Metagenome / Metatranscriptome Family F085710

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F085710
Family Type	Metagenome / Metatranscriptome
Number of Sequences	111
Average Sequence Length	39 residues
Representative Sequence	MDYNDYYDDIYLDIYLEFGADSVSDPAYAEQLAKDKGVR
Number of Associated Samples	75
Number of Associated Scaffolds	111

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	75.68 %
% of genes near scaffold ends (potentially truncated)	21.62 %
% of genes from short scaffolds (< 2000 bps)	69.37 %
Associated GOLD sequencing projects	70
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.68

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (54.054 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (16.216 % of family members)
Environment Ontology (ENVO)	Unclassified (20.721 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (53.153 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 44.78% β-sheet: 0.00% Coil/Unstructured: 55.22%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.68
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.68
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 111 Family Scaffolds
PF13640	2OG-FeII_Oxy_3	3.60
PF06067	DUF932	3.60
PF02675	AdoMet_dc	1.80
PF02867	Ribonuc_red_lgC	1.80
PF00255	GSHPx	0.90
PF00041	fn3	0.90
PF01555	N6_N4_Mtase	0.90
PF13155	Toprim_2	0.90
PF02945	Endonuclease_7	0.90
PF01926	MMR_HSR1	0.90

COG ID	Name	Functional Category	% Frequency in 111 Family Scaffolds
COG0209	Ribonucleotide reductase alpha subunit	Nucleotide transport and metabolism [F]	1.80
COG1586	S-adenosylmethionine decarboxylase	Amino acid transport and metabolism [E]	1.80
COG0386	Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides	Defense mechanisms [V]	0.90
COG0863	DNA modification methylase	Replication, recombination and repair [L]	0.90
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	0.90
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	0.90

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
All Organisms	root	All Organisms	45.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Viruses	superkingdom	All Organisms → Viruses	41.44 %
cellular organisms	root	All Organisms → cellular organisms	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	19.82 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	19.82 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	19.82 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	19.82 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	16.22 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
Aphanizomenonaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
Aphanizomenon	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
Aphanizomenon flos-aquae	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae	4.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	54.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	20.72 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	16.22 %
Aphanizomenon flos-aquae WA102	isolate	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	4.50 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300001282\|B570J14230_10018528	Not Available	2569	Open in IMG/M
3300001843\|RCM34_1065372	Not Available	803	Open in IMG/M
3300002835\|B570J40625_100048512	Not Available	6105	Open in IMG/M
3300005580\|Ga0049083_10086196	All Organisms → Viruses → Predicted Viral	1093	Open in IMG/M
3300005662\|Ga0078894_11596436	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300005805\|Ga0079957_1053198	Not Available	2462	Open in IMG/M
3300005805\|Ga0079957_1107292	Not Available	1507	Open in IMG/M
3300005942\|Ga0070742_10027036	All Organisms → Viruses → Predicted Viral	1532	Open in IMG/M
3300006030\|Ga0075470_10198616	Not Available	575	Open in IMG/M
3300006030\|Ga0075470_10235159	Not Available	519	Open in IMG/M
3300006484\|Ga0070744_10008330	Not Available	3090	Open in IMG/M
3300006641\|Ga0075471_10263800	Not Available	883	Open in IMG/M
3300006641\|Ga0075471_10303073	Not Available	813	Open in IMG/M
3300006641\|Ga0075471_10376452	Not Available	715	Open in IMG/M
3300007171\|Ga0102977_1056216	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	1184	Open in IMG/M
3300007212\|Ga0103958_1141320	Not Available	1657	Open in IMG/M
3300007559\|Ga0102828_1064689	Not Available	863	Open in IMG/M
3300007639\|Ga0102865_1108640	Not Available	829	Open in IMG/M
3300007647\|Ga0102855_1041944	All Organisms → Viruses → Predicted Viral	1249	Open in IMG/M
3300007708\|Ga0102859_1187096	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	614	Open in IMG/M
3300007862\|Ga0105737_1101738	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	726	Open in IMG/M
3300008107\|Ga0114340_1001257	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	25585	Open in IMG/M
3300008107\|Ga0114340_1002965	Not Available	13259	Open in IMG/M
3300008107\|Ga0114340_1007121	Not Available	8235	Open in IMG/M
3300008107\|Ga0114340_1107007	All Organisms → Viruses → Predicted Viral	1685	Open in IMG/M
3300008107\|Ga0114340_1137355	Not Available	920	Open in IMG/M
3300008107\|Ga0114340_1205772	Not Available	654	Open in IMG/M
3300008110\|Ga0114343_1143312	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	772	Open in IMG/M
3300008113\|Ga0114346_1181299	Not Available	863	Open in IMG/M
3300008113\|Ga0114346_1247235	Not Available	666	Open in IMG/M
3300008116\|Ga0114350_1002364	Not Available	12906	Open in IMG/M
3300008116\|Ga0114350_1014209	Not Available	5824	Open in IMG/M
3300008120\|Ga0114355_1056777	All Organisms → Viruses → Predicted Viral	1743	Open in IMG/M
3300008962\|Ga0104242_1007010	Not Available	2028	Open in IMG/M
3300008962\|Ga0104242_1007558	Not Available	1944	Open in IMG/M
3300008962\|Ga0104242_1015245	Not Available	1343	Open in IMG/M
3300009161\|Ga0114966_10008135	Not Available	8556	Open in IMG/M
3300009194\|Ga0114983_1013451	All Organisms → Viruses → Predicted Viral	2314	Open in IMG/M
3300009194\|Ga0114983_1029729	All Organisms → Viruses → Predicted Viral	1377	Open in IMG/M
3300009233\|Ga0103856_10093726	Not Available	566	Open in IMG/M
3300009233\|Ga0103856_10114220	Not Available	519	Open in IMG/M
3300009419\|Ga0114982_1292876	Not Available	510	Open in IMG/M
3300010354\|Ga0129333_10008450	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9717	Open in IMG/M
3300010354\|Ga0129333_10021483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	6128	Open in IMG/M
3300010354\|Ga0129333_10031996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	4966	Open in IMG/M
3300010354\|Ga0129333_10040493	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4388	Open in IMG/M
3300010354\|Ga0129333_10231713	Not Available	1671	Open in IMG/M
3300010354\|Ga0129333_10339514	All Organisms → Viruses → Predicted Viral	1338	Open in IMG/M
3300010354\|Ga0129333_11323968	Not Available	594	Open in IMG/M
3300010354\|Ga0129333_11539250	Not Available	544	Open in IMG/M
3300010354\|Ga0129333_11757246	Not Available	503	Open in IMG/M
3300010885\|Ga0133913_11619623	All Organisms → Viruses → Predicted Viral	1632	Open in IMG/M
3300012000\|Ga0119951_1004654	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6730	Open in IMG/M
3300012663\|Ga0157203_1000021	Not Available	66216	Open in IMG/M
3300012663\|Ga0157203_1001153	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	6659	Open in IMG/M
3300012714\|Ga0157601_1185361	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	609	Open in IMG/M
3300012720\|Ga0157613_1207014	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	744	Open in IMG/M
3300012968\|Ga0129337_1177116	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	2765	Open in IMG/M
3300012968\|Ga0129337_1205250	All Organisms → Viruses → Predicted Viral	1151	Open in IMG/M
3300013005\|Ga0164292_10046205	Not Available	3446	Open in IMG/M
(restricted) 3300013132\|Ga0172372_10268477	All Organisms → Viruses → Predicted Viral	1235	Open in IMG/M
3300020141\|Ga0211732_1358029	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	608	Open in IMG/M
3300020159\|Ga0211734_10643844	Not Available	879	Open in IMG/M
3300020493\|Ga0208591_1016619	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	966	Open in IMG/M
3300021325\|Ga0210301_1229848	Not Available	519	Open in IMG/M
3300021519\|Ga0194048_10015027	All Organisms → Viruses → Predicted Viral	3446	Open in IMG/M
3300021961\|Ga0222714_10103351	All Organisms → Viruses → Predicted Viral	1797	Open in IMG/M
3300022748\|Ga0228702_1139372	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	536	Open in IMG/M
3300023174\|Ga0214921_10006379	All Organisms → Viruses	16205	Open in IMG/M
3300024289\|Ga0255147_1000951	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7499	Open in IMG/M
3300024289\|Ga0255147_1095707	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102	548	Open in IMG/M
3300024289\|Ga0255147_1107086	Not Available	511	Open in IMG/M
3300024346\|Ga0244775_11398140	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	538	Open in IMG/M
3300024348\|Ga0244776_10261702	All Organisms → Viruses → Predicted Viral	1198	Open in IMG/M
3300024352\|Ga0255142_1064947	Not Available	554	Open in IMG/M
3300024484\|Ga0256332_1042640	Not Available	975	Open in IMG/M
3300024484\|Ga0256332_1121092	Not Available	560	Open in IMG/M
3300024495\|Ga0255164_1003517	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2947	Open in IMG/M
3300024561\|Ga0255288_1042915	Not Available	1023	Open in IMG/M
3300024562\|Ga0256336_1042700	Not Available	983	Open in IMG/M
3300024570\|Ga0255276_1068026	Not Available	963	Open in IMG/M
3300024572\|Ga0255268_1032991	Not Available	1294	Open in IMG/M
3300024574\|Ga0255275_1211374	Not Available	514	Open in IMG/M
3300024857\|Ga0256339_1067354	Not Available	750	Open in IMG/M
3300024867\|Ga0255267_1051547	Not Available	960	Open in IMG/M
3300025585\|Ga0208546_1115154	Not Available	593	Open in IMG/M
3300025872\|Ga0208783_10300484	Not Available	638	Open in IMG/M
3300026473\|Ga0255166_1006028	All Organisms → Viruses → Predicted Viral	2826	Open in IMG/M
3300027217\|Ga0208928_1032092	Not Available	827	Open in IMG/M
3300027467\|Ga0255154_1057644	Not Available	867	Open in IMG/M
3300027563\|Ga0209552_1123642	Not Available	679	Open in IMG/M
3300027586\|Ga0208966_1092631	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	833	Open in IMG/M
3300027710\|Ga0209599_10018432	All Organisms → Viruses → Predicted Viral	1994	Open in IMG/M
3300027710\|Ga0209599_10037831	All Organisms → Viruses → Predicted Viral	1295	Open in IMG/M
3300027754\|Ga0209596_1005319	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	9543	Open in IMG/M
3300027754\|Ga0209596_1020422	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3980	Open in IMG/M
3300028112\|Ga0256335_1024349	All Organisms → Viruses → Predicted Viral	1571	Open in IMG/M
3300028286\|Ga0256331_1047028	Not Available	978	Open in IMG/M
3300031758\|Ga0315907_10003962	Not Available	16938	Open in IMG/M
3300031758\|Ga0315907_10052383	All Organisms → Viruses → Predicted Viral	3587	Open in IMG/M
3300031758\|Ga0315907_10419922	All Organisms → Viruses → Predicted Viral	1074	Open in IMG/M
3300031758\|Ga0315907_11180409	Not Available	537	Open in IMG/M
3300031857\|Ga0315909_10006383	Not Available	13317	Open in IMG/M
3300031951\|Ga0315904_10291343	Not Available	1536	Open in IMG/M
3300031951\|Ga0315904_10407964	All Organisms → Viruses → Predicted Viral	1229	Open in IMG/M
3300033521\|Ga0316616_100705474	All Organisms → Viruses → Predicted Viral	1209	Open in IMG/M
3300033557\|Ga0316617_100060441	All Organisms → Viruses → Predicted Viral	2426	Open in IMG/M
3300033557\|Ga0316617_100995056	Not Available	819	Open in IMG/M
3300033557\|Ga0316617_101568142	Not Available	666	Open in IMG/M
3300033994\|Ga0334996_0048617	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2642	Open in IMG/M
3300034523\|Ga0310143_00917	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	11783	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	90.99%
Terrestrial	Environmental → Terrestrial	9.01%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	63.96%
Marine	Environmental → Aquatic → Marine	27.03%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	5.41%
Soil	Environmental → Terrestrial → Soil	3.60%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	28.83%
Coastal	Environmental → Aquatic → Marine → Coastal	17.12%
River	Environmental → Aquatic → Freshwater → River	16.22%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	8.11%
Lentic	Environmental → Aquatic → Freshwater → Lentic	7.21%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	6.31%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	5.41%
Unclassified	Environmental → Aquatic → Marine → Unclassified	3.60%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.60%
Lotic	Environmental → Aquatic → Freshwater → Lotic	2.70%
Creek	Environmental → Aquatic → Freshwater → Creek	0.90%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	28.83%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	17.12%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	16.22%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	8.11%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	6.31%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	5.41%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	4.50%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	3.60%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.60%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.70%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	2.70%
Unclassified	Environmental → Aquatic → Freshwater → Creek → Unclassified	0.90%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	16.22%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	10.81%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	8.11%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	8.11%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	6.31%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	6.31%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.41%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.41%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	4.50%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	3.60%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.60%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.70%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	2.70%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	1.80%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	1.80%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	1.80%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	1.80%
River Water	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water	1.80%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	0.90%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.90%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.90%
Marine Plankton	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton	0.90%
Freshwater	Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater	0.90%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.90%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	0.90%
Fracking Water	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water	0.90%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300001282	Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion	Environmental	Open in IMG/M
3300001843	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300005942	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757	Environmental	Open in IMG/M
3300006030	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006641	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA	Environmental	Open in IMG/M
3300007171	Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects	Environmental	Open in IMG/M
3300007212	Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007639	Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02	Environmental	Open in IMG/M
3300007647	Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02	Environmental	Open in IMG/M
3300007708	Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02	Environmental	Open in IMG/M
3300007862	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008120	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009194	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT	Environmental	Open in IMG/M
3300009233	Microbial communities of water from Amazon river, Brazil - RCM9	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300010885	northern Canada Lakes Co-assembly	Environmental	Open in IMG/M
3300012000	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A	Environmental	Open in IMG/M
3300012663	Freshwater microbial communities from Indian River, Ontario, Canada - S50	Environmental	Open in IMG/M
3300012714	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012720	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300012968	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013132 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020493	Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021325	Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300021519	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300022748	Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024289	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300024352	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h	Environmental	Open in IMG/M
3300024484	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024495	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d	Environmental	Open in IMG/M
3300024561	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024562	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024570	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024572	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024574	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024857	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024867	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300025585	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025872	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300026473	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d	Environmental	Open in IMG/M
3300027217	Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 (SPAdes)	Environmental	Open in IMG/M
3300027467	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h	Environmental	Open in IMG/M
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028112	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300028286	Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300033521	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B	Environmental	Open in IMG/M
3300033557	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B	Environmental	Open in IMG/M
3300033994	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046	Environmental	Open in IMG/M
3300034523	Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J14230_100185285	3300001282	Freshwater	MDYNDYYDEIYLEIYEEFGAESVSDPAYAESLKK*
RCM34_10653721	3300001843	Marine Plankton	MFNEYDEYYNDIYLDIYETFGAEAVSDPAYAEQLLKEGK*
B570J40625_10004851213	3300002835	Freshwater	LKGVQMDYNDYYDEIYLEIYEEFGAESVSDPAYAESLKK*
Ga0049083_100861961	3300005580	Freshwater Lentic	MNDYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR*
Ga0078894_115964362	3300005662	Freshwater Lake	MNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0079957_10531985	3300005805	Lake	MDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKKGNK*
Ga0079957_11072923	3300005805	Lake	MNYDNYYDEIYTDIYLEFGAEAVSDPNYAEQLLNRKDK*
Ga0070742_100270366	3300005942	Estuarine	LGVILMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0075470_101986162	3300006030	Aqueous	MDYLDYYDEVYTDIYLEFGADSVSDPNYAEQLLKERGQNVR*
Ga0075470_102351592	3300006030	Aqueous	MDFLDYQDEIYLDIYLEFGETSVSDVKYAEQLRKEKNA*
Ga0070744_1000833010	3300006484	Estuarine	LGVIPMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0075471_102638003	3300006641	Aqueous	MNDYLDYQDEIYLDIYLEFGADSVSDPEYAEQLLRKEIA*
Ga0075471_103030731	3300006641	Aqueous	MDYFDYYDEVYTDIYLEFGASAVSDPDYAEELLRDKGHTR*
Ga0075471_103764521	3300006641	Aqueous	DYYDEVYTDIYLEFGADSVSDPNYAEELLKKGNK*
Ga0102977_10562164	3300007171	Freshwater Lake	MSDYFDYYDEIYTDIYLEFGAEAVSDPAYAEELLSKSQR*
Ga0103958_11413204	3300007212	Freshwater Lake	MDYLDYYDEVYTDIYLEFGADAVSDPAHAEALLGKSQN*
Ga0102828_10646894	3300007559	Estuarine	YYDDIYLDIYLEFGADSVSDPVYAEKLAKDKGVR*
Ga0102865_11086404	3300007639	Estuarine	MNDYYDEIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0102855_10419445	3300007647	Estuarine	MLLLEVGSNLMNDSYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0102859_11870961	3300007708	Estuarine	MDYNDYYDDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR*
Ga0105737_11017383	3300007862	Estuary Water	MLLLEVGSNLMIDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0114340_100125710	3300008107	Freshwater, Plankton	MNDYYDDIYLDIYLEFGADSVSDPDYAEQLAKDKGVR*
Ga0114340_100296537	3300008107	Freshwater, Plankton	MDYLDYYDEVYTDIYLEFGADSVSDPNYAEQLLKERK*
Ga0114340_10071214	3300008107	Freshwater, Plankton	MDYNEYYDEIYLEIYEEFGAESVSDPAYAESLKK*
Ga0114340_11070075	3300008107	Freshwater, Plankton	MDFNEYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR*
Ga0114340_11373551	3300008107	Freshwater, Plankton	MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR*
Ga0114340_12057722	3300008107	Freshwater, Plankton	MDFNEYYDDIYLDIYEEFGASAVSDPAYAEQLAKDKGVR*
Ga0114343_11433122	3300008110	Freshwater, Plankton	MNDYYDDIYLDIYLGFGADSVSGPVYAEQLAKDKGVR*
Ga0114346_11812991	3300008113	Freshwater, Plankton	MDYNDYYNEIYLDIFEEFGDSAVSDVSYAKELQSKKVGK*
Ga0114346_12472351	3300008113	Freshwater, Plankton	MDYNEYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR*
Ga0114350_100236415	3300008116	Freshwater, Plankton	MDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF*
Ga0114350_10142099	3300008116	Freshwater, Plankton	MDYFDYYDEVYTDIYLEFGADSVSDPAHAEALLGKSQN*
Ga0114355_10567774	3300008120	Freshwater, Plankton	MDFNEYYDEIYLDIYEEFGASAVSDPAYAEQLAKDKGVR*
Ga0104242_10070103	3300008962	Freshwater	MDYNDYYDDIYLDIYLEFGSDSVSDPAYAEQLAKDKGVR*
Ga0104242_10075584	3300008962	Freshwater	MDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLSHAKGVK*
Ga0104242_10152451	3300008962	Freshwater	MDYNDYYDDIYLEIYEEFGADSVSNPAYAEQLAKDKGVR*
Ga0114966_1000813511	3300009161	Freshwater Lake	MDYEDYYNDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR*
Ga0114983_10134511	3300009194	Deep Subsurface	LMDYNEYYDEIYLEIYEEFGADSVSDPSYAESLKGNK*
Ga0114983_10297292	3300009194	Deep Subsurface	MDYNEYYDEIYLEIYEEFGADSVSDPAYAESLKGNK*
Ga0103856_100937262	3300009233	River Water	MYNEYDEYYNDIYLDIYETFGAEAVSDPAYAEQLLKEGK*
Ga0103856_101142202	3300009233	River Water	MSDYLDYLDDIYLDIYETFGDKSVSDPNYAKELLAERNK*
Ga0114982_12928763	3300009419	Deep Subsurface	MDYNEYYDEIYLEIYEEFGADSVSDPSYAESLKGNK*
Ga0129333_100084507	3300010354	Freshwater To Marine Saline Gradient	MDYNDYYDEIYLDIYLEFGADSVSDPAYAESLLKKEGI*
Ga0129333_1002148314	3300010354	Freshwater To Marine Saline Gradient	MDYNDYYDEVYLDIYLEFGADAVSDPSYAEDLLSKSQK*
Ga0129333_100319968	3300010354	Freshwater To Marine Saline Gradient	MDYNDYYDEIYTDIYLEFGSEAVSDPAHAQNLLGKSQS*
Ga0129333_1004049311	3300010354	Freshwater To Marine Saline Gradient	MNYDDYYDEIYTDIYLEFGAEAVSDPNYAEQLLNRKDK*
Ga0129333_102317132	3300010354	Freshwater To Marine Saline Gradient	MDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK*
Ga0129333_103395144	3300010354	Freshwater To Marine Saline Gradient	MDYLDYYDEVYTDIYLEFGSEAVSDPAHAEALLGKSQA*
Ga0129333_113239682	3300010354	Freshwater To Marine Saline Gradient	MDYFDYYDEVYTDIYLEFGADAVSDPAHAEELLGKSHS*
Ga0129333_115392501	3300010354	Freshwater To Marine Saline Gradient	MDYFDYYDEVYTDIYLEFGAEAVSDPNYAEELLNRKDK*
Ga0129333_117572461	3300010354	Freshwater To Marine Saline Gradient	MDYLDYQDEIYLDIYLEFGADSVSDPDYAESLLKKEGI*
Ga0133913_116196236	3300010885	Freshwater Lake	MDDYYDEIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0119951_100465412	3300012000	Freshwater	MDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK*
Ga0157203_100002110	3300012663	Freshwater	MDYNEYYDEIYLEIYEEFGAQSVSDPAYAESLKK*
Ga0157203_100115318	3300012663	Freshwater	MLLLEVGSNLMNDYYDEIYLDIYLEFGADSVSDPAYAEQLAKDKGVR*
Ga0157601_11853613	3300012714	Freshwater	MLLLEVGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0157613_12070144	3300012720	Freshwater	EVGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
Ga0129337_11771168	3300012968	Aqueous	LGLTMDYNDYYDEVYLDIYLEFGADAVSDPSYAEDLLSKSQK*
Ga0129337_12052506	3300012968	Aqueous	LVLTMDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK*
Ga0164292_1004620514	3300013005	Freshwater	NDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR*
(restricted) Ga0172372_102684774	3300013132	Freshwater	MYNEYDEYLNDIYLDIYETFGAEAVTDPAYAEQLLKKGY*
Ga0211732_13580292	3300020141	Freshwater	MNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR
Ga0211734_106438443	3300020159	Freshwater	MDYNEYYDDIYLEIYEEFGADAVSDPSYAESLKGNK
Ga0208591_10166195	3300020493	Freshwater	MNDYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR
Ga0210301_12298481	3300021325	Estuarine	MDYNDYYDDIYLDIYLEFGADSVSDPAYAEQLAKDKGVR
Ga0194048_1001502714	3300021519	Anoxic Zone Freshwater	MDYDDYYNDIYLEIYEEFGADSVSNPAYAEQLAKDKGVR
Ga0222714_101033512	3300021961	Estuarine Water	MDYNDYYDDIYLDIYLEFGADSVTDPAYAEQLAKEKGVR
Ga0228702_11393721	3300022748	Freshwater	MNEYFDYMDEIYLDIYEEFGASAVSDPAYAEELKEKRNA
Ga0214921_1000637917	3300023174	Freshwater	MDYNDYYDDIYLEIYEEFGADSVSNPAYAEQLAKDKGVR
Ga0255147_100095110	3300024289	Freshwater	MDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF
Ga0255147_10957072	3300024289	Freshwater	MNYNDYYDEIYTDIYLEFGADSVTDPNYAEELLKKGNK
Ga0255147_11070863	3300024289	Freshwater	NDYYDDIYLDIYLEFGADSVTDPAYAEQLAKEKGVR
Ga0244775_113981402	3300024346	Estuarine	MNDYYDEIYLDIYLEFGADSVSDPVYAEQLAKDKGVR
Ga0244776_102617021	3300024348	Estuarine	ALARFMLLLEVGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR
Ga0255142_10649471	3300024352	Freshwater	MDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0256332_10426404	3300024484	Freshwater	KVGLTMDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0256332_11210922	3300024484	Freshwater	KTIMDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF
Ga0255164_10035172	3300024495	Freshwater	MDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR
Ga0255288_10429154	3300024561	Freshwater	LVLTMDYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0256336_10427001	3300024562	Freshwater	VGLTMDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0255276_10680264	3300024570	Freshwater	LTMDYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0255268_10329911	3300024572	Freshwater	MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEKLLKERNR
Ga0255275_12113741	3300024574	Freshwater	YNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHSKGVK
Ga0256339_10673544	3300024857	Freshwater	MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERKTKCFH
Ga0255267_10515471	3300024867	Freshwater	DYNDYYDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0208546_11151542	3300025585	Aqueous	MDYLDYYDEVYTDIYLEFGADSVSDPNYAEQLLKERGQNVR
Ga0208783_103004842	3300025872	Aqueous	MDFLDYQDEIYLDIYLEFGETSVSDVKYAEQLRKEKNA
Ga0255166_100602810	3300026473	Freshwater	IMDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF
Ga0208928_10320921	3300027217	Estuarine	GVILMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR
Ga0255154_10576443	3300027467	Freshwater	DYNDYYDDIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0209552_11236424	3300027563	Freshwater Lake	ILMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR
Ga0208966_10926313	3300027586	Freshwater Lentic	MNDYYDDIYLDIYLEFGADSVSDPAYAEQLAKDKGVR
Ga0209599_100184323	3300027710	Deep Subsurface	MDYNEYYDEIYLEIYEEFGADSVSDPSYAESLKGNK
Ga0209599_100378314	3300027710	Deep Subsurface	MDYNEYYDEIYLEIYEEFGADSVSDPAYAESLKGNK
Ga0209596_100531916	3300027754	Freshwater Lake	MDYNDYYDDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR
Ga0209596_10204221	3300027754	Freshwater Lake	MDYEDYYNDIYLDIYLEFGADSVSNPAYAEQLAKDKGVR
Ga0256335_10243492	3300028112	Freshwater	MNDYLDYQDEIYLDIYLEFGAEAVTDPAYAEELLSKSQF
Ga0256331_10470281	3300028286	Freshwater	MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLAHAKGVK
Ga0315907_1000396211	3300031758	Freshwater	MDFNEYYDDIYLEIYEEFGASAVSDPDYAEQLAKDKGVR
Ga0315907_1005238312	3300031758	Freshwater	MDYFDYYDEVYTDIYLEFGADSVSDPAHAEALLGKSQS
Ga0315907_104199221	3300031758	Freshwater	MNDYLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR
Ga0315907_111804093	3300031758	Freshwater	VGSNLMNDYYDDIYLDIYLEFGADSVSDPVYAEQLAKDKGVR
Ga0315909_1000638331	3300031857	Freshwater	MDYFDYYDEVYTDIYLEFGADSVSDPAHAEALLGKSQN
Ga0315904_102913431	3300031951	Freshwater	MDYNDYYDEIYTDIYLEFGAEAVSDPAHAEALLGKSQS
Ga0315904_104079642	3300031951	Freshwater	MDYLDYYDEVYTDIYLEFGAEAVSDPNYAEELLQKGNK
Ga0316616_1007054741	3300033521	Soil	MDYLDYYDEVYTDIYLEFGADSVSDPDYAEQLLKKGNK
Ga0316617_1000604411	3300033557	Soil	MDFLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKERNR
Ga0316617_1009950562	3300033557	Soil	MDYLDYQDEIYLDIYLEFGADSVSDPNYAEQLLKERNK
Ga0316617_1015681421	3300033557	Soil	MDFLDYQDEIYLDIYLEFGADSVSDPDYAEQLLKKGNK
Ga0334996_0048617_854_973	3300033994	Freshwater	MDYNDYYDEIYLEIYEEFGAESVSDPAYAESLKSGINHI
Ga0310143_00917_9992_10111	3300034523	Fracking Water	MDYNDYYDDIYLDIYLEFGADSVTDPTYAEQLAKEKGVR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters