| Basic Information | |
|---|---|
| Family ID | F085803 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PNNIKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNII |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.20 % |
| % of genes from short scaffolds (< 2000 bps) | 96.40 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.171 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (20.721 % of family members) |
| Environment Ontology (ENVO) | Unclassified (69.369 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.892 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF01523 | PmbA_TldD | 4.50 |
| PF13450 | NAD_binding_8 | 3.60 |
| PF08501 | Shikimate_dh_N | 0.90 |
| PF13231 | PMT_2 | 0.90 |
| PF01370 | Epimerase | 0.90 |
| PF00679 | EFG_C | 0.90 |
| PF05099 | TerB | 0.90 |
| PF02085 | Cytochrom_CIII | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 4.50 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 0.90 |
| COG3793 | Tellurite resistance protein TerB | Inorganic ion transport and metabolism [P] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.17 % |
| All Organisms | root | All Organisms | 28.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001834|ACM2_1054002 | Not Available | 685 | Open in IMG/M |
| 3300001954|GOS2235_1012986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 501 | Open in IMG/M |
| 3300001972|GOS2216_10101457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1447 | Open in IMG/M |
| 3300002040|GOScombined01_103075784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1632 | Open in IMG/M |
| 3300002040|GOScombined01_105463154 | Not Available | 887 | Open in IMG/M |
| 3300005398|Ga0066858_10118519 | Not Available | 770 | Open in IMG/M |
| 3300005401|Ga0066857_10060011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1361 | Open in IMG/M |
| 3300005404|Ga0066856_10321371 | Not Available | 665 | Open in IMG/M |
| 3300005432|Ga0066845_10262175 | Not Available | 667 | Open in IMG/M |
| 3300005432|Ga0066845_10263511 | Not Available | 665 | Open in IMG/M |
| 3300005523|Ga0066865_10239770 | Not Available | 682 | Open in IMG/M |
| 3300005523|Ga0066865_10250257 | Not Available | 668 | Open in IMG/M |
| 3300005606|Ga0066835_10182234 | Not Available | 704 | Open in IMG/M |
| 3300005934|Ga0066377_10054493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1149 | Open in IMG/M |
| 3300005934|Ga0066377_10144449 | Not Available | 722 | Open in IMG/M |
| 3300005934|Ga0066377_10239899 | Not Available | 559 | Open in IMG/M |
| 3300005971|Ga0066370_10228225 | Not Available | 656 | Open in IMG/M |
| 3300005971|Ga0066370_10231317 | Not Available | 651 | Open in IMG/M |
| 3300005971|Ga0066370_10243737 | Not Available | 635 | Open in IMG/M |
| 3300006024|Ga0066371_10299127 | Not Available | 505 | Open in IMG/M |
| 3300006337|Ga0068495_1197251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3064 | Open in IMG/M |
| 3300006345|Ga0099693_1460393 | Not Available | 553 | Open in IMG/M |
| 3300006350|Ga0099954_1559381 | Not Available | 819 | Open in IMG/M |
| 3300006351|Ga0099953_1699234 | Not Available | 594 | Open in IMG/M |
| 3300006620|Ga0101444_106749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3330 | Open in IMG/M |
| 3300007113|Ga0101666_1025757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1036 | Open in IMG/M |
| 3300007133|Ga0101671_1028564 | Not Available | 801 | Open in IMG/M |
| 3300007152|Ga0101672_1013369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1295 | Open in IMG/M |
| 3300007956|Ga0105741_1104791 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 691 | Open in IMG/M |
| 3300009132|Ga0118730_1379996 | Not Available | 539 | Open in IMG/M |
| 3300009481|Ga0114932_10140184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1490 | Open in IMG/M |
| 3300009550|Ga0115013_10724982 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 678 | Open in IMG/M |
| 3300009593|Ga0115011_10584159 | Not Available | 898 | Open in IMG/M |
| 3300009593|Ga0115011_11251722 | Not Available | 642 | Open in IMG/M |
| 3300009703|Ga0114933_10776512 | Not Available | 612 | Open in IMG/M |
| 3300012928|Ga0163110_10301504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1173 | Open in IMG/M |
| 3300012928|Ga0163110_10990751 | Not Available | 669 | Open in IMG/M |
| 3300012928|Ga0163110_10992178 | Not Available | 669 | Open in IMG/M |
| 3300012928|Ga0163110_11311838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
| 3300012928|Ga0163110_11665698 | Not Available | 520 | Open in IMG/M |
| 3300012936|Ga0163109_10642858 | Not Available | 776 | Open in IMG/M |
| 3300012936|Ga0163109_10886385 | Not Available | 652 | Open in IMG/M |
| 3300012936|Ga0163109_11287577 | Not Available | 533 | Open in IMG/M |
| 3300012953|Ga0163179_11742220 | Not Available | 567 | Open in IMG/M |
| 3300012953|Ga0163179_12281999 | Not Available | 500 | Open in IMG/M |
| 3300012954|Ga0163111_10330987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1362 | Open in IMG/M |
| 3300012954|Ga0163111_10944041 | Not Available | 830 | Open in IMG/M |
| 3300012954|Ga0163111_11165407 | Not Available | 751 | Open in IMG/M |
| 3300012954|Ga0163111_11429060 | Not Available | 682 | Open in IMG/M |
| 3300017710|Ga0181403_1102085 | Not Available | 599 | Open in IMG/M |
| 3300017724|Ga0181388_1149045 | Not Available | 556 | Open in IMG/M |
| 3300017731|Ga0181416_1155940 | Not Available | 551 | Open in IMG/M |
| 3300017735|Ga0181431_1099093 | Not Available | 654 | Open in IMG/M |
| 3300017743|Ga0181402_1143474 | Not Available | 607 | Open in IMG/M |
| 3300017743|Ga0181402_1150087 | Not Available | 590 | Open in IMG/M |
| 3300017744|Ga0181397_1131801 | Not Available | 646 | Open in IMG/M |
| 3300017749|Ga0181392_1019670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2162 | Open in IMG/M |
| 3300017771|Ga0181425_1133129 | Not Available | 792 | Open in IMG/M |
| 3300017771|Ga0181425_1153428 | Not Available | 730 | Open in IMG/M |
| 3300017771|Ga0181425_1162633 | Not Available | 706 | Open in IMG/M |
| 3300017779|Ga0181395_1267938 | Not Available | 520 | Open in IMG/M |
| 3300017786|Ga0181424_10206439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 831 | Open in IMG/M |
| 3300017956|Ga0181580_10701443 | Not Available | 644 | Open in IMG/M |
| 3300018041|Ga0181601_10423795 | Not Available | 707 | Open in IMG/M |
| 3300018049|Ga0181572_10589815 | Not Available | 676 | Open in IMG/M |
| 3300019459|Ga0181562_10486070 | Not Available | 587 | Open in IMG/M |
| 3300020177|Ga0181596_10347962 | Not Available | 579 | Open in IMG/M |
| 3300020194|Ga0181597_10319629 | Not Available | 684 | Open in IMG/M |
| 3300020240|Ga0211494_1080466 | Not Available | 634 | Open in IMG/M |
| 3300020250|Ga0211627_1031762 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300020352|Ga0211505_1070148 | Not Available | 846 | Open in IMG/M |
| 3300020377|Ga0211647_10130294 | Not Available | 844 | Open in IMG/M |
| 3300020380|Ga0211498_10384159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales | 526 | Open in IMG/M |
| 3300020388|Ga0211678_10049440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1985 | Open in IMG/M |
| 3300020388|Ga0211678_10117386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1164 | Open in IMG/M |
| 3300020402|Ga0211499_10031139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2177 | Open in IMG/M |
| 3300020414|Ga0211523_10200198 | Not Available | 828 | Open in IMG/M |
| 3300020418|Ga0211557_10545466 | Not Available | 501 | Open in IMG/M |
| 3300020421|Ga0211653_10097714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1307 | Open in IMG/M |
| 3300020438|Ga0211576_10258704 | Not Available | 912 | Open in IMG/M |
| 3300020452|Ga0211545_10317593 | Not Available | 711 | Open in IMG/M |
| 3300020452|Ga0211545_10488133 | Not Available | 557 | Open in IMG/M |
| 3300020456|Ga0211551_10306317 | Not Available | 756 | Open in IMG/M |
| 3300020459|Ga0211514_10059136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1948 | Open in IMG/M |
| 3300020460|Ga0211486_10259303 | Not Available | 753 | Open in IMG/M |
| 3300020465|Ga0211640_10096496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1704 | Open in IMG/M |
| 3300020466|Ga0211714_10538018 | Not Available | 549 | Open in IMG/M |
| 3300020469|Ga0211577_10785524 | Not Available | 550 | Open in IMG/M |
| 3300020475|Ga0211541_10084160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1577 | Open in IMG/M |
| 3300021378|Ga0213861_10464647 | Not Available | 608 | Open in IMG/M |
| (restricted) 3300022920|Ga0233426_10237986 | Not Available | 730 | Open in IMG/M |
| 3300022926|Ga0255753_1280703 | Not Available | 655 | Open in IMG/M |
| 3300022927|Ga0255769_10166114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1015 | Open in IMG/M |
| 3300023084|Ga0255778_10307959 | Not Available | 724 | Open in IMG/M |
| 3300023105|Ga0255782_10237429 | Not Available | 883 | Open in IMG/M |
| 3300023170|Ga0255761_10231935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1014 | Open in IMG/M |
| 3300024242|Ga0228673_1098707 | Not Available | 521 | Open in IMG/M |
| 3300025892|Ga0209630_10132383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1292 | Open in IMG/M |
| 3300026076|Ga0208261_1136607 | Not Available | 623 | Open in IMG/M |
| 3300026081|Ga0208390_1107719 | Not Available | 687 | Open in IMG/M |
| 3300026203|Ga0207985_1018547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1843 | Open in IMG/M |
| 3300026292|Ga0208277_1076048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1288 | Open in IMG/M |
| 3300026511|Ga0233395_1078303 | Not Available | 896 | Open in IMG/M |
| 3300027830|Ga0209359_10553443 | Not Available | 531 | Open in IMG/M |
| 3300027906|Ga0209404_11244579 | Not Available | 513 | Open in IMG/M |
| 3300031766|Ga0315322_10514834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
| 3300031774|Ga0315331_10728116 | Not Available | 698 | Open in IMG/M |
| 3300031774|Ga0315331_11072788 | Not Available | 544 | Open in IMG/M |
| 3300031775|Ga0315326_10680372 | Not Available | 649 | Open in IMG/M |
| 3300032011|Ga0315316_11300452 | Not Available | 580 | Open in IMG/M |
| 3300032073|Ga0315315_11374835 | Not Available | 617 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.72% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 20.72% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.71% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 10.81% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.91% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 5.41% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 3.60% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.70% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.70% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.80% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.80% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 1.80% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.90% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.90% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.90% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.90% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.90% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001834 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM2, ROCA_DNA019_0.2um_2g | Environmental | Open in IMG/M |
| 3300001954 | Marine microbial communities from Colon, Panama - GS019 | Environmental | Open in IMG/M |
| 3300001972 | Marine microbial communities from the Sargasso Sea - GS000d | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300005398 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV201 | Environmental | Open in IMG/M |
| 3300005401 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006620 | Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ10 time point | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007133 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', water-ds | Environmental | Open in IMG/M |
| 3300007152 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3 | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300009132 | Combined Assembly of Gp0139359, Gp0139510 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018041 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020194 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041403US metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020240 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556046-ERR598982) | Environmental | Open in IMG/M |
| 3300020250 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555986-ERR599129) | Environmental | Open in IMG/M |
| 3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
| 3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020402 | Marine microbial communities from Tara Oceans - TARA_B000000609 (ERX555971-ERR599057) | Environmental | Open in IMG/M |
| 3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
| 3300020418 | Marine microbial communities from Tara Oceans - TARA_B100002051 (ERX556028-ERR599136) | Environmental | Open in IMG/M |
| 3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020452 | Marine microbial communities from Tara Oceans - TARA_B100001173 (ERX556054-ERR599078) | Environmental | Open in IMG/M |
| 3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020466 | Marine microbial communities from Tara Oceans - TARA_B100001540 (ERX556059-ERR598968) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300022920 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_10_MG | Environmental | Open in IMG/M |
| 3300022926 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG | Environmental | Open in IMG/M |
| 3300022927 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG | Environmental | Open in IMG/M |
| 3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300024242 | Seawater microbial communities from Monterey Bay, California, United States - 91D | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026076 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300026081 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026203 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 (SPAdes) | Environmental | Open in IMG/M |
| 3300026292 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026511 | Seawater microbial communities from Monterey Bay, California, United States - 27D | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300031766 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACM2_10540021 | 3300001834 | Marine Plankton | INPKHKKKNVENFGLRLCGLSDVQLTFGIFLIFKNIF* |
| GOS2235_10129861 | 3300001954 | Marine | HKKKNVENFGLKLNGLSELHFTFGIFFIFKNISAIIYIY* |
| GOS2216_101014574 | 3300001972 | Marine | HKKKNVENFGLKLKGFSELHFTFGIFFIFKNIIVISYIY* |
| GOScombined01_1030757842 | 3300002040 | Marine | NIRKKNVENFGLKLNGFSELHFTFGIFFIFKNIIIISYIY* |
| GOScombined01_1054631542 | 3300002040 | Marine | PNRDKPKHKKKNVENFGLKLNGFSELHFTFGIFLIFKNIIIISYIY* |
| Ga0066858_101185191 | 3300005398 | Marine | NKPSPKPNNDKPKHKKNNVENFGLKLNGLPELQYVFGTFFIDKNI* |
| Ga0066857_100600113 | 3300005401 | Marine | PSPKPNNDKPKHKKNNVENFGLKLNGLSELQYVFGTFFIDKNI* |
| Ga0066856_103213712 | 3300005404 | Marine | PNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIIISYIY* |
| Ga0066845_102621751 | 3300005432 | Marine | NNPSPNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFLIFKNIIIISYIY* |
| Ga0066845_102635111 | 3300005432 | Marine | NKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYFY* |
| Ga0066865_102397701 | 3300005523 | Marine | PSPNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIIISYIY* |
| Ga0066865_102502572 | 3300005523 | Marine | HKKKNVENFGLRLCGLSDVQLTFGIFLIFKNIFS* |
| Ga0066835_101822341 | 3300005606 | Marine | SPNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY* |
| Ga0066377_100544931 | 3300005934 | Marine | KPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY* |
| Ga0066377_101444491 | 3300005934 | Marine | RPNNVRPKHKKKKVENFGLKLYGLSELQLTFGIFLFLKTF* |
| Ga0066377_102398991 | 3300005934 | Marine | RPNNVRPKHKKKKVENFGLKLYGLSELQLTFGIFLFLKTS* |
| Ga0066370_102282251 | 3300005971 | Marine | PNPNNINPKHKKKNVENFGLRLCGLSDVQLTFGIFLIFKNIF* |
| Ga0066370_102313171 | 3300005971 | Marine | NPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIIISYIY* |
| Ga0066370_102437372 | 3300005971 | Marine | KKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY* |
| Ga0066371_102991271 | 3300006024 | Marine | PKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYFY* |
| Ga0068495_11972511 | 3300006337 | Marine | PNIDKPKHKKKNVEKFGLKLYGFFELHFTFGIFFIFKNIIVISYIY* |
| Ga0099693_14603931 | 3300006345 | Marine | VRPKHKKKKVENFGLKLYGLSELQLTFGIFFIFKNILISYFYYR* |
| Ga0099954_15593811 | 3300006350 | Marine | SPRPNNIRPKHKKKKVENFGLKLYGLSELQLTFGIFFIFKNILISYFYYR* |
| Ga0099953_16992342 | 3300006351 | Marine | NNIKPKHKKKKVENFGLKLYGLSELQLTFGIFFIFKNILISYFYYR* |
| Ga0101444_1067497 | 3300006620 | Marine Surface Water | KKNVENFGLKLNGLSELQCTFGIFFIFKNIFLLNYFYY* |
| Ga0101666_10257571 | 3300007113 | Volcanic Co2 Seep Seawater | PNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIIISYIY* |
| Ga0101671_10285642 | 3300007133 | Volcanic Co2 Seeps | KPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIIISYIY* |
| Ga0101672_10133691 | 3300007152 | Volcanic Co2 Seeps | PNNVRPKHKKKKVENFGLKLYGLSELQLTFGIFLFLKTS* |
| Ga0105741_11047912 | 3300007956 | Estuary Water | PNNIKPKQQKNNVKNLGLKLYGFSELQLTFGIFLIFKNII* |
| Ga0118730_13799962 | 3300009132 | Marine | PNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIVVISYIY* |
| Ga0114932_101401843 | 3300009481 | Deep Subsurface | PNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY* |
| Ga0115013_107249821 | 3300009550 | Marine | NINPKQQKNNAENFGLKLYGFSELQLTFGIFFIFKNII* |
| Ga0115011_105841591 | 3300009593 | Marine | PNNIKPKQQKNNVENLGLKLYGLLELQLTFGIFFIFKNIF* |
| Ga0115011_112517221 | 3300009593 | Marine | PSPKPNNIKPKQQKNNVENFGLKLYGFSELQFTFGTFFIFKNIF* |
| Ga0114933_107765122 | 3300009703 | Deep Subsurface | KPKHKKNNVENFGLKLNGLPELQFVFGTFFIDKNI* |
| Ga0163110_103015041 | 3300012928 | Surface Seawater | NIKPKQQKNNVKNLGLKLYVFSELHFTLGIFFIFKNIF* |
| Ga0163110_109907511 | 3300012928 | Surface Seawater | NPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY* |
| Ga0163110_109921781 | 3300012928 | Surface Seawater | NIKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNIF* |
| Ga0163110_113118381 | 3300012928 | Surface Seawater | KPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNII* |
| Ga0163110_116656981 | 3300012928 | Surface Seawater | PNNISPKHKKKNVENFGLRLCGLPDVQLTFGIFLIFKNIF* |
| Ga0163109_106428582 | 3300012936 | Surface Seawater | PNNIKPKQQKNNVEIFGFKFNGFLELQLVLGIFFMDKNII* |
| Ga0163109_108863852 | 3300012936 | Surface Seawater | PNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY* |
| Ga0163109_112875771 | 3300012936 | Surface Seawater | PSPNPNKDKPKHKKKNVENFGLKFNGFSELQLTFGIFFIFKNINMINYIYQ* |
| Ga0163179_117422201 | 3300012953 | Seawater | NPSPKPNNVNPKHKKNNVENFGLKLNGLLELQFVFGTFFIDKNI* |
| Ga0163179_122819991 | 3300012953 | Seawater | PSPNPNNIKPKHKKKNVENLGLKLYGFLELQFTLGIFFIFKNIF* |
| Ga0163111_103309871 | 3300012954 | Surface Seawater | KQQKNNVENLGLKLYVFSELQFTFGIFLIFKNIF* |
| Ga0163111_109440411 | 3300012954 | Surface Seawater | NPNNIKPKQQKNSVKNLGLKLYVFSELQLTFGIFFIFKNIF* |
| Ga0163111_111654071 | 3300012954 | Surface Seawater | DKPKHKKKNVENFGLKLKGFSELHLTFGIFFIFKNIIIINYIY* |
| Ga0163111_114290602 | 3300012954 | Surface Seawater | KHKKKNVENFGLRLCGLSDVQLTFGIFLIFKNIF* |
| Ga0181403_11020851 | 3300017710 | Seawater | KPNNIKPKQQKNSVENFGLKLYIFSELHFTFGIFFIFKNIF |
| Ga0181388_11490451 | 3300017724 | Seawater | NVKPKHKKKNVENLGLKLKGFLELQFTFGIFFIFKNIF |
| Ga0181416_11559401 | 3300017731 | Seawater | VKPKHKKKNVENLGLKLYGFSELQFTLGIFFIFKNIF |
| Ga0181431_10990931 | 3300017735 | Seawater | NIKPKQQKNNVKNLGLKLYIFSELQFTFGIFFIFKNIF |
| Ga0181402_11434741 | 3300017743 | Seawater | NPKPNNVKPKHKKKNVENLGLKLYGFSELHFTLGIFFIFKNIF |
| Ga0181402_11500871 | 3300017743 | Seawater | KDKPKHKKKNVENLGLKLNGFSELHFTFGIFFIFKNIIIISYIY |
| Ga0181397_11318012 | 3300017744 | Seawater | PNKVRPKHKKKNVENFGLKLNGLSELQCTFGIFFIFKNIFLLNYFYY |
| Ga0181392_10196701 | 3300017749 | Seawater | PNPNRVRPKHKKKNVENFGLKLNGLSELQCTFGIFFIFKNIFLLNYFYY |
| Ga0181425_11331292 | 3300017771 | Seawater | DPSPKPNNIKQKQQKNNVENLGLKLYVFSELQFTFGIFLIFKNIF |
| Ga0181425_11534281 | 3300017771 | Seawater | ANNISPKHKKKNVENFGLRLCDLSDVQLTFGIFLIFKNIF |
| Ga0181425_11626331 | 3300017771 | Seawater | PKQQKNNVENLGLKLYVFSELQFTFGIFFIFKNIF |
| Ga0181395_12679382 | 3300017779 | Seawater | IKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNIPQ |
| Ga0181424_102064391 | 3300017786 | Seawater | NVKPKQQKNNVENLGLKLYVFSELQFTFGTFFIFKNIF |
| Ga0181580_107014431 | 3300017956 | Salt Marsh | KKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYFY |
| Ga0181601_104237951 | 3300018041 | Salt Marsh | KPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY |
| Ga0181572_105898151 | 3300018049 | Salt Marsh | PNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY |
| Ga0181562_104860701 | 3300019459 | Salt Marsh | KHKKKNVENFGLKLNGFSELHFTFGIFLIFKNIIIISYIY |
| Ga0181596_103479622 | 3300020177 | Salt Marsh | NNINPKHKKKNVENFGLRLCGLSDVQLTFGIFLIFKNIF |
| Ga0181597_103196291 | 3300020194 | Salt Marsh | NPSPNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY |
| Ga0211494_10804661 | 3300020240 | Marine | KPNNIKPKHKKKNVENLGLKLYGFSELQFTFGIFLIFKNIF |
| Ga0211627_10317622 | 3300020250 | Marine | NPSPNPNNVKPKHKKKNVENFGLKLYGFSELQFTLGIFLIFKNII |
| Ga0211505_10701482 | 3300020352 | Marine | NPKQQKNNVENLGLKLYIFSELQFTFGIFFIFKNII |
| Ga0211647_101302942 | 3300020377 | Marine | HKKKKVENFGLKLYGLSELQLTFGIFFIFKNILISYFYYR |
| Ga0211498_103841592 | 3300020380 | Marine | PSPKPNSIKPKQQKNNVKNLGLKLYGFSELQDTFGIFFIVKNIYK |
| Ga0211678_100494401 | 3300020388 | Marine | KPNNIKPKQQKNNVKNLGLKLYVFSELQFTIGIFFIFKNIFL |
| Ga0211678_101173861 | 3300020388 | Marine | SPKPNNIKPKQQKNNVENFGLRLYVFFELQKTTGIFFIVKNIIHFMTIV |
| Ga0211499_100311391 | 3300020402 | Marine | APNNVNPKTKKKIVINFGLKLNGFLELHDFFGIFFIVKNIINY |
| Ga0211523_102001981 | 3300020414 | Marine | IKPKQQKNNVENFGLKLYGFSELQFTFGTFFIFKNIF |
| Ga0211557_105454662 | 3300020418 | Marine | SPNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY |
| Ga0211653_100977143 | 3300020421 | Marine | PKPNNIKPKQQKNNVENFGLKLYGFSELQFTFGTFFIFKNIFX |
| Ga0211576_102587041 | 3300020438 | Marine | KPKQQKNNVKNLGLKLYIFSELQFTFGIFLIFKNII |
| Ga0211545_103175931 | 3300020452 | Marine | IKPIQQKNNVENFGLKLYGFSELQFTFGIFFIFKNIF |
| Ga0211545_104881331 | 3300020452 | Marine | PKHKKKNVESLGLKLYALSELHFTFGIFFIFKNIILISYLY |
| Ga0211551_103063171 | 3300020456 | Marine | NKPSPNPNNISPKHKKKNVDSFGLRLCGLSDVQLTFGIFLIFKNIF |
| Ga0211514_100591361 | 3300020459 | Marine | PKHKKKNVENFGLRLCGLSDVQFTFGIFLIFKNIFG |
| Ga0211486_102593032 | 3300020460 | Marine | PKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIVVISYIY |
| Ga0211640_100964961 | 3300020465 | Marine | PKPNKVSPKHKKKNVENFGLKLNGLSELQCTFGIFFIFKNIFLLNYFYY |
| Ga0211714_105380181 | 3300020466 | Marine | NSPSPNPNRVRPKHKKKNVENFGLKLNGLSELQCTFGIFFIFKNIFLLNYFYY |
| Ga0211577_107855242 | 3300020469 | Marine | NPSPNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNISIISYFY |
| Ga0211541_100841603 | 3300020475 | Marine | NIKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNIFE |
| Ga0213861_104646471 | 3300021378 | Seawater | KPKQQKKNVENFGLKLYTFSELQLTFGIFFIFKNIF |
| (restricted) Ga0233426_102379862 | 3300022920 | Seawater | SPKPNSINPKQQKNNVKNFGLKLYGFSELQLTFGIFLIFKNII |
| Ga0255753_12807032 | 3300022926 | Salt Marsh | KKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY |
| Ga0255769_101661141 | 3300022927 | Salt Marsh | PNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY |
| Ga0255778_103079592 | 3300023084 | Salt Marsh | NPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFLIFKNIIIISYIY |
| Ga0255782_102374292 | 3300023105 | Salt Marsh | NNPSPNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVISYIY |
| Ga0255761_102319353 | 3300023170 | Salt Marsh | PKHKKKNVENFGFRLCGLSDVQLTFGIFLIFKNIFR |
| Ga0228673_10987072 | 3300024242 | Seawater | KPNNIKPKQQKNNVKNLGLKLYGFSELQLTFGIFLIFKNII |
| Ga0209630_101323831 | 3300025892 | Pelagic Marine | NIKPKQQKNNVKNLGLKLYGFSELQLTFGTFLIFKNII |
| Ga0208261_11366071 | 3300026076 | Marine | PKHKKKNVENFGLRLCGFSDVQFTFGIFLIFKNIF |
| Ga0208390_11077192 | 3300026081 | Marine | KHKKKKVENFGLKLYGLSELQLTFGIFFIFKNILISYFYYR |
| Ga0207985_10185471 | 3300026203 | Marine | PNPNKDKPKHKKKNVENFGLKLNGFSELHFTFGIFFIFKNIIVINYIY |
| Ga0208277_10760481 | 3300026292 | Marine | PNNIKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNII |
| Ga0233395_10783031 | 3300026511 | Seawater | PKPNNIKPKQQKNNVKNLGLKLYGFSELQLTFGIFLIFKNII |
| Ga0209359_105534431 | 3300027830 | Marine | PNRDNPKHKKKNVENFGLKLYVFSELHLTLGIFLIFKNII |
| Ga0209404_112445791 | 3300027906 | Marine | PNNIKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNIFK |
| Ga0315322_105148342 | 3300031766 | Seawater | KPNNIKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNII |
| Ga0315331_107281162 | 3300031774 | Seawater | NNIKPKQQKNNVENFGLKLYGFSELQFTFGIFFIFKNII |
| Ga0315331_110727881 | 3300031774 | Seawater | PKPNNIKPKQQKNNVKNRGLKLYIFSELQFTFGTFFIFKNIF |
| Ga0315326_106803722 | 3300031775 | Seawater | NKVRPKHKKKNVENFGLKLNGLSELQCTFGIFFIFKNIFLLNYFYY |
| Ga0315316_113004522 | 3300032011 | Seawater | IKPKQQKNNVENLGLKLYVFLELQFTFGTFFIFKNIF |
| Ga0315315_113748352 | 3300032073 | Seawater | KKKNVENFGLKLNGFSELHFTFGIFLIFKNIVIISYIY |
| ⦗Top⦘ |