Metagenome / Metatranscriptome Family F085532

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F085532
Family Type	Metagenome / Metatranscriptome
Number of Sequences	111
Average Sequence Length	38 residues
Representative Sequence	MSALRLVLLFVVSLALTGCPGPNYAPYDNMNNNSPG
Number of Associated Samples	86
Number of Associated Scaffolds	111

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	80.18 %
% of genes near scaffold ends (potentially truncated)	16.22 %
% of genes from short scaffolds (< 2000 bps)	85.59 %
Associated GOLD sequencing projects	81
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (70.270 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (32.432 % of family members)
Environment Ontology (ENVO)	Unclassified (37.838 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (49.550 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 111 Family Scaffolds
PF01019	G_glu_transpept	8.11
PF10014	2OG-Fe_Oxy_2	5.41
PF09931	DUF2163	5.41
PF00496	SBP_bac_5	3.60
PF06627	DUF1153	3.60
PF02900	LigB	2.70
PF04519	Bactofilin	2.70
PF07690	MFS_1	1.80
PF08241	Methyltransf_11	1.80
PF01610	DDE_Tnp_ISL3	1.80
PF07542	ATP12	1.80
PF13419	HAD_2	0.90
PF01464	SLT	0.90
PF13193	AMP-binding_C	0.90
PF00006	ATP-synt_ab	0.90
PF02738	MoCoBD_1	0.90
PF09297	zf-NADH-PPase	0.90
PF13358	DDE_3	0.90
PF09356	Phage_BR0599	0.90
PF07746	LigA	0.90
PF13467	RHH_4	0.90
PF12146	Hydrolase_4	0.90
PF14696	Glyoxalase_5	0.90
PF02371	Transposase_20	0.90
PF13472	Lipase_GDSL_2	0.90
PF05598	DUF772	0.90
PF13610	DDE_Tnp_IS240	0.90
PF01569	PAP2	0.90
PF14690	zf-ISL3	0.90
PF13356	Arm-DNA-bind_3	0.90

COG ID	Name	Functional Category	% Frequency in 111 Family Scaffolds
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	8.11
COG1664	Cytoskeletal protein CcmA, bactofilin family	Cytoskeleton [Z]	2.70
COG3464	Transposase	Mobilome: prophages, transposons [X]	1.80
COG5387	Mitochondrial FoF1-type ATP synthase assembly chaperone ATP12	Posttranslational modification, protein turnover, chaperones [O]	1.80
COG0272	NAD-dependent DNA ligase	Replication, recombination and repair [L]	0.90
COG2816	NADH pyrophosphatase NudC, Nudix superfamily	Nucleotide transport and metabolism [F]	0.90
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.90

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	70.27 %
Unclassified	root	N/A	29.73 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	70.27 %
Unclassified	root	N/A	29.73 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	70.27 %
Unclassified	root	N/A	29.73 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	63.06 %
Unclassified	root	N/A	29.73 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	50.45 %
Unclassified	root	N/A	29.73 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.70 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.73 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	28.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9.91 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2.70 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.73 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	27.93 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	6.31 %
Oxalobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae	1.80 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.90 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.90 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	0.90 %
Alphaproteobacteria bacterium MarineAlpha4_Bin1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.73 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	27.93 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	4.50 %
unclassified Oxalobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae	1.80 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.90 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.90 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.90 %
Alphaproteobacteria bacterium MarineAlpha4_Bin1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1	0.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	29.73 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	27.93 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	4.50 %
Oxalobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium	1.80 %
pseudomallei group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	0.90 %
Rhodospirillales bacterium URHD0088	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	0.90 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.90 %
Alphaproteobacteria bacterium MarineAlpha4_Bin1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1	0.90 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_101714705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1892	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_105723757	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1359	Open in IMG/M
3300001661\|JGI12053J15887_10016597	All Organisms → cellular organisms → Bacteria	4094	Open in IMG/M
3300001661\|JGI12053J15887_10040994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2600	Open in IMG/M
3300001661\|JGI12053J15887_10083306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1757	Open in IMG/M
3300001661\|JGI12053J15887_10138504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1288	Open in IMG/M
3300005435\|Ga0070714_100858502	All Organisms → cellular organisms → Bacteria → Proteobacteria	880	Open in IMG/M
3300005451\|Ga0066681_10981515	Not Available	504	Open in IMG/M
3300005454\|Ga0066687_10327649	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	873	Open in IMG/M
3300005467\|Ga0070706_100243141	All Organisms → cellular organisms → Bacteria → Proteobacteria	1680	Open in IMG/M
3300005467\|Ga0070706_100752928	Not Available	902	Open in IMG/M
3300005468\|Ga0070707_101613687	Not Available	616	Open in IMG/M
3300005471\|Ga0070698_101216701	Not Available	703	Open in IMG/M
3300005536\|Ga0070697_102141685	Not Available	501	Open in IMG/M
3300005561\|Ga0066699_10619858	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	777	Open in IMG/M
3300005564\|Ga0070664_101041013	Not Available	770	Open in IMG/M
3300005564\|Ga0070664_101754376	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	589	Open in IMG/M
3300005598\|Ga0066706_10670180	All Organisms → cellular organisms → Bacteria → Proteobacteria	824	Open in IMG/M
3300005614\|Ga0068856_100806182	All Organisms → cellular organisms → Bacteria → Proteobacteria	958	Open in IMG/M
3300005614\|Ga0068856_100889175	Not Available	910	Open in IMG/M
3300005764\|Ga0066903_100770578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1713	Open in IMG/M
3300005921\|Ga0070766_10779514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium	650	Open in IMG/M
3300006032\|Ga0066696_10997676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	533	Open in IMG/M
3300006755\|Ga0079222_10073359	All Organisms → cellular organisms → Bacteria → Proteobacteria	1694	Open in IMG/M
3300006797\|Ga0066659_10391265	All Organisms → cellular organisms → Bacteria	1091	Open in IMG/M
3300006800\|Ga0066660_10607507	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	913	Open in IMG/M
3300006903\|Ga0075426_10323369	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1130	Open in IMG/M
3300006954\|Ga0079219_10294183	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1001	Open in IMG/M
3300007255\|Ga0099791_10424576	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	641	Open in IMG/M
3300007788\|Ga0099795_10097411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	1149	Open in IMG/M
3300007788\|Ga0099795_10259770	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	752	Open in IMG/M
3300007788\|Ga0099795_10570128	Not Available	536	Open in IMG/M
3300009012\|Ga0066710_100552358	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1742	Open in IMG/M
3300009088\|Ga0099830_10854691	All Organisms → cellular organisms → Bacteria	752	Open in IMG/M
3300009093\|Ga0105240_11312281	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	763	Open in IMG/M
3300010048\|Ga0126373_10234364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1798	Open in IMG/M
3300010159\|Ga0099796_10018045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	2112	Open in IMG/M
3300010366\|Ga0126379_10455428	All Organisms → cellular organisms → Bacteria → Proteobacteria	1342	Open in IMG/M
3300010366\|Ga0126379_12310396	All Organisms → cellular organisms → Bacteria → Proteobacteria	638	Open in IMG/M
3300010373\|Ga0134128_10291094	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1830	Open in IMG/M
3300010396\|Ga0134126_11451521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	757	Open in IMG/M
3300010397\|Ga0134124_12415802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	567	Open in IMG/M
3300011269\|Ga0137392_10222838	Not Available	1548	Open in IMG/M
3300011269\|Ga0137392_10685870	Not Available	848	Open in IMG/M
3300011270\|Ga0137391_10068999	All Organisms → cellular organisms → Bacteria → Proteobacteria	3034	Open in IMG/M
3300011270\|Ga0137391_10427555	Not Available	1129	Open in IMG/M
3300012198\|Ga0137364_10428222	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	992	Open in IMG/M
3300012200\|Ga0137382_10085606	Not Available	2052	Open in IMG/M
3300012200\|Ga0137382_10520771	Not Available	846	Open in IMG/M
3300012202\|Ga0137363_10220101	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1531	Open in IMG/M
3300012203\|Ga0137399_10600347	Not Available	925	Open in IMG/M
3300012204\|Ga0137374_10364295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1161	Open in IMG/M
3300012208\|Ga0137376_10138003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2092	Open in IMG/M
3300012211\|Ga0137377_11868191	Not Available	519	Open in IMG/M
3300012360\|Ga0137375_10148196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2297	Open in IMG/M
3300012362\|Ga0137361_10182857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1890	Open in IMG/M
3300012362\|Ga0137361_10409912	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1245	Open in IMG/M
3300012362\|Ga0137361_11682344	Not Available	554	Open in IMG/M
3300012582\|Ga0137358_10105666	All Organisms → cellular organisms → Bacteria → Proteobacteria	1908	Open in IMG/M
3300012582\|Ga0137358_10202079	Not Available	1356	Open in IMG/M
3300012917\|Ga0137395_10225427	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1311	Open in IMG/M
3300012923\|Ga0137359_10493518	Not Available	1081	Open in IMG/M
3300012923\|Ga0137359_11072468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → unclassified Oxalobacteraceae → Oxalobacteraceae bacterium	690	Open in IMG/M
3300012925\|Ga0137419_10118212	All Organisms → cellular organisms → Bacteria	1866	Open in IMG/M
3300012960\|Ga0164301_10707775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	759	Open in IMG/M
3300012971\|Ga0126369_10312565	All Organisms → cellular organisms → Bacteria → Proteobacteria	1577	Open in IMG/M
3300012989\|Ga0164305_10944268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	728	Open in IMG/M
3300013100\|Ga0157373_11403579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	531	Open in IMG/M
3300015054\|Ga0137420_1069334	Not Available	955	Open in IMG/M
3300015242\|Ga0137412_10460935	All Organisms → cellular organisms → Bacteria	977	Open in IMG/M
3300018482\|Ga0066669_11726247	Not Available	576	Open in IMG/M
3300019888\|Ga0193751_1106699	Not Available	1068	Open in IMG/M
3300020583\|Ga0210401_10073432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	3221	Open in IMG/M
3300021170\|Ga0210400_10001257	All Organisms → cellular organisms → Bacteria	25432	Open in IMG/M
3300021170\|Ga0210400_10005586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	10652	Open in IMG/M
3300021170\|Ga0210400_10081148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium MarineAlpha4_Bin1	2548	Open in IMG/M
3300021560\|Ga0126371_11165931	Not Available	908	Open in IMG/M
3300024347\|Ga0179591_1055820	All Organisms → cellular organisms → Bacteria	3486	Open in IMG/M
3300025910\|Ga0207684_10281138	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1435	Open in IMG/M
3300025922\|Ga0207646_10012877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	8017	Open in IMG/M
3300025922\|Ga0207646_10042088	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	4105	Open in IMG/M
3300025922\|Ga0207646_10210623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1755	Open in IMG/M
3300026078\|Ga0207702_10625547	Not Available	1058	Open in IMG/M
3300026078\|Ga0207702_11151928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	769	Open in IMG/M
3300026374\|Ga0257146_1040446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	756	Open in IMG/M
3300026490\|Ga0257153_1020069	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1365	Open in IMG/M
3300026490\|Ga0257153_1105305	Not Available	558	Open in IMG/M
3300026508\|Ga0257161_1075296	Not Available	694	Open in IMG/M
3300026514\|Ga0257168_1136778	Not Available	546	Open in IMG/M
3300026538\|Ga0209056_10681984	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	519	Open in IMG/M
3300026557\|Ga0179587_10117783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1626	Open in IMG/M
3300027181\|Ga0208997_1050290	Not Available	620	Open in IMG/M
3300027381\|Ga0208983_1022908	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1219	Open in IMG/M
3300027383\|Ga0209213_1008998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1791	Open in IMG/M
3300027480\|Ga0208993_1074057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	620	Open in IMG/M
3300027546\|Ga0208984_1014606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1541	Open in IMG/M
3300027583\|Ga0209527_1091623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088	682	Open in IMG/M
3300027605\|Ga0209329_1009162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1850	Open in IMG/M
3300027616\|Ga0209106_1108263	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	624	Open in IMG/M
3300027633\|Ga0208988_1048515	Not Available	1084	Open in IMG/M
3300027669\|Ga0208981_1022209	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1616	Open in IMG/M
3300027681\|Ga0208991_1054839	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1204	Open in IMG/M
3300027738\|Ga0208989_10112700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	924	Open in IMG/M
3300027903\|Ga0209488_10040282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3422	Open in IMG/M
3300027903\|Ga0209488_10070973	All Organisms → cellular organisms → Bacteria	2582	Open in IMG/M
3300028047\|Ga0209526_10118841	Not Available	1857	Open in IMG/M
3300028536\|Ga0137415_11366911	Not Available	529	Open in IMG/M
3300028536\|Ga0137415_11483833	All Organisms → cellular organisms → Bacteria → Proteobacteria	503	Open in IMG/M
3300030839\|Ga0073999_10058375	Not Available	623	Open in IMG/M
3300030991\|Ga0073994_12119553	Not Available	522	Open in IMG/M
3300031047\|Ga0073995_10095414	Not Available	662	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.89%
Host-Associated	Host-Associated	8.11%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	91.89%
Plants	Host-Associated → Plants	8.11%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	91.89%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	3.60%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	65.77%
Loam	Environmental → Terrestrial → Soil → Loam	26.13%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	3.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.70%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.80%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	42.34%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	17.12%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.81%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	10.81%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	9.01%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	3.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.70%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.80%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	32.43%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	15.32%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	9.01%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	8.11%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.50%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.70%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.70%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.80%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.80%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.90%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.90%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.90%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.90%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.90%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental	Open in IMG/M
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012211	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental	Open in IMG/M
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026374	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-A	Environmental	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300026508	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A	Environmental	Open in IMG/M
3300026514	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027181	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes)	Environmental	Open in IMG/M
3300027381	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)	Environmental	Open in IMG/M
3300027383	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)	Environmental	Open in IMG/M
3300027480	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)	Environmental	Open in IMG/M
3300027546	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)	Environmental	Open in IMG/M
3300027583	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027605	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes)	Environmental	Open in IMG/M
3300027616	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)	Environmental	Open in IMG/M
3300027633	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)	Environmental	Open in IMG/M
3300027669	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes)	Environmental	Open in IMG/M
3300027681	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027738	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300030839	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil TCEFB (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300030991	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031047	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_1017147053	3300000364	Soil	MSKLWFVLLFIAGLALSGCPGPNYAPYDNMTGGYG*
INPhiseqgaiiFebDRAFT_1057237572	3300000364	Soil	MSALRLVLLFVATVALSGALMGVLTGCPGPNYAPYDNMNNNSPG*
JGI12053J15887_100165975	3300001661	Forest Soil	ALRFVLLFVVTLALMGCPGPNYAPYDNMNNNSPG*
JGI12053J15887_100409944	3300001661	Forest Soil	MMSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG*
JGI12053J15887_100833062	3300001661	Forest Soil	MNDRLTAALRFVLLFVVTLALMGCPGPNYAPYDNMNNNSPG*
JGI12053J15887_101385042	3300001661	Forest Soil	MSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNSPG*
Ga0070714_1008585022	3300005435	Agricultural Soil	MRRASMLIGLRFVLLLLAVLMLAGCPGPNYAPYDNMTNSPGVG*
Ga0066681_109815151	3300005451	Soil	MDAGKGAADGRAETILLLVVTLTLTGCPGPHYAPYDNMNNNSPG*
Ga0066687_103276492	3300005454	Soil	AKLAMLIAARFALLLVSVLALTGCPGPNYAPYDNMTNSPGVG*
Ga0070706_1002431412	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRLVLLFVATVALAGALMGTLTGCPGPDYAPYDNMNNNSPG*
Ga0070706_1007529282	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRLVLLFVATVALSGALTGCPGPDYAPYDNMNNNSPG*
Ga0070707_1016136871	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRLVLLFVATVALAGALMGVLTGCPGPDYAPYDNMNNNSPG*
Ga0070698_1012167012	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRLVLLFVATVALAGALMGTLTGCPGPDYAPYDNMNNNSP
Ga0070697_1021416852	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRLVLLFVATVALSGALMGTLTGCPGPDYARYDNMNNNSPN*
Ga0066699_106198582	3300005561	Soil	MAAFRLVLLFVAALALTGCAGPNYAPYDNMRNSYG*
Ga0070664_1010410131	3300005564	Corn Rhizosphere	MGAYLPMSLRFVLLLIAVLALTGCPGPNYAPDDNMRNSYG*
Ga0070664_1017543761	3300005564	Corn Rhizosphere	MLIALRFALLFVAVLMLAGCPGPNYAPYDNMTNSPGVG*
Ga0066706_106701802	3300005598	Soil	MLTGLRLVFLLTAMLTLTGCPGPNYAPYNNMRNSSE*
Ga0068856_1008061822	3300005614	Corn Rhizosphere	MLIALRFVLLLLAVLMLAGCPGPNYAPYDNMTNSPGVG*
Ga0068856_1008891753	3300005614	Corn Rhizosphere	MSLRFVLLLIAVLALTGCPGPNYAPYDNMRNSYG*
Ga0066903_1007705783	3300005764	Tropical Forest Soil	MICALRLVLLFVAMLAVTGCPGPNYAPYNNMKNSYG*
Ga0070766_107795141	3300005921	Soil	MAALRLVLLFVAVLALTGCAGPNYAPYDNMTNSYG*
Ga0066696_109976762	3300006032	Soil	AMALRFVLLLVAMVALAGCPGANYAPYDNMRNSSA*
Ga0079222_100733593	3300006755	Agricultural Soil	MDEVADKPPMLTALRFVLLFVAVLMLAGCPGPNYAPYDNMTNSPGVG*
Ga0066659_103912653	3300006797	Soil	MAALRLVVLFVAALALTGCPGPNYAPYDNMRNSYG*
Ga0066660_106075072	3300006800	Soil	MAALRLVLLFVAALALTGCPGPNYAPYDNMRNSYG*
Ga0075426_103233693	3300006903	Populus Rhizosphere	MLALRFVLLFVAVLMLAACPGPNYAPYDNMTNSPGVG*
Ga0079219_102941832	3300006954	Agricultural Soil	MSLRFVLLLIAMLALTGCPGPNYAPYDNMRNSYG*
Ga0099791_104245762	3300007255	Vadose Zone Soil	MAALRLVVLFVAALALTGCAGPNYAPYDNMRNSYG*
Ga0099795_100974111	3300007788	Vadose Zone Soil	MMSALRHVLLFVVALTLTGCPGPNYAPYDNMNNNSPG*
Ga0099795_102597702	3300007788	Vadose Zone Soil	MMSALRHVLLFVVALMLTGCPGPNYAPYDHMTNSYG*
Ga0099795_105701282	3300007788	Vadose Zone Soil	MTLRLVLLFVVTLSLTGCPGPNYAPYDNMTGGYG*
Ga0066710_1005523582	3300009012	Grasslands Soil	MAALRLVLLFVATLALTGCPGPNYAPYDNMRNSYG
Ga0099830_108546911	3300009088	Vadose Zone Soil	MMAALRLVLLFVVALALTGCPGPQYAPYDNMKNSYG*
Ga0105240_113122813	3300009093	Corn Rhizosphere	MLIGLRFVLLLLAVLMLAGCPGPNYAPYDNMTNSPGVG*
Ga0126373_102343643	3300010048	Tropical Forest Soil	MIWGLRFVLLFVALLALTGCPGRNYAPYDNMTNSYG*
Ga0099796_100180454	3300010159	Vadose Zone Soil	MMSALRHVLLFVVALMLTGCPGPNYAPYDNMNNNSPG*
Ga0126379_104554282	3300010366	Tropical Forest Soil	MIWGLRFVLLFIALLALMGCPGPNYAPYDNMTNSYG*
Ga0126379_123103961	3300010366	Tropical Forest Soil	SLSDFGVMSVLRFVFLLLATLMLTGCPGPTYAPYDNMTNSYG*
Ga0134128_102910943	3300010373	Terrestrial Soil	MSALRLVVLFLAVRALTGCPGPKYAPKDNMTNSYG*
Ga0134126_114515211	3300010396	Terrestrial Soil	PMLALRCILLFLAMLMLAGCPGPNYAPYDNMTNSPGVG*
Ga0134124_124158021	3300010397	Terrestrial Soil	MLALRFVLLFVAVLMLAACPGPNYAPYDNMTNSAGVG*
Ga0137392_102228382	3300011269	Vadose Zone Soil	MMAALRVVLLFVVALALTGCPGPNYAPYDNMTNSPG*
Ga0137392_106858702	3300011269	Vadose Zone Soil	TELNGRSMMAALRLVLLFVVALALTGCPGPQYAPYDNMKNSYG*
Ga0137391_100689991	3300011270	Vadose Zone Soil	KRGISLQAEVMMAALRLVVLFVMALALTGCPGPNYAPYDNMTNSPG*
Ga0137391_104275551	3300011270	Vadose Zone Soil	MMAALRLDLLFVVALALTGCPGPQYAPYDNMKNSYG*
Ga0137364_104282222	3300012198	Vadose Zone Soil	MAALRLILLFVVMLALTGCPGPHYAPYDNMNNNSPG*
Ga0137382_100856063	3300012200	Vadose Zone Soil	MAALRLVLLFVAALALTGCAGPNYAPYDNMRNSYG*
Ga0137382_105207712	3300012200	Vadose Zone Soil	LMAALRLILLFVVTLTLTGCPGPHYAPYDNMNNNSPG*
Ga0137363_102201012	3300012202	Vadose Zone Soil	MAALRLILLFVVTLMLTGCPGPHYAPYDNMNNNSPG*
Ga0137399_106003472	3300012203	Vadose Zone Soil	MAALRLILLFVVTLTLTGCPGPHYAPYDNMNNNSPG*
Ga0137374_103642953	3300012204	Vadose Zone Soil	MTTALKLVVLLVVALTLTGCAGPGYAPYDNLKNSYG*
Ga0137376_101380031	3300012208	Vadose Zone Soil	CPAEAMMSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG*
Ga0137377_118681912	3300012211	Vadose Zone Soil	RRWTPAREALMAALRLILLFVVMLALTGCPGPHYAPYDNMNNNSPG*
Ga0137375_101481963	3300012360	Vadose Zone Soil	MTTALKLVVLFVVALTLTGCAGPGYAPYDNLKNSYG*
Ga0137361_101828572	3300012362	Vadose Zone Soil	MTALRLVLLLVVALALTGCAGPNYAPYDNMRNSYG*
Ga0137361_104099121	3300012362	Vadose Zone Soil	RRAGEEEAEATMSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNSPG*
Ga0137361_116823441	3300012362	Vadose Zone Soil	MMSALRLVLLFIVTLALTGCPGPDYAPYDNMNNNSPG*
Ga0137358_101056662	3300012582	Vadose Zone Soil	MAALRLMLLFIVALGLMGCPGPQYAPYNNMTNSKG*
Ga0137358_102020793	3300012582	Vadose Zone Soil	MMSALRHVLLFLVALMLTGCPGPNYAPYDHMTNSYG*
Ga0137395_102254272	3300012917	Vadose Zone Soil	MMSALRHVLLFVVTLMLTGCPGPNYAPYDHMTNSYG*
Ga0137359_104935182	3300012923	Vadose Zone Soil	MKVLRLVLLFVVTLALTGCPGPNYAPYDNMTNGYG*
Ga0137359_110724681	3300012923	Vadose Zone Soil	MAALRLVLLLVVALALTGCAGPNYAPYDNMNNNSPG*
Ga0137419_101182122	3300012925	Vadose Zone Soil	MIPKLCLVLLFVATLALMGCPGPNYAPYDNMNNNSPG*
Ga0164301_107077751	3300012960	Soil	MDKLAAKLAMLIAVRFALLLVSVLALTRCPGPNYAPYDNMTNSPGVG*
Ga0126369_103125652	3300012971	Tropical Forest Soil	MIWGLRFVLLFVALLALTGCPGRNYAPYDNMTNSYE*
Ga0164305_109442682	3300012989	Soil	MDKVAAKAAMLTALRFVFLLTAMLTLTGCPGPNYAPYDNMTNSPGVG*
Ga0157373_114035792	3300013100	Corn Rhizosphere	MSALRLVVLFVAVLALTGCPGPNYAPYNNMTNSYG*
Ga0137420_10693341	3300015054	Vadose Zone Soil	MMSALRHVLLFLVALMLTGCPGPNYAPYDNMNNNSPG*
Ga0137412_104609352	3300015242	Vadose Zone Soil	MIPKLCLVLLFVVTLALMGCPGPNYAPYDNMNNNSPG*
Ga0066669_117262471	3300018482	Grasslands Soil	MAALRLILLLVVTLTLTGCPGPHYAPYDNMNNNSPG
Ga0193751_11066991	3300019888	Soil	MMPALRLVLLFVVTLALTGCPGPQYAPYDNMTNSYG
Ga0210401_100734323	3300020583	Soil	MAALRLVLLLVAVLTLTGCAGPNYAPYDNMTNSYG
Ga0210400_1000125713	3300021170	Soil	MSALRLVLLFVVSLALTGCPGPNYAPYDNMNNNSPG
Ga0210400_100055868	3300021170	Soil	MSALRHVLLFVVALALTGCPGPNYAPYDNMTGGYG
Ga0210400_100811484	3300021170	Soil	MISALRLVLLFIVTLALTGCPGPDYAPYDNMNNNSPG
Ga0126371_111659312	3300021560	Tropical Forest Soil	MIWGLRFVLLFVALLALTGCPGRNYAPYDNMTNSYG
Ga0179591_10558201	3300024347	Vadose Zone Soil	MIPKLCLVLLFVVTLALTGCPGPNYAPYDNMNNNSPG
Ga0207684_102811382	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRLVLLFVATVALAGALMGTLTGCPGPDYAPYDNMNNNSPG
Ga0207646_1001287711	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRLVLLFVATVALSGALMGTLTGCPGPDYAPYDNMNNNSPN
Ga0207646_100420882	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MPRLWLVLLFIAGLALSGCPGPNYAPYDNMTGGYG
Ga0207646_102106233	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MSALRHVLLFVVVLSLTGCPGPNYAPYDNMNNNSPG
Ga0207702_106255472	3300026078	Corn Rhizosphere	MSSLRIVMLFVVILALTGCPGPNYAPYNNMGNSYG
Ga0207702_111519281	3300026078	Corn Rhizosphere	MSALRLVVLFLAVRALTGCPGPKYAPKDNITNNYK
Ga0257146_10404463	3300026374	Soil	MMSALRHVLLFVVALTLTGCPGPNYAPYDHMTNSYG
Ga0257153_10200692	3300026490	Soil	MSALRFALLFVVTLALTGALIGALTGCPGPNYAPYDNMNNNSPG
Ga0257153_11053052	3300026490	Soil	MMTGLRLVMLFVMALALTGCPGPNYAPYDHMTNSYG
Ga0257161_10752962	3300026508	Soil	MSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNSPG
Ga0257168_11367781	3300026514	Soil	MMSALRHVLLFVVTLTLTGCPGPNYAPYDNMNNNSPG
Ga0209056_106819842	3300026538	Soil	MAALRLVVLFVAALALTGCPGPNYAPYDNMRNSYG
Ga0179587_101177834	3300026557	Vadose Zone Soil	MMSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG
Ga0208997_10502901	3300027181	Forest Soil	MMSTLRHVLLFVVALMLTGCPGPNYAPYDHMTNSYG
Ga0208983_10229082	3300027381	Forest Soil	MNDRLIAALRFVLLLVVTLALTGCPGPNYAPYDNMNNNSPG
Ga0209213_10089983	3300027383	Forest Soil	MSALRHVLLFLVALMLTGCPGPNYAPYDNMNNNSPG
Ga0208993_10740571	3300027480	Forest Soil	MNDRLIAALRFVLLLVVTLALTGCPGPNYAPYDNMK
Ga0208984_10146062	3300027546	Forest Soil	MMSALRHVLLFLVALMLTGCPGPNYAPYDNMNNNSPG
Ga0209527_10916232	3300027583	Forest Soil	MAMVPALRLVLLFVVTLALTGCPGPQYAPYDNMTNSYG
Ga0209329_10091621	3300027605	Forest Soil	MMSALRHVLLFVVALMLTGCPGPNYAPYDNMTNSYG
Ga0209106_11082633	3300027616	Forest Soil	MMSALRHVLLFLVALMLTGCPGPNYAPYDHMTNSYG
Ga0208988_10485152	3300027633	Forest Soil	MIPKLCLVLLFVVTLALMGCPGPNYAPYDNMNNNSPG
Ga0208981_10222093	3300027669	Forest Soil	MSALRHVLLFVVALMLTGCPGPNYAPYDNMNNNSPG
Ga0208991_10548393	3300027681	Forest Soil	MNDRLTAALRFVLLFVVTLALMGCPGPNYAPYDNMNNNSPG
Ga0208989_101127002	3300027738	Forest Soil	MMSALRHVLLFVVALMLTGCPGPNYAPYDNMNNNSPG
Ga0209488_100402822	3300027903	Vadose Zone Soil	MSALRHVLLFVVALMLTGCPGRNYAPYDHMTNSYG
Ga0209488_100709736	3300027903	Vadose Zone Soil	MKVLRLVLLFVVTLALTGCPGPNYAPYDNMTNGYG
Ga0209526_101188412	3300028047	Forest Soil	MAALRLVLLFVAALALAGCPGPGYAPYDNMTNSYG
Ga0137415_113669112	3300028536	Vadose Zone Soil	MAALRLILLFVVTLTLTGCPGPHYAPYDNMNNNSPG
Ga0137415_114838332	3300028536	Vadose Zone Soil	MAALRLVLLLVVALALTGCAGPNYAPYDNMRNSYG
Ga0073999_100583753	3300030839	Soil	MMSALRHVLLFVVTLMLTGCPGPNYAPYDHMTNSYA
Ga0073994_121195531	3300030991	Soil	MSTLRLVLLFVVSLALIGALTGCPGPNYAPYDNMNNNS
Ga0073995_100954141	3300031047	Soil	MMSALRHVLLFVVALTLTGCPGPNYAPYDNMNNNSPG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F085532

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences