Open in IMG/M |
| 3300026108|Ga0208391_1030736 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300026294|Ga0209839_10007342 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 4852 | Open in IMG/M |
| 3300026296|Ga0209235_1255569 | Not Available | 540 | Open in IMG/M |
| 3300026552|Ga0209577_10700860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 573 | Open in IMG/M |
| 3300026557|Ga0179587_10487631 | Not Available | 808 | Open in IMG/M |
| 3300028560|Ga0302144_10018700 | Not Available | 2242 | Open in IMG/M |
| 3300028800|Ga0265338_11144144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 523 | Open in IMG/M |
| 3300028867|Ga0302146_10374331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 545 | Open in IMG/M |
| 3300029939|Ga0311328_10588728 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300029957|Ga0265324_10232020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300030049|Ga0302191_10146639 | Not Available | 913 | Open in IMG/M |
| 3300030508|Ga0302185_10248725 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300030580|Ga0311355_10658002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 980 | Open in IMG/M |
| 3300030620|Ga0302046_10271040 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300031234|Ga0302325_11887467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 743 | Open in IMG/M |
| 3300031236|Ga0302324_102527741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 626 | Open in IMG/M |
| 3300031250|Ga0265331_10430095 | Not Available | 593 | Open in IMG/M |
| 3300031524|Ga0302320_11522772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300031525|Ga0302326_11132438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1084 | Open in IMG/M |
| 3300031833|Ga0310917_10801534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 636 | Open in IMG/M |
| 3300031942|Ga0310916_11165496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 638 | Open in IMG/M |
| 3300031942|Ga0310916_11457304 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300032069|Ga0315282_10542800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 646 | Open in IMG/M |
| 3300032118|Ga0315277_10040459 | All Organisms → cellular organisms → Bacteria | 5489 | Open in IMG/M |
| 3300032515|Ga0348332_14724177 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300033482|Ga0316627_102677785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300033818|Ga0334804_001532 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13355 | Open in IMG/M |
| 3300033824|Ga0334840_039140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1451 | Open in IMG/M |
| 3300034124|Ga0370483_0356747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.41% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.41% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.50% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 4.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.60% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 2.70% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.70% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.80% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.90% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.90% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.90% |
| Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.90% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.90% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.90% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2124908036 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
| 3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015206 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026108 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Host-Associated | Open in IMG/M |
| 3300030049 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_1 | Environmental | Open in IMG/M |
| 3300030508 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
| 3300033824 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_DRAFT_00570850 | 2088090004 | Soil | XSYSDHYEEKGVFERLMDRLRKIAPRGAGYAPVMLPALR |
| A5_v_00034680 | 2124908036 | Soil | VSYSDHYEEKGVFERLLDRLRKIAPRGAGYAPVMLPALR |
| JGI24130J36418_100849541 | 3300002549 | Arctic Peat Soil | VSYSDHYEEKGVFERLMDRLRKIAPRGAGYAPVMLPALR* |
| Ga0070679_1000945683 | 3300005530 | Corn Rhizosphere | VSYSDHDEEKGVFERLMDRLRRIASNAGGYAPVMVPALR* |
| Ga0070731_108964432 | 3300005538 | Surface Soil | RAGRTGVSYGDHYEEKGVFQRLMDRLRKIVPRRSGYAPVMLPALR* |
| Ga0066700_110134651 | 3300005559 | Soil | VSYSDQYEEKGMFDRLMDRLRRIVPRGQGYAPVMVPALR* |
| Ga0066708_110311901 | 3300005576 | Soil | IWRHAGRTGVSYSDHYAEKTTFQRLMTRLRNIAPRPSGFIPVIVAALR* |
| Ga0066795_100010381 | 3300005938 | Soil | YSDQYEEKGVFERLMDRLRRIAPRGQGYAPVMLPILR* |
| Ga0066795_100228443 | 3300005938 | Soil | GRTGVSYSDHYEEKGVFERLMDRLRRIAPRGQGYAPVMLPALC* |
| Ga0066794_101596301 | 3300005947 | Soil | GRTGVSYSDHYEEKGVFQRLMDRLRRIVPRGSGYAPVLQPALR* |
| Ga0066789_102986871 | 3300005994 | Soil | GRTGVSYSDHYEEKGVFERLMNRLRRIVPCGQGYAPVMYPALR* |
| Ga0097691_11965292 | 3300006055 | Arctic Peat Soil | TGVSYSDHYEEKGVFRRLMDRLRKIVLRGSDYAPVMLPALR* |
| Ga0079037_1019525022 | 3300006224 | Freshwater Wetlands | VSYSDHYEEKGMFERLMDRLRRIVPRGQSYAPVMLPALR* |
| Ga0075527_102578402 | 3300006640 | Arctic Peat Soil | GVSYSDQYEEKGVFQRLMDRLRRIAPRGQGYAPVMVPALR* |
| Ga0075521_105958702 | 3300006642 | Arctic Peat Soil | GRTGVSYSDSYEEKGVFERLMDRLRRIAPRGQGYAPVMQPALR* |
| Ga0066659_106168982 | 3300006797 | Soil | VFVATKNWRHEVRTGVSYSDHYEEKGVFERLMDRLRRIASRAGGYAPVMLPALR* |
| Ga0066710_1038772261 | 3300009012 | Grasslands Soil | AGRTGVSYSDHYEEKGVFSRLMDRLRRIAPRAQGYAPVMVPALR |
| Ga0066793_101812481 | 3300009029 | Prmafrost Soil | SYSDHYEEKGVFERLMDRLRRIAPRGQGYAPVMLPALC* |
| Ga0066793_104216541 | 3300009029 | Prmafrost Soil | GVSYSDHYQEKGVFERLMIRLRKIATRAQGYAPVMLPALR* |
| Ga0066793_106541971 | 3300009029 | Prmafrost Soil | IWRHAGRTGVSYSDHYEEKGMFERLMDRLRKIAPRGAGYAPVMLPALR* |
| Ga0105095_108670431 | 3300009053 | Freshwater Sediment | SYSDHYEEKGVFERLMDRLRRIAPRGEGYAPVMLPALR* |
| Ga0099830_110718862 | 3300009088 | Vadose Zone Soil | GVSYSDHYEEKGVFERLMVRLRKIASHAQGYAPVMLPALR* |
| Ga0099830_116220321 | 3300009088 | Vadose Zone Soil | RTGVSYSDHYEEKGVFERLMDRLRRIVPRGQGYAAVMLPALR* |
| Ga0099827_115830691 | 3300009090 | Vadose Zone Soil | GRTGVSYSDHYEEKGVFERLMHRLRRIVPCGQGYAPVMQPALR* |
| Ga0116106_11961222 | 3300009645 | Peatland | AGRTGVSYSDHYEEKGVFRRLMDRLRKIVVRGSDYAPVMLPALR* |
| Ga0116106_12996911 | 3300009645 | Peatland | TGVSYSEHYEEKGVFERLMSRLRDIALKAQGYAPVMTPALR* |
| Ga0126373_106020961 | 3300010048 | Tropical Forest Soil | SDHYEEKDVFERLMDRLRRIASRAEGYAPVMFPALR* |
| Ga0126373_115312951 | 3300010048 | Tropical Forest Soil | WRHAGRTGVSYSDHYEEKGVLQRLMDRLRRITPRGGGYAPVLVPALR* |
| Ga0126373_116163983 | 3300010048 | Tropical Forest Soil | WRHAGRTGVSYSDHYEEKGVLQRLMDRLRRITPRGGGYAPVMVPALR* |
| Ga0134084_101706982 | 3300010322 | Grasslands Soil | GVSYSDHYEEKGMFERLMDRLRRIAPRGPGFAPVMVPALR* |
| Ga0126370_119082611 | 3300010358 | Tropical Forest Soil | AGRTGVSYSDHYEEKGMFERLIDRLRRIVPRGEGYVPVVVPALR* |
| Ga0126378_132759862 | 3300010361 | Tropical Forest Soil | AGRTGVSYSDHYEEKGVLQRLMDRLRRITPRGGGYAPVLVPALR* |
| Ga0126379_134665302 | 3300010366 | Tropical Forest Soil | VSYSDHYEEKGVFERLMERLRRIAARGQGYAPVLVPALR* |
| Ga0136449_1035909752 | 3300010379 | Peatlands Soil | GRTGVSYSDHYEEKGVFERLMDRLRRIVPRAQGYAPVMVPALR* |
| Ga0136449_1038742282 | 3300010379 | Peatlands Soil | AGRTGVSYSDHYEEKGVFQRLMDRLRKIVPRGSGYAPIMLPALR* |
| Ga0136847_109590112 | 3300010391 | Freshwater Sediment | MRGEPESSYSDQYQEKGLFQRLMDRLRRIAPRGGGYAPMMTPAVR* |
| Ga0126350_111805901 | 3300010880 | Boreal Forest Soil | GRTGVSYSDHYEEKGVFERLMVRLRKIAPRAGGYAPVMLPALR* |
| Ga0137383_111662502 | 3300012199 | Vadose Zone Soil | GVSYSDHYEEKGVFEQLMDRLRRIAPRGAGYAPVMLPALR* |
| Ga0137399_116167572 | 3300012203 | Vadose Zone Soil | SYSDHYEEKGVFERLMNRLRRIVPCGQGYAPVMQPALR* |
| Ga0137379_103743112 | 3300012209 | Vadose Zone Soil | VSYSDHYEEKGLFERLMNRLRSIVPRGPGYAPVMQPALK* |
| Ga0137379_118035921 | 3300012209 | Vadose Zone Soil | RHAGRTGVSYSDHYEEKGVFERLMDRLRRIAPRGRGYAPVMVPALC* |
| Ga0137387_112398102 | 3300012349 | Vadose Zone Soil | VSYSDHYEEQGAFTRLMMRLRAILPRGESYRPVLEAVLG* |
| Ga0137384_108993673 | 3300012357 | Vadose Zone Soil | YSDHYEEKGMFERLMDRLRRIAPRAQGYAPVMVPALR* |
| Ga0137360_106051732 | 3300012361 | Vadose Zone Soil | SYSDHYEEKGMFERLMDRLRRIAPRAQGYAPVMVPALR* |
| Ga0137360_108372911 | 3300012361 | Vadose Zone Soil | RTGVSYSDHYEEKGLFERLMYRLRRIAPRGSGFAPVMVPALR* |
| Ga0137390_108506662 | 3300012363 | Vadose Zone Soil | VSYSDHYEEKGVFERLMDRLRRIALCTQGYVPVMVPALR* |
| Ga0137359_101598442 | 3300012923 | Vadose Zone Soil | VSYSDHYEEKGVFERLMDRLRRIAPRAGGYAPVMLPALR* |
| Ga0137359_110475111 | 3300012923 | Vadose Zone Soil | IWRHAGRTGVSYGDHYEEKGVFQRLMNRLRKIVPRGSGYAPVMVPALR* |
| Ga0153915_118356881 | 3300012931 | Freshwater Wetlands | GVSYSDHYQEKGMFERLMDRLRRIAPNAQGYAPVMVPALR* |
| Ga0163199_13256212 | 3300013092 | Freshwater | TGVSYSDHYEEKGVFERLMDRLRRIAPRAQGYAPVMVPALR* |
| Ga0157370_119744041 | 3300013104 | Corn Rhizosphere | HYEEKGVFERLMDRLRQIAPRANGYAPVMVPALR* |
| Ga0181527_14078981 | 3300014153 | Bog | HAGRTGVSYSDHYEEKGMFERLMDRLRRIAPRAQGYGPVMLPALR* |
| Ga0181524_104048911 | 3300014155 | Bog | HYEEKGVFERLMDRLRRIASRAQGYAPVMLPALR* |
| Ga0181532_106074402 | 3300014164 | Bog | VSYSDSYEEKGMFERLMDRLRKIVPSGSGYAPVMQPALR* |
| Ga0134079_106061681 | 3300014166 | Grasslands Soil | HAGRTGVSYSDHYEEKGVFERLMNRLRQIAPRVGGYAPVMLPALR* |
| Ga0181526_104883552 | 3300014200 | Bog | VSYSDSYEEKGVFERLMDRLRKIVPSGSGYAPVMQPALC* |
| Ga0182014_103457172 | 3300014491 | Bog | GRTGVSYSDHYEEQGVFQRLMDRLRRVAPRGEGYAPVMVPALR* |
| Ga0182017_107422481 | 3300014494 | Fen | GRTGVSYSDHYEEKGVFERLMDRLRRIAPRAQGYGPVMLPALR* |
| Ga0182024_112899501 | 3300014501 | Permafrost | SYSDHYEEKGVFERLMDRLRRIAPRGPGFAPVMAPALR* |
| Ga0182021_131050911 | 3300014502 | Fen | HAGRTGVSYSDHYEEQGVFQRLMDRLRRIAPRGQDYAPVLLPALR* |
| Ga0182021_131677552 | 3300014502 | Fen | SYSDHYEEKGMFERLMDRLRRIAPRAQGYGPVMLPALR* |
| Ga0182030_116960232 | 3300014838 | Bog | KVWRHAGRTGVSYSDHYEERGLFQRRMDRLRAITARGPGFAPVLAAAFT* |
| Ga0182027_123479782 | 3300014839 | Fen | AGRTGVSYSDHYEEKGVFRRLLDRLRKIVLRGSDYAPVMLPALR* |
| Ga0137414_12394746 | 3300015051 | Vadose Zone Soil | VSFGDHYEEKGVFNRLMDRLRRIAGSGQCYAPVMTPALR* |
| Ga0167636_10284302 | 3300015075 | Glacier Forefield Soils | VSYSDHYEEKGVIERLMDRLRKIAPRAGGYPPVMLPALR* |
| Ga0167644_11228031 | 3300015206 | Glacier Forefield Soil | AGRTGVSYSDHYEEKGLFERLMNRLRQIASRAQGYAPVMMPALR* |
| Ga0137403_111255051 | 3300015264 | Vadose Zone Soil | SYGDHYQEKDVFNRLMDRLRRIALSGQGYAPVMTPALC* |
| Ga0182041_103152463 | 3300016294 | Soil | FVAAEIWRHAGRTGVSYSDHYEEKGMLERLMDRLRRITPRGRGYAPVMVPALR |
| Ga0182041_113872421 | 3300016294 | Soil | VSYSDHYEEKGVLQRLMDRLRRITPRGGGYAPVMVPALR |
| Ga0182035_105257222 | 3300016341 | Soil | GRTGVSYSDHYEEKGMLERLMDRLRRITPRGRGYAPVMVPALR |
| Ga0187818_100330571 | 3300017823 | Freshwater Sediment | VSYSDHYEEKGVFERLMDRLRKIVPRGSSYAPVMLPALC |
| Ga0187876_12373801 | 3300018003 | Peatland | RHAGRTGVSYSDHYEEKGVFERLMDRLRRIAPRGQGYAPVMVPALR |
| Ga0187867_107989172 | 3300018033 | Peatland | RTGVSYSDHYQEQGVFERLMDRLRKIAPRAQGYEPVMVPALR |
| Ga0187863_106135171 | 3300018034 | Peatland | IWRHAGRTGVSYSDHYEEKGVFQRLMDRLRKIVPRGSGYAPVMVPALR |
| Ga0187851_106876972 | 3300018046 | Peatland | FLFVAARIWRHAGRTGVSYSDHYAEKGVFERLMDRLRRIAPRGESYAPVMVPALR |
| Ga0187859_107506872 | 3300018047 | Peatland | SYSDHYEEQGVFQRLMDRLRRVASRADGYAPVMVPSLR |
| Ga0187784_114681802 | 3300018062 | Tropical Peatland | AKLWRHAGRSGVSYADHYAEAGLLQRLMDRLRAVRLPGPGFAPVVEGVLQ |
| Ga0182028_15558474 | 3300019788 | Fen | VSYSDHYEEKGVFERLMDRLRRIAPRAQGYAPVMLPALR |
| Ga0194127_101251922 | 3300020221 | Freshwater Lake | PHAGRTGVSYSDHYEEKGVFERLMNRLRKIVPRAQGYAPVMVPALR |
| Ga0210377_102787323 | 3300021090 | Groundwater Sediment | SYSDHYEEKGVFERLMHRLRRIAPCGQGYAPVMQPALR |
| Ga0213853_105595321 | 3300021861 | Watersheds | HAGRTGVSYIDQYEEKGVFERLMDRLRRITPRGQGYAPVMVPVLR |
| Ga0207707_116562401 | 3300025912 | Corn Rhizosphere | YSDHYEEKGVFERLMDRLRQIALRANGYAPVMVPALR |
| Ga0208391_10307362 | 3300026108 | Marine | SYSDHYQGKGLFERLMRRLRAMAPPGTSFAPVVEGALR |
| Ga0209839_100073421 | 3300026294 | Soil | IWRHAGRTGVSYSDQYQEQGVFERLMTRLRRIAPRAQGYAPVMVPALC |
| Ga0209235_12555691 | 3300026296 | Grasslands Soil | GVSYSDHYEEKGVFERLMVRLRKMTSHGQGYAPVMLPALR |
| Ga0209577_107008602 | 3300026552 | Soil | GRTGVSYSDQYEEKGMFDRLMDRLRRIAPRGQGYVPVMVPALC |
| Ga0179587_104876311 | 3300026557 | Vadose Zone Soil | VSYSDHYEEKSVFERLMDRLRKIAPRAGGYAPVMLPALR |
| Ga0302144_100187003 | 3300028560 | Bog | VSYSDHYEEKGLFERLMNRLRKIAPCAQGYAPVMVPALR |
| Ga0265338_111441442 | 3300028800 | Rhizosphere | GRTGVSYSDHYEEKGVFERLLDRLRKIAPRAGGYAPVMLPALR |
| Ga0302146_103743312 | 3300028867 | Bog | IWRHAGRTGVSYSDHYEEKGVFERLMNRLRNIAPRAQGYAPVMVPALR |
| Ga0311328_105887282 | 3300029939 | Bog | LRFLFVAAKIWHHAGRTGVHYSDHYEEKGVFERLMTRLRNIMPGAQGYRPVMTPALC |
| Ga0265324_102320201 | 3300029957 | Rhizosphere | YGDHYEEKGVFRLLMDRLRRIAPGRYAPVMVPALC |
| Ga0302191_101466392 | 3300030049 | Bog | SDHYEEKGTLDRLMTRLRSIMPGDQGYAPVMVPALR |
| Ga0302185_102487251 | 3300030508 | Bog | KIRRHAGRTGVHYSDHYEEKGTLDRLMTRLRSIMPGDQGYAPVMVPALR |
| Ga0311355_106580021 | 3300030580 | Palsa | ISYSDHYEEKGVFERLMNRLRKIEARGSGYAPVMLPALC |
| Ga0302046_102710402 | 3300030620 | Soil | VSYSDHYQEQGKFERLMDRLRRIVPRGAGYAAVMQPALR |
| Ga0302325_118874671 | 3300031234 | Palsa | DHYEEKGVFERLMNRLRKIEARGSGYAPVMLPALC |
| Ga0302324_1025277412 | 3300031236 | Palsa | IWRHAGRTGVSYSDSYEEKGMLGRLMNRLRGIVPCGQGYAPVMQPALR |
| Ga0265331_104300952 | 3300031250 | Rhizosphere | LPSAEDHYADKGVFERLMDRLRRIGPGYAPVMQPALC |
| Ga0302320_115227722 | 3300031524 | Bog | IWRRAGRTGVSYSDHYEEKGVLERLMDRLRRIAPRAQGYAPVMLPALRCMDPPPGLPRCA |
| Ga0302326_111324381 | 3300031525 | Palsa | IWRHAGRTSISYSDHYQEKGVFERLMNRLRKIEPRGSGYAPVMLPALC |
| Ga0310917_108015342 | 3300031833 | Soil | SDHYEEKGVFERLMDRLRRIKPRGQGYAPVMVPALR |
| Ga0310916_111654961 | 3300031942 | Soil | LSYSDHYEEKGIFERLMDRLRRIASRREGYAPVMVPALR |
| Ga0310916_114573041 | 3300031942 | Soil | VSYSDHYEEKGMLERLMDRLRWIKPRGQGYAPVMVPALR |
| Ga0315282_105428001 | 3300032069 | Sediment | IWRHAGRTGISYSDHYEERGVFERLMDRLRRIAPRAQGYAPVMVPALR |
| Ga0315277_100404591 | 3300032118 | Sediment | VSYSDHYEEQGLFQRLMDRLRRIVPGGSGYAPVLQPALR |
| Ga0348332_147241772 | 3300032515 | Plant Litter | IWRHAGRTGISYSDHYEEKGTFERLMNRLRKIEPRESGYVPVMIPALR |
| Ga0316627_1026777852 | 3300033482 | Soil | DHDEEKGVFERLMDRLRRIVPRGQSYAPVMLPALR |
| Ga0334804_001532_3277_3396 | 3300033818 | Soil | VSYSDHYEEKGVFERLMERLRRIAPRAQGYAAVMVPALR |
| Ga0334840_039140_3_140 | 3300033824 | Soil | IWHHAGRTGVHYSDHYEEKGVFERLMTRLRNIMPGAQGYSRLRKK |
| Ga0370483_0356747_340_507 | 3300034124 | Untreated Peat Soil | FLFVAATIWRHAGRTGVSYSDHYEEKGVFERLLDRLRKIEPRGAGYAPVMLPALR |
| ⦗Top⦘ |