| Basic Information | |
|---|---|
| Family ID | F085778 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 43 residues |
| Representative Sequence | IVKVLREDDPDGKWNYEVFVKANGKESGFEVDPNGKFVKQHE |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.27 % |
| % of genes near scaffold ends (potentially truncated) | 87.39 % |
| % of genes from short scaffolds (< 2000 bps) | 87.39 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.477 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.117 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.036 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.342 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 40.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 12.61 |
| PF03023 | MurJ | 0.90 |
| PF05711 | TylF | 0.90 |
| PF00486 | Trans_reg_C | 0.90 |
| PF16277 | DUF4926 | 0.90 |
| PF16640 | Big_3_5 | 0.90 |
| PF00196 | GerE | 0.90 |
| PF13650 | Asp_protease_2 | 0.90 |
| PF13432 | TPR_16 | 0.90 |
| PF13376 | OmdA | 0.90 |
| PF01545 | Cation_efflux | 0.90 |
| PF05922 | Inhibitor_I9 | 0.90 |
| PF12681 | Glyoxalase_2 | 0.90 |
| PF00903 | Glyoxalase | 0.90 |
| PF00578 | AhpC-TSA | 0.90 |
| PF01872 | RibD_C | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.90 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.90 |
| COG0534 | Na+-driven multidrug efflux pump, DinF/NorM/MATE family | Defense mechanisms [V] | 0.90 |
| COG0728 | Lipid II flippase MurJ/MviN (peptidoglycan biosynthesis) | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.90 |
| COG1404 | Serine protease, subtilisin family | Posttranslational modification, protein turnover, chaperones [O] | 0.90 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.90 |
| COG2244 | Membrane protein involved in the export of O-antigen and teichoic acid | Cell wall/membrane/envelope biogenesis [M] | 0.90 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.48 % |
| Unclassified | root | N/A | 22.52 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2065487018|GPINP_F5MS3JC02IH20L | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 530 | Open in IMG/M |
| 2209111022|2221226694 | Not Available | 560 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_13901260 | Not Available | 540 | Open in IMG/M |
| 3300000953|JGI11615J12901_10062230 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 699 | Open in IMG/M |
| 3300000955|JGI1027J12803_103213462 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 721 | Open in IMG/M |
| 3300000955|JGI1027J12803_104050893 | Not Available | 621 | Open in IMG/M |
| 3300000955|JGI1027J12803_107143219 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 713 | Open in IMG/M |
| 3300002911|JGI25390J43892_10047584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1017 | Open in IMG/M |
| 3300003911|JGI25405J52794_10000564 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5433 | Open in IMG/M |
| 3300004479|Ga0062595_101623294 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 604 | Open in IMG/M |
| 3300005329|Ga0070683_101069175 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 775 | Open in IMG/M |
| 3300005436|Ga0070713_100153319 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2052 | Open in IMG/M |
| 3300005468|Ga0070707_101543140 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 631 | Open in IMG/M |
| 3300005549|Ga0070704_101260848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 675 | Open in IMG/M |
| 3300005564|Ga0070664_101307063 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 685 | Open in IMG/M |
| 3300005578|Ga0068854_101354129 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005586|Ga0066691_10188480 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1198 | Open in IMG/M |
| 3300005713|Ga0066905_100974566 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 746 | Open in IMG/M |
| 3300005764|Ga0066903_100543829 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1988 | Open in IMG/M |
| 3300005764|Ga0066903_101711573 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300005764|Ga0066903_105654314 | Not Available | 658 | Open in IMG/M |
| 3300005937|Ga0081455_10116724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2110 | Open in IMG/M |
| 3300006358|Ga0068871_100127201 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2158 | Open in IMG/M |
| 3300006904|Ga0075424_101436616 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 733 | Open in IMG/M |
| 3300009098|Ga0105245_12877813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 533 | Open in IMG/M |
| 3300009147|Ga0114129_11814054 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 741 | Open in IMG/M |
| 3300009162|Ga0075423_11146004 | Not Available | 829 | Open in IMG/M |
| 3300009174|Ga0105241_10085862 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2474 | Open in IMG/M |
| 3300010041|Ga0126312_10224929 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1314 | Open in IMG/M |
| 3300010043|Ga0126380_10425153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 995 | Open in IMG/M |
| 3300010043|Ga0126380_11181485 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 658 | Open in IMG/M |
| 3300010046|Ga0126384_10772885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 858 | Open in IMG/M |
| 3300010048|Ga0126373_13201281 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 510 | Open in IMG/M |
| 3300010323|Ga0134086_10400422 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 552 | Open in IMG/M |
| 3300010366|Ga0126379_13208389 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 547 | Open in IMG/M |
| 3300010366|Ga0126379_13593450 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 519 | Open in IMG/M |
| 3300010373|Ga0134128_12451705 | Not Available | 575 | Open in IMG/M |
| 3300010375|Ga0105239_11206729 | Not Available | 872 | Open in IMG/M |
| 3300010376|Ga0126381_100189373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2741 | Open in IMG/M |
| 3300010376|Ga0126381_102191413 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 795 | Open in IMG/M |
| 3300010398|Ga0126383_11804437 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300010401|Ga0134121_10381164 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300011444|Ga0137463_1101686 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1081 | Open in IMG/M |
| 3300012200|Ga0137382_10788352 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 683 | Open in IMG/M |
| 3300012200|Ga0137382_11206763 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 537 | Open in IMG/M |
| 3300012210|Ga0137378_10567620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1044 | Open in IMG/M |
| 3300012212|Ga0150985_121158023 | Not Available | 586 | Open in IMG/M |
| 3300012359|Ga0137385_10722741 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 831 | Open in IMG/M |
| 3300012359|Ga0137385_11349231 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 576 | Open in IMG/M |
| 3300012359|Ga0137385_11475037 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 544 | Open in IMG/M |
| 3300012582|Ga0137358_10136118 | All Organisms → cellular organisms → Bacteria | 1671 | Open in IMG/M |
| 3300012922|Ga0137394_10266707 | Not Available | 1464 | Open in IMG/M |
| 3300012925|Ga0137419_10024975 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3568 | Open in IMG/M |
| 3300012929|Ga0137404_11988073 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300012948|Ga0126375_10655818 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 810 | Open in IMG/M |
| 3300012957|Ga0164303_10417543 | Not Available | 834 | Open in IMG/M |
| 3300012957|Ga0164303_10620823 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 715 | Open in IMG/M |
| 3300012957|Ga0164303_11343918 | Not Available | 531 | Open in IMG/M |
| 3300012971|Ga0126369_10124678 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 2379 | Open in IMG/M |
| 3300012971|Ga0126369_10386855 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1432 | Open in IMG/M |
| 3300012971|Ga0126369_11564103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 749 | Open in IMG/M |
| 3300012977|Ga0134087_10033246 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1961 | Open in IMG/M |
| 3300012984|Ga0164309_11453830 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 586 | Open in IMG/M |
| 3300012987|Ga0164307_10791526 | Not Available | 753 | Open in IMG/M |
| 3300012988|Ga0164306_10448931 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 980 | Open in IMG/M |
| 3300013102|Ga0157371_10462754 | Not Available | 933 | Open in IMG/M |
| 3300013296|Ga0157374_11739478 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 648 | Open in IMG/M |
| 3300013297|Ga0157378_10766813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 988 | Open in IMG/M |
| 3300013306|Ga0163162_10129313 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2634 | Open in IMG/M |
| 3300013308|Ga0157375_13201597 | Not Available | 546 | Open in IMG/M |
| 3300015241|Ga0137418_10650515 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 818 | Open in IMG/M |
| 3300015371|Ga0132258_10386191 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3474 | Open in IMG/M |
| 3300015371|Ga0132258_11428816 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1748 | Open in IMG/M |
| 3300015371|Ga0132258_12591673 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1267 | Open in IMG/M |
| 3300015374|Ga0132255_102624784 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 770 | Open in IMG/M |
| 3300015374|Ga0132255_103430842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 675 | Open in IMG/M |
| 3300015374|Ga0132255_104547885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 588 | Open in IMG/M |
| 3300018051|Ga0184620_10275314 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 566 | Open in IMG/M |
| 3300018071|Ga0184618_10346615 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 633 | Open in IMG/M |
| 3300019886|Ga0193727_1034405 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1716 | Open in IMG/M |
| 3300019998|Ga0193710_1013120 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 847 | Open in IMG/M |
| 3300020000|Ga0193692_1068681 | Not Available | 785 | Open in IMG/M |
| 3300020002|Ga0193730_1155570 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 600 | Open in IMG/M |
| 3300020008|Ga0193757_1003869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1297 | Open in IMG/M |
| 3300020018|Ga0193721_1025580 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1563 | Open in IMG/M |
| 3300020059|Ga0193745_1075436 | Not Available | 734 | Open in IMG/M |
| 3300020583|Ga0210401_10220447 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300021344|Ga0193719_10015568 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 3222 | Open in IMG/M |
| 3300021411|Ga0193709_1116006 | Not Available | 554 | Open in IMG/M |
| 3300022534|Ga0224452_1170019 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 671 | Open in IMG/M |
| 3300022756|Ga0222622_11042102 | Not Available | 601 | Open in IMG/M |
| 3300024323|Ga0247666_1101708 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 571 | Open in IMG/M |
| 3300025898|Ga0207692_10284451 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1002 | Open in IMG/M |
| 3300025915|Ga0207693_10435203 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1025 | Open in IMG/M |
| 3300025927|Ga0207687_11475811 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 584 | Open in IMG/M |
| 3300025930|Ga0207701_11063738 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 672 | Open in IMG/M |
| 3300025931|Ga0207644_11850621 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 505 | Open in IMG/M |
| 3300025944|Ga0207661_12162406 | Not Available | 503 | Open in IMG/M |
| 3300028828|Ga0307312_10983072 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 559 | Open in IMG/M |
| 3300028875|Ga0307289_10329230 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 629 | Open in IMG/M |
| 3300028875|Ga0307289_10345090 | Not Available | 613 | Open in IMG/M |
| 3300030916|Ga0075386_12033138 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 998 | Open in IMG/M |
| 3300030945|Ga0075373_10037721 | All Organisms → cellular organisms → Bacteria | 2285 | Open in IMG/M |
| 3300031446|Ga0170820_12910659 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1678 | Open in IMG/M |
| 3300031446|Ga0170820_13158285 | Not Available | 586 | Open in IMG/M |
| 3300031446|Ga0170820_13298623 | Not Available | 540 | Open in IMG/M |
| 3300031744|Ga0306918_10633576 | Not Available | 838 | Open in IMG/M |
| 3300031890|Ga0306925_10329261 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1641 | Open in IMG/M |
| 3300031912|Ga0306921_10185470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2438 | Open in IMG/M |
| 3300033551|Ga0247830_11574519 | Not Available | 526 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.71% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.31% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.70% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.70% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.80% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.90% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.90% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.90% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300030916 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030945 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPINP_02148120 | 2065487018 | Soil | IVKILREDDPDGKWNYEVFVKANGKESGFEVDPNGKFVKHHE |
| 2222079042 | 2209111022 | Grass Soil | VREDDPDGKWNYEAFVKASGKEFLFEVDPNGNFVKEHK |
| ICChiseqgaiiFebDRAFT_139012602 | 3300000363 | Soil | DDPDGKWNYEVLVKANGKESKFEVDPNGNFVKQHE* |
| JGI11615J12901_100622301 | 3300000953 | Soil | IVQIKREGDVNGKWNYEVVVRTNGKEWGFEMDPSGKFVKKHSDQK* |
| JGI1027J12803_1032134621 | 3300000955 | Soil | VKVLREDDPDGKWNYEVFVKANGKEAGFEVDPNGQFVKQHE* |
| JGI1027J12803_1040508932 | 3300000955 | Soil | QVVKVMREDDPDGKWNYEVLIKANGKESKFEVDPNGNFVKQHE* |
| JGI1027J12803_1071432192 | 3300000955 | Soil | AGGEIVRVIREDDPDGKWNYEVFVKTNGTESVFEVDPNGKFVRQRSEVRK* |
| JGI25390J43892_100475841 | 3300002911 | Grasslands Soil | REDDANGKWNYEVVVRTNGKEWGFEVDPNGKFLKKHTEVKK* |
| JGI25405J52794_100005641 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MKREDDANGRWNYEVVVKSQGKEWGFEVDPNGKLLKTHGEKK* |
| Ga0062595_1016232942 | 3300004479 | Soil | KVMREDDPDGKWNYEVLAKVNGKDSKFEVDPNGTFVKQHE* |
| Ga0070683_1010691751 | 3300005329 | Corn Rhizosphere | REDDPDGKWNYEVVVKANGKESGFEVDPNGRFVKHHEAN* |
| Ga0070713_1001533192 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VKREDDTNGRWNYEVVVRTNGKEWGFEVAPNGRFVKKHGEKTMGRQ* |
| Ga0070707_1015431401 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VKREDDTNGRWNYEVVVRTNGKEWGFEVDPNGKLLKQHSAIKR* |
| Ga0070704_1012608481 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VKREDDTNGRWNYEVVVRTNGKDWGFEIDPNGKVLKQREAKE* |
| Ga0070664_1013070631 | 3300005564 | Corn Rhizosphere | REDDPDGKWNYEVFVKANGKDSQFEVDPNGNFVKQHE* |
| Ga0068854_1013541292 | 3300005578 | Corn Rhizosphere | VMREDDRDGKWNYEVFVKTEGKEWCFEVNPQGKFVKKHDATQHKEH* |
| Ga0066691_101884803 | 3300005586 | Soil | DANGKWNYEVVVRTNGKESGFEVDPNGKLLRQHAEVKR* |
| Ga0066905_1009745662 | 3300005713 | Tropical Forest Soil | REDDPDGKWNYEVFVKANGKESKFEVDPNGNFVKHHE* |
| Ga0066903_1005438294 | 3300005764 | Tropical Forest Soil | MREDDPDGKWNYEVVVNANGKESKFEVDPNGNFVKQHE* |
| Ga0066903_1017115731 | 3300005764 | Tropical Forest Soil | GVKREDDSNGKWNYEVVVRTNGKDWGFEVDPNGKFVKKHSDQKTMGR* |
| Ga0066903_1056543142 | 3300005764 | Tropical Forest Soil | VLREDDPDGKWNYEVFVKANRKESGFEVDPNGKFVKQHD* |
| Ga0081455_101167241 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ANGKWNYEVVAKTNGKEWKFEVDPNGKFVKKHDEAKK* |
| Ga0068871_1001272013 | 3300006358 | Miscanthus Rhizosphere | DPDGKWNYEVFVKASGKDSLFEVDPNGNFVKQHE* |
| Ga0075424_1014366161 | 3300006904 | Populus Rhizosphere | AGGNVVKVMREDDPDGKWNYEVFVKTNGKESGFEVDPNGKFLREHSE* |
| Ga0105245_128778132 | 3300009098 | Miscanthus Rhizosphere | RVIREDDPDGKWNYEVFVKTNGTESVFEVDPNGKFVRQHSEVRK* |
| Ga0114129_118140542 | 3300009147 | Populus Rhizosphere | MREDDPDGKWNYEVHVKANGKDSKFEVDPNGSFVKQHE* |
| Ga0075423_111460042 | 3300009162 | Populus Rhizosphere | SEDDPNGKWNYEVVVKTNGKESGFEVDPNGKLVRHHGEQKK* |
| Ga0105241_100858621 | 3300009174 | Corn Rhizosphere | EDDPDGKWNYEIHVKGNGKDSKFEVDPNGTFVKNQE* |
| Ga0126312_102249291 | 3300010041 | Serpentine Soil | KVVQVKREDDTNGKWNYEVVVKTNGEESAFEVDPNGKFLKKHPELRK* |
| Ga0126380_104251531 | 3300010043 | Tropical Forest Soil | GQVVKVVREDDPDGKWNYEVFVKANGKESGFEVDPNGNFVKQHE* |
| Ga0126380_111814852 | 3300010043 | Tropical Forest Soil | RVIREDDPDGKWNYEVVVKTNGKESGFEVDPNGRFVKHHEPN* |
| Ga0126384_107728851 | 3300010046 | Tropical Forest Soil | VIKVVREDDPDGKWNYEVFLTANGKESGFEVDPNGQFVKNHGE* |
| Ga0126373_132012812 | 3300010048 | Tropical Forest Soil | PDGKWNYEVFVAANGKELGFEIDPNGQFVKNHGE* |
| Ga0134086_104004222 | 3300010323 | Grasslands Soil | GGKVVQVKREDDTNGKWNYEVVVKTNGEESAFEVDPNGKFLRQHTEIKR* |
| Ga0126379_132083891 | 3300010366 | Tropical Forest Soil | DSNGKWNYEVVVKTNGKESGFEVDPNGKLLKQHAEIKR* |
| Ga0126379_135934502 | 3300010366 | Tropical Forest Soil | VTRVMREDDPDGRWNYEVVVTTNGKESGFEVAPSGKFVKQHSEIKK* |
| Ga0134128_124517051 | 3300010373 | Terrestrial Soil | RVIREDDPNGKWNYEVVVKTNGKESGFEVDPNGKLVRHHGELKK* |
| Ga0105239_112067291 | 3300010375 | Corn Rhizosphere | EDDPDGKWNYEVSVKANGKDSLFEVDPNGNFVKQHE* |
| Ga0126381_1001893731 | 3300010376 | Tropical Forest Soil | DPDGKWNYEVFVKANGKESGFEVDPNGQFVKNHE* |
| Ga0126381_1021914131 | 3300010376 | Tropical Forest Soil | DPDGKWNYEVFVKANGKQSGFEIDPNGKFVKEHSE* |
| Ga0126383_118044371 | 3300010398 | Tropical Forest Soil | DDPDGKWNYEVHAKADGKDLKFEVDPDGKFVKQQE* |
| Ga0134121_103811641 | 3300010401 | Terrestrial Soil | DPDGKWNYEVFVKTNGSESVFEVDPNGKFVRQHSEVRK* |
| Ga0137463_11016862 | 3300011444 | Soil | REDDPDGKWNYEVFVKANGKDSGFEVDPNGKFVKQHE* |
| Ga0137382_107883521 | 3300012200 | Vadose Zone Soil | KAAGGSIVKVLREDDPDGKWNYEVFVKANGKESGFEVDPNGKFVKNHE* |
| Ga0137382_112067632 | 3300012200 | Vadose Zone Soil | RIKREDDANGKWNYEVVVRTNGKEWGFEVDPNGKFLKQQSGITE* |
| Ga0137378_105676201 | 3300012210 | Vadose Zone Soil | VKREDDANGKWNYEVVVRTNGKESGFEVDPNGKLLRQHAEVKR* |
| Ga0150985_1211580232 | 3300012212 | Avena Fatua Rhizosphere | SGGNIVKVLREDDPDGKWNYEVFVNANGKQSGFEVDPNGKFVREHGE* |
| Ga0137385_107227411 | 3300012359 | Vadose Zone Soil | VVQVRREDDSNGKWNYEIVVKTNGKESEFEVDPNGKFLRQHTEIKR* |
| Ga0137385_113492312 | 3300012359 | Vadose Zone Soil | NQKAAGGKVVQVKREDDTNGKWNYEVVVKTNGEESAFEVDPNGKFLRQHTEIKR* |
| Ga0137385_114750371 | 3300012359 | Vadose Zone Soil | VKREDDANGKWNYEVVVRTNGKESGFEVDPKGKFLRIKR* |
| Ga0137358_101361181 | 3300012582 | Vadose Zone Soil | IVKVLREDAPDGKWNYEVCVKANGKESGFEIDPNGKFVKQHE* |
| Ga0137394_102667071 | 3300012922 | Vadose Zone Soil | AGGGSIVKVLREDDPDGKWNYEVFVKASGKESGFEVDPNGKFVKQHE* |
| Ga0137419_100249753 | 3300012925 | Vadose Zone Soil | VRREDDANGKWNYEVVVRTNGKEWGFEVDPNGKFLKKHTEIKR* |
| Ga0137404_119880731 | 3300012929 | Vadose Zone Soil | DANGKWNYEVVVKTNGKESGFEVDPNGKFVRQHTEVKR* |
| Ga0126375_106558182 | 3300012948 | Tropical Forest Soil | GGKIVRITREDDPDGKWKYEVVVSANGKESGFEVDPNGKFLKQHTEVHK* |
| Ga0164303_104175431 | 3300012957 | Soil | KAAGGQIVKVVREDDPDGKWNYEAFVKASGKESLFEVDPNGTFVKQHE* |
| Ga0164303_106208231 | 3300012957 | Soil | GNVVKVMREDDPDGKWNYEVVVKANGKESGFEVDPNGRLVKAHRVVTK* |
| Ga0164303_113439181 | 3300012957 | Soil | DPDGKWNYEVFVKANGKEALFEVDPNGQFVKQHEYYTAAVT* |
| Ga0126369_101246785 | 3300012971 | Tropical Forest Soil | DANGKWNYEVVVKTNGKESGFEVDPNGKFVKQRTETR* |
| Ga0126369_103868553 | 3300012971 | Tropical Forest Soil | AAGGDIVKVLREDDPDGRWNYEVFVKANGKDSGFEVDPNGKFVKHHSE* |
| Ga0126369_115641032 | 3300012971 | Tropical Forest Soil | KVLREDDPDGKWNYEVFVKANGKESGFEVDPNGKLVKDHSE* |
| Ga0134087_100332461 | 3300012977 | Grasslands Soil | QKTAGGEVVQVKREDDANGTWNYEVVVRTNGKESGFEVDPKGNS* |
| Ga0164309_114538301 | 3300012984 | Soil | AGGQIVKVLREDDPDGKWNYEVFVKASGKESLFEVDPNGEFVKQHE* |
| Ga0164307_107915262 | 3300012987 | Soil | VKVLREDDPDGKCNYEVLVKANGKESGVEVDPNGQFVKQHE* |
| Ga0164306_104489311 | 3300012988 | Soil | KVVRVMREDDPDGKWNYEVFVTTNGKASGFEVDPNGKFLKEHSE* |
| Ga0157371_104627541 | 3300013102 | Corn Rhizosphere | REDDPDGKWNYEVVVKASGKASRFEVDPNGNFVKQHE* |
| Ga0157374_117394781 | 3300013296 | Miscanthus Rhizosphere | KAAGGQVVKVLREDDPDGKWNYEVVVKASGKASRFEVDPNGNFVKQHE* |
| Ga0157378_107668131 | 3300013297 | Miscanthus Rhizosphere | KAAGGEVVRVIREDDPDGKWFYEVVVKANGKESGFEVDMHGKVVRHHG* |
| Ga0163162_101293134 | 3300013306 | Switchgrass Rhizosphere | GQVVKVLREDDPDGKWNYEVVVKASGKASRFEVDPNGNFVKQHE* |
| Ga0157375_132015971 | 3300013308 | Miscanthus Rhizosphere | EDDPDGKWNYEVVAKANGKESKFEVDPNGNFVKQHE* |
| Ga0137418_106505152 | 3300015241 | Vadose Zone Soil | AAGGEVVQVRREDDSNGKWNYEVVVRTNEKESGFEVDPNGKFLRQHAEIKR* |
| Ga0132258_103861912 | 3300015371 | Arabidopsis Rhizosphere | DKAAGGTVVKVMREDDPDGKWNYEVVAKANGKESKFEVDPNGNFVKQHE* |
| Ga0132258_114288161 | 3300015371 | Arabidopsis Rhizosphere | GGNIVKVVREDDPDGKWNYEVFVKANGKDSLFEVDPNGNFVKQHE* |
| Ga0132258_125916732 | 3300015371 | Arabidopsis Rhizosphere | MREDDPDGKWNYEVFVKTSGKESGFEVDPNGKFLREHSE* |
| Ga0132255_1026247841 | 3300015374 | Arabidopsis Rhizosphere | KAAGGSIVKVLREDDPDGRWNYEVFVKASGKDSGFEVDPNGQFVKQHE* |
| Ga0132255_1034308421 | 3300015374 | Arabidopsis Rhizosphere | NVVKVMREDDPDGKWNYEVFVTTNGKKSGFEVDPNGKFLREHNE* |
| Ga0132255_1045478851 | 3300015374 | Arabidopsis Rhizosphere | VKVVREDDPDGKWNYEASVKASGKESLFEVDPNGNFVKQHE* |
| Ga0184620_102753142 | 3300018051 | Groundwater Sediment | NQKAAGGSIIKVLREDDPDGKWNYEVFVKANGKESGFEVDPNGKFVKQHE |
| Ga0184618_103466151 | 3300018071 | Groundwater Sediment | MKRRQAGEIVHVKREDDTNGKWNYEVVVKASGKEWQFEVDPNGKFVKKHGETKE |
| Ga0173479_108012602 | 3300019362 | Soil | MEPGPPEGKAAGGEIVRVKREDDVNGKWNYEVVVRTNGKEWGFEVDPNGKFRKKYGQIKE |
| Ga0193727_10344051 | 3300019886 | Soil | GEIVHVKREDDTNGKWNYEVVVKTSGKEWQFEVDPNGKFVKKHGETKE |
| Ga0193710_10131202 | 3300019998 | Soil | VKREDDTNGKWNYEVVVKTSGKEWQFEVDPNGKFVKKHGETKE |
| Ga0193692_10686812 | 3300020000 | Soil | GQIVKVLREDDPDGKWNYEVFVKANGKDSLFEVDPNGNFVQQHE |
| Ga0193730_11555701 | 3300020002 | Soil | IVKVLREDDPDGKWNYEVFVKANGKESGFEIDPNGKFVKNHGE |
| Ga0193757_10038692 | 3300020008 | Soil | AGGQIVKVLREDDPDGKWNYEVFVKASGKESGFEVDPNGQFVKQHE |
| Ga0193721_10255802 | 3300020018 | Soil | KAAGGQIVKVLREDDPDGKWNYEVFVKANGKESGFEIDPNGKFVKHHGE |
| Ga0193745_10754361 | 3300020059 | Soil | GGQIIKVLREDDPDGKWNYEVFVKANGKESLFEVDPNGTFVKQHE |
| Ga0210401_102204471 | 3300020583 | Soil | VEREDDKNGKWNYEVIVKTNGKKWGFEVDPNGKYVRNHAKPSQAE |
| Ga0193719_100155681 | 3300021344 | Soil | GSIVKVLREDDPDGKWNYEVFVKANGKESGFEVDPNGKFVKQHE |
| Ga0193709_11160061 | 3300021411 | Soil | KVLREDDPDGKWNYEVFVKANGKESVFEVDPNGNFVKQHE |
| Ga0224452_11700192 | 3300022534 | Groundwater Sediment | KAAGGEIVHVKREDDTNGKWNYEIVVKTNGKESKFEVDPNGKFLKKHGETKE |
| Ga0222622_110421021 | 3300022756 | Groundwater Sediment | EDDPDGKWNYEVFVKANGKESGFEVDPNGKFVKDHE |
| Ga0247666_11017081 | 3300024323 | Soil | EGGQVVNVMREDDPDGKWNYEIHVKGNGKDSKFEVDPNGTFVKNQE |
| Ga0207692_102844512 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EDDPDGKWNYEVVVSANGKKSGFEVDPNGKFVRQHNEIPE |
| Ga0207693_104352031 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LREDDPDGKWNYEVFVKANGKESGFEVDPNGQFVKNHE |
| Ga0207687_114758112 | 3300025927 | Miscanthus Rhizosphere | GGQVVKVLREDDPDGKWNYEVVVKASGKASRFEVDPNGNFVKQHE |
| Ga0207701_110637382 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VREDDPDGKWNYEAFVKASGKESLFEVDPSGNFVKQHE |
| Ga0207644_118506211 | 3300025931 | Switchgrass Rhizosphere | GGQIVKVLREDDPDGKWNYEVFVKASGKDSGFEVDPNGQFVKQHE |
| Ga0207661_121624061 | 3300025944 | Corn Rhizosphere | VKVMREDDPDGKWNYEVLAKVNGKDSKFEVDPNGNFVKQHE |
| Ga0307312_109830721 | 3300028828 | Soil | IVKVLREDDPDGKWNYEVFVKANGKESGFEVDPNGKFVKQHE |
| Ga0307289_103292302 | 3300028875 | Soil | AAGQEIVRVKREDPDGRWNYEVVARPSGKEWGFEVDPNGKFLKEDSENSECK |
| Ga0307289_103450901 | 3300028875 | Soil | KAAGGQIVKVLREDNPDGKWNYEVFVKANGKDSKFEVDPNGSFVKQHE |
| Ga0075386_120331381 | 3300030916 | Soil | GGSIVKVLREDDPDGKWNYEVFVKANGKESGFEVDPNGQFVKQHE |
| Ga0075373_100377211 | 3300030945 | Soil | AAGGQIVKVLREDDPDGKWNYEVFVKANGKESGFEVDPNGQFVKQHE |
| Ga0170820_129106591 | 3300031446 | Forest Soil | PDGKWNYEVVVKTNGKESGFDVDPNGRFAKHHEAN |
| Ga0170820_131582851 | 3300031446 | Forest Soil | REDDPDGKWNYEVSVKANGKDSLFEVDPNGNFVKQHE |
| Ga0170820_132986231 | 3300031446 | Forest Soil | GGQIVKVIREDDPDGKWNYEAFVKASGKESLFEVDPNGQFVKQHE |
| Ga0306918_106335762 | 3300031744 | Soil | MREDDPDGKWNYEVHVKANGKDSKFEVDPNGNFVKQHQ |
| Ga0306925_103292611 | 3300031890 | Soil | MREDDPDGKWNYEVFVKTSGKESGFEVDPNGKFLREHSE |
| Ga0306921_101854703 | 3300031912 | Soil | AGGTVVKVMREDDPDGKWNYEVHVKANGKDSKFEVDPNGNFVKQHQ |
| Ga0247830_115745192 | 3300033551 | Soil | VLREDDPDGKWNYEVFVKANGKESLFEVDPNGTFVKQHE |
| ⦗Top⦘ |