| Basic Information | |
|---|---|
| Family ID | F085498 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 48 residues |
| Representative Sequence | GGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRVRMLAGR |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.79 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.099 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (12.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.946 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (72.072 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 7.79% Coil/Unstructured: 92.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13594 | Obsolete Pfam Family | 11.71 |
| PF01979 | Amidohydro_1 | 8.11 |
| PF13147 | Obsolete Pfam Family | 7.21 |
| PF00293 | NUDIX | 2.70 |
| PF13520 | AA_permease_2 | 1.80 |
| PF01593 | Amino_oxidase | 0.90 |
| PF00510 | COX3 | 0.90 |
| PF06452 | CBM9_1 | 0.90 |
| PF06964 | Alpha-L-AF_C | 0.90 |
| PF13229 | Beta_helix | 0.90 |
| PF13450 | NAD_binding_8 | 0.90 |
| PF07969 | Amidohydro_3 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 0.90 |
| COG3534 | Alpha-L-arabinofuranosidase | Carbohydrate transport and metabolism [G] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.10 % |
| Unclassified | root | N/A | 0.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_483301 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300000559|F14TC_108773112 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300000891|JGI10214J12806_11193339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 511 | Open in IMG/M |
| 3300000955|JGI1027J12803_102758065 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300004156|Ga0062589_102703561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 516 | Open in IMG/M |
| 3300004479|Ga0062595_100741602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 797 | Open in IMG/M |
| 3300004480|Ga0062592_102504026 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300004643|Ga0062591_101147140 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005290|Ga0065712_10025833 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300005293|Ga0065715_10102156 | All Organisms → cellular organisms → Bacteria | 3110 | Open in IMG/M |
| 3300005293|Ga0065715_10749638 | Not Available | 617 | Open in IMG/M |
| 3300005294|Ga0065705_10069661 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005294|Ga0065705_10409222 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005336|Ga0070680_100966233 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300005336|Ga0070680_101811677 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005340|Ga0070689_100217570 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300005356|Ga0070674_101500266 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300005438|Ga0070701_11069414 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005440|Ga0070705_100335250 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005444|Ga0070694_101079473 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 669 | Open in IMG/M |
| 3300005468|Ga0070707_101956063 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005518|Ga0070699_101570653 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005545|Ga0070695_101504211 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300005577|Ga0068857_100783634 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300005577|Ga0068857_101279788 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005614|Ga0068856_100484401 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300005617|Ga0068859_100958625 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005618|Ga0068864_101664985 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005834|Ga0068851_10626244 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300005841|Ga0068863_102269466 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300005841|Ga0068863_102375919 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005843|Ga0068860_100044661 | All Organisms → cellular organisms → Bacteria | 4223 | Open in IMG/M |
| 3300005843|Ga0068860_100089737 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2927 | Open in IMG/M |
| 3300005843|Ga0068860_100776716 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005844|Ga0068862_101074682 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005983|Ga0081540_1238682 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300006034|Ga0066656_10095846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1794 | Open in IMG/M |
| 3300006791|Ga0066653_10071986 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300006804|Ga0079221_11436757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300006845|Ga0075421_101859495 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300006852|Ga0075433_10324457 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300006852|Ga0075433_10517756 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300006852|Ga0075433_10836592 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300006880|Ga0075429_100219877 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300006880|Ga0075429_101896903 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006904|Ga0075424_100790404 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300006954|Ga0079219_10142298 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300007076|Ga0075435_100519097 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300009011|Ga0105251_10283035 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300009094|Ga0111539_10768868 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300009094|Ga0111539_12393569 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009137|Ga0066709_101329432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300009148|Ga0105243_12849127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 524 | Open in IMG/M |
| 3300009156|Ga0111538_12994488 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009162|Ga0075423_10276231 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300009174|Ga0105241_10816248 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300009174|Ga0105241_11892409 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009174|Ga0105241_12090192 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300009177|Ga0105248_13261723 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009609|Ga0105347_1364426 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300010042|Ga0126314_10299573 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300010042|Ga0126314_10496118 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300010373|Ga0134128_12538700 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300010375|Ga0105239_11556785 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300010397|Ga0134124_10646649 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300010397|Ga0134124_11307508 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300010399|Ga0134127_13497749 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300010400|Ga0134122_10450451 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300010400|Ga0134122_11362350 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300011119|Ga0105246_11845209 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012046|Ga0136634_10363213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 599 | Open in IMG/M |
| 3300012198|Ga0137364_10705785 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012201|Ga0137365_10446382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300012203|Ga0137399_11410776 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012350|Ga0137372_10946657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 606 | Open in IMG/M |
| 3300012353|Ga0137367_10755193 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300012685|Ga0137397_10226564 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
| 3300012948|Ga0126375_10670449 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300012961|Ga0164302_10265617 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300013100|Ga0157373_11507701 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300013296|Ga0157374_10616067 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300013296|Ga0157374_11597625 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300013297|Ga0157378_12733512 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300013306|Ga0163162_11039168 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300013307|Ga0157372_13447885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 503 | Open in IMG/M |
| 3300014154|Ga0134075_10288046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
| 3300014325|Ga0163163_10123904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2621 | Open in IMG/M |
| 3300015262|Ga0182007_10158058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 774 | Open in IMG/M |
| 3300015372|Ga0132256_102370986 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300018054|Ga0184621_10208361 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300018482|Ga0066669_10785240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 842 | Open in IMG/M |
| 3300025900|Ga0207710_10091518 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
| 3300025927|Ga0207687_10259251 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300025930|Ga0207701_10046272 | All Organisms → cellular organisms → Bacteria | 4022 | Open in IMG/M |
| 3300025936|Ga0207670_10103492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2037 | Open in IMG/M |
| 3300025936|Ga0207670_10167296 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300025940|Ga0207691_11489134 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300025941|Ga0207711_11859596 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300025942|Ga0207689_10018127 | All Organisms → cellular organisms → Bacteria | 5945 | Open in IMG/M |
| 3300025942|Ga0207689_10059375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3146 | Open in IMG/M |
| 3300026088|Ga0207641_10710043 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300026095|Ga0207676_12127089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 559 | Open in IMG/M |
| 3300027882|Ga0209590_10873217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 568 | Open in IMG/M |
| 3300028381|Ga0268264_10177603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1931 | Open in IMG/M |
| 3300028381|Ga0268264_10461437 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
| 3300028381|Ga0268264_11993751 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300028381|Ga0268264_12309199 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300030511|Ga0268241_10122533 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032012|Ga0310902_10449446 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300032012|Ga0310902_10668967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 696 | Open in IMG/M |
| 3300032074|Ga0308173_11168370 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 12.61% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.81% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.31% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.41% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.70% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.70% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0697.00003500 | 2162886007 | Switchgrass Rhizosphere | TGGRANWRGGLFNGVPGGNFIGSANSSGVMFLPFQGEKDGRLRVRMLAPQ |
| F14TC_1087731122 | 3300000559 | Soil | AGMFIGTANDKGVLFVPFKGQKDGRLRLRMLAVL* |
| JGI10214J12806_111933392 | 3300000891 | Soil | AKYELQMTGGRANWRGGLFNGVPGGSYIGNANGSGVMYSPFKGQKDGRLRLRLLSSE* |
| JGI1027J12803_1027580651 | 3300000955 | Soil | MTGGRANWRGGLFNGVPSGTFIARANDSGVLFVPFKGEKDGRLRLRILA* |
| Ga0062589_1027035611 | 3300004156 | Soil | GGRANWRGGLFNGVPGGSYIGTANGSGVMYLPFKGQKDGRLRLRLLTSE* |
| Ga0062595_1007416021 | 3300004479 | Soil | RGGLFNGVPAGTFIATANESGVLYVPFEGQKDGRLRLRLLANR* |
| Ga0062592_1025040262 | 3300004480 | Soil | GRANWRGGLFNGVPGGIFIGTANESGVLYVPFKGQKDGRLRVRMLAGR* |
| Ga0062591_1011471401 | 3300004643 | Soil | AKYELQMTGGRANWRGGLFNGVPGGNFIGSANSSGVMYLPFQGEKDGRLRVRMLAPQ* |
| Ga0065712_100258331 | 3300005290 | Miscanthus Rhizosphere | WRGGLFNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG* |
| Ga0065715_101021563 | 3300005293 | Miscanthus Rhizosphere | GGRANWRGGLFNGVPAGTFIGTANGSGVLFIPFQGQKDGRLRLRILATN* |
| Ga0065715_107496382 | 3300005293 | Miscanthus Rhizosphere | MTGGRANWRGGLFNGVPGGTFIARANESGVLFVPFRGEKDGRLRVRMIGN* |
| Ga0065705_100696612 | 3300005294 | Switchgrass Rhizosphere | RGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN* |
| Ga0065705_104092221 | 3300005294 | Switchgrass Rhizosphere | GRANWRGGLFNGVPGGNFIGSANSSGVMYLPFQGEKDGRLRVRMLATQ* |
| Ga0070680_1009662331 | 3300005336 | Corn Rhizosphere | TGGRANWRGGLFNGVPGGNFIGSANSSGVMFLPFQGEKDGRLRVRMLAPQ* |
| Ga0070680_1018116771 | 3300005336 | Corn Rhizosphere | RANWRGGLFNGVPGGTFTGTANESGVLYVPFKGQKDGRLRLRILASR* |
| Ga0070689_1002175702 | 3300005340 | Switchgrass Rhizosphere | TGGRANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR* |
| Ga0070674_1015002661 | 3300005356 | Miscanthus Rhizosphere | PLAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL* |
| Ga0070701_110694141 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | QMTGGRANWRGGLFNGVPGGTFIAKANDSGVLFAPFKGEKDGRLRLRMLANQ* |
| Ga0070705_1003352502 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | QMTGGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRMLAGR* |
| Ga0070694_1010794731 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | HAKYELQMTGGRANWRGGLFNGVPGGNFIGTANGSGVLFIPFKGQKDGRLRVRLL* |
| Ga0070707_1019560631 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LQMTGGRANWRGGLFNGVPGGTFIAKANDSGVLFAPFKGEKDGRLRLRMLANQ* |
| Ga0070699_1015706531 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRVLATR* |
| Ga0070695_1015042112 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GRANWRGGLFNGVPGGTFIARANESGVLFVPFKGEKDGRLRVRTLAN* |
| Ga0068857_1007836342 | 3300005577 | Corn Rhizosphere | LQMTGGRANWRGGLFNGVPGGSYIATANESGVLHVPFAGQKDGRLRVRMLSR* |
| Ga0068857_1012797882 | 3300005577 | Corn Rhizosphere | ELQMTGGRANWRGGLFNGVPGGSYIGSANGSGVIYLPFKGQKDGRLRLRLLSSE* |
| Ga0068856_1004844011 | 3300005614 | Corn Rhizosphere | TGGRANWRGGLFNGVPAGTFIARANDSGVLFVPFKGEKDGRLRVRMLSN* |
| Ga0068859_1009586251 | 3300005617 | Switchgrass Rhizosphere | LAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN* |
| Ga0068864_1016649852 | 3300005618 | Switchgrass Rhizosphere | FNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG* |
| Ga0068851_106262441 | 3300005834 | Corn Rhizosphere | GGRADWRGGLFNGVPIGTFVATANESGVLYVPFKGQQDGRLRLHLLASR* |
| Ga0068863_1022694661 | 3300005841 | Switchgrass Rhizosphere | ANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR* |
| Ga0068863_1023759191 | 3300005841 | Switchgrass Rhizosphere | ANWRGGLFNGVPAGIFIATANESGVLYVPFVGQKDGRLRVRMLSRN* |
| Ga0068860_1000446611 | 3300005843 | Switchgrass Rhizosphere | QMTGGRANWRGGLFNGVPAGTFIATANDSGVLFAPFAGEKDGRLRIHMLSAN* |
| Ga0068860_1000897373 | 3300005843 | Switchgrass Rhizosphere | TGGRANWRGGLFNGVPAGTLIATANESGVLYVPFKGQKDGRLRLRLLASR* |
| Ga0068860_1007767161 | 3300005843 | Switchgrass Rhizosphere | QMTGGRANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLATR* |
| Ga0068862_1010746823 | 3300005844 | Switchgrass Rhizosphere | NWRGGLYNGVPAGTFLATANDSGVLYVPFKGQKDGRLRLRLLSDR* |
| Ga0081540_12386821 | 3300005983 | Tabebuia Heterophylla Rhizosphere | RANWRGGLFNGVPAGTFIATANYSGVLFAPFKGEKDGRLRLRLLATN* |
| Ga0066656_100958461 | 3300006034 | Soil | WRGGLFNGVPAGSYIAAANDSGNIYLPFKGQKDGRLRIRLLSSE* |
| Ga0066653_100719862 | 3300006791 | Soil | VPGGSYIGTANSSGVMYLPFKGQKDGRLRLRLLSSE* |
| Ga0079221_114367572 | 3300006804 | Agricultural Soil | KYELQMTGGRANWRGGLFNGIPVAGYISAANSSGIIYLPFKGKKDGRLRVRLLTSE* |
| Ga0075421_1018594952 | 3300006845 | Populus Rhizosphere | RANWRGGLFNGVPAGTFVGTANESGVLYVPFKGQKDGRLRLRVLATR* |
| Ga0075433_103244572 | 3300006852 | Populus Rhizosphere | YELQMTGGRANWRGGLFNGVPAGIFIGTANESGVLYVPFKGQKDGRLRLRLLAGR* |
| Ga0075433_105177562 | 3300006852 | Populus Rhizosphere | ELQMTGGRANWRGGLFNGVPGGTFIATANESGVLYVPFKGQKDGRLRLRMLTA* |
| Ga0075433_108365922 | 3300006852 | Populus Rhizosphere | MTGGRANWRGGLFNGVPGGTFIATANESGVLYVPFKGQKDGRLRLRMLTA* |
| Ga0075429_1002198772 | 3300006880 | Populus Rhizosphere | RGGLFNGVPAGTFIANANSSGVLSVPFKGQKDGRLRLRML* |
| Ga0075429_1018969031 | 3300006880 | Populus Rhizosphere | LQMTGGRANWRGGLFNGVLAGLFVANANESGVLYVPFKGQQDGRLRLRILSR* |
| Ga0075424_1007904041 | 3300006904 | Populus Rhizosphere | GRANWRGGLFNGVPAGTFIARANESGVLFVPFKGEKDGRLRVRMLGN* |
| Ga0079219_101422981 | 3300006954 | Agricultural Soil | TGGRANWRGGLFNGVPGGTFIATANESGVLYVPFKGQKDGRLRLRLLSNNRT* |
| Ga0075435_1005190971 | 3300007076 | Populus Rhizosphere | WRGGMFNGVPGGTFIGTANESGVLYAPFKGQKDGRLRLRILATP* |
| Ga0105251_102830352 | 3300009011 | Switchgrass Rhizosphere | LFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN* |
| Ga0111539_107688681 | 3300009094 | Populus Rhizosphere | VPAGTLIGTANESGVLYVPFEGRKDGRLRIRVLATR* |
| Ga0111539_123935692 | 3300009094 | Populus Rhizosphere | LFNGVPAGTFTGTANESGVLYVPFKGQKDGRLRVRMLATR* |
| Ga0066709_1013294321 | 3300009137 | Grasslands Soil | GHFEGVPAGSYVGATNDAGNIYLPLKGEKDGRLRVRLLSS* |
| Ga0105243_128491272 | 3300009148 | Miscanthus Rhizosphere | YELQMTGGRANWRGGLFNGVPAGTFIGTANESGVMYLPFKGQKDGRLRLRMLATR* |
| Ga0111538_129944881 | 3300009156 | Populus Rhizosphere | LQMTGGRANWRGGLFNGVPAGTFIGTANESGVLYVPFEGQKDGRLRIRVLATR* |
| Ga0075423_102762311 | 3300009162 | Populus Rhizosphere | AGTFIATANESGVLYVPFKGQKDGRLRLRMLGGR* |
| Ga0105241_108162482 | 3300009174 | Corn Rhizosphere | RANWRGGLFNGVPGGTFIGTANESGVLYASFKGQKDGRLRLRILATR* |
| Ga0105241_118924091 | 3300009174 | Corn Rhizosphere | QMTGGRANWRGGLFNGIPGGMFIATANGSGVLYVPFAGQKDGRLRIRMLSR* |
| Ga0105241_120901921 | 3300009174 | Corn Rhizosphere | NWRGGLFNGVPAGTLIATANESGVLYVPFKGQKDGRLRLRLLASR* |
| Ga0105248_132617232 | 3300009177 | Switchgrass Rhizosphere | GRANWRGGLFNGVPAGTFIGTANEWGVLYVPFKGQKDGRLRVRMLASR* |
| Ga0105347_13644262 | 3300009609 | Soil | AKYELQMTGGRANWRGGLFNGVPGLTYVGAANGSGVMQVAWKDQKDGRLRLRML* |
| Ga0126314_102995731 | 3300010042 | Serpentine Soil | PHAKYELQMTGGRASWRGGLFNGVPAGTFIGTANESGALYVPFKGQKDGRLRLRLLATR* |
| Ga0126314_104961181 | 3300010042 | Serpentine Soil | GGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRVRMLAGR* |
| Ga0134128_125387001 | 3300010373 | Terrestrial Soil | NWRGGLFNGVPAGTFTGTANESGVLYVPFKGQKDGRLRLRMLAIR* |
| Ga0105239_115567852 | 3300010375 | Corn Rhizosphere | RGGLFNGVPGGTFIANANESGVLYVPFKGQKDGRLRLRMLASR* |
| Ga0134124_106466492 | 3300010397 | Terrestrial Soil | RANWRGGLFNGVPAGTFIARANESGVLFVPFKGEKDGRLRVRMLGN* |
| Ga0134124_113075082 | 3300010397 | Terrestrial Soil | LFNGILAGTFIGRANDSGVLYVEFKGQKDGRLRLRMLANQ* |
| Ga0134127_134977491 | 3300010399 | Terrestrial Soil | ANWRGGLFNGVPAGTLIGTANESGVLYVPFEGQKDGRLRIRVLATR* |
| Ga0134122_104504511 | 3300010400 | Terrestrial Soil | GVPAVIFIGTANESGILYAPFKGQKDGRLRLRMLATR* |
| Ga0134122_113623501 | 3300010400 | Terrestrial Soil | QMTGGRANWRGGLFNGVPAGTFIARANESGVLFVPFKGEKDGRLRVRMLGN* |
| Ga0105246_118452091 | 3300011119 | Miscanthus Rhizosphere | AKYELQMTGGRANWRGGLFNGVPAGTSIGTANESGVLYVPFKGQKDGRLRLRVLATR* |
| Ga0136634_103632132 | 3300012046 | Polar Desert Sand | GGRASWRGGLFNGVPGDTYISAANGSGVMHLPFKGQKDGRLRLRLLSSD* |
| Ga0137364_107057852 | 3300012198 | Vadose Zone Soil | LFNGVPGGSYIGTDNSSGVIYLPFKGQKDGRLRLHILT* |
| Ga0137365_104463821 | 3300012201 | Vadose Zone Soil | YELQMTGGRANWRGGLFNGVPGGNYIGSANGSGIMYLPFKGQKDGRLRLRLLSTE* |
| Ga0137399_114107762 | 3300012203 | Vadose Zone Soil | AKYELQMTGGRANWRGGLFNGVPGGSYIGTANVSGVMHLPFKGQKDGRLRLRLLSSE* |
| Ga0137372_109466571 | 3300012350 | Vadose Zone Soil | KYELQMTGGRANWRGGLFNGVPGGSYIGTANGSGVIHLPFKGQKDGRLRLRILSSE* |
| Ga0137367_107551931 | 3300012353 | Vadose Zone Soil | RGGLFNGVPGGSYIGTANGSGVMHLPFKGQKDGRLRLRLLS* |
| Ga0137397_102265642 | 3300012685 | Vadose Zone Soil | LFNGVPGGSYIGAANSSGVMHAPFKGQKDGRLRLRLLSSE* |
| Ga0126375_106704491 | 3300012948 | Tropical Forest Soil | TGGRANWRGGLFNGVPGGTFIARANDSGVLFVPFKGEKDGRLRLRMLNN* |
| Ga0164302_102656171 | 3300012961 | Soil | RGGLFNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG* |
| Ga0157373_115077011 | 3300013100 | Corn Rhizosphere | RANWRGGLFNGVPGANYIAAANGSGVLRVSFGGQKDGRLRLRLLATN* |
| Ga0157374_106160672 | 3300013296 | Miscanthus Rhizosphere | GVPAGTFIATANDSGVLFAPFKGEKDGRLRIHMLSAN* |
| Ga0157374_115976252 | 3300013296 | Miscanthus Rhizosphere | ELQMTGGRANWRGGLFNGVPSGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG* |
| Ga0157378_127335121 | 3300013297 | Miscanthus Rhizosphere | GRANWRGGLFNGVPGGSFIARANESGVLFVPFKGEKDGRLRLRML* |
| Ga0163162_110391682 | 3300013306 | Switchgrass Rhizosphere | FNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLATR* |
| Ga0157372_134478851 | 3300013307 | Corn Rhizosphere | LAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL* |
| Ga0134075_102880461 | 3300014154 | Grasslands Soil | GVPAGSYIAAANGSGNMYLPFKGQKDGRLRVRLLSSE* |
| Ga0163163_101239043 | 3300014325 | Switchgrass Rhizosphere | ANWRGGLFNGVPGANYIAAANGSGVLRVLFGGQKDGRLRIRLLGS* |
| Ga0182007_101580581 | 3300015262 | Rhizosphere | MTGGRANWRGGLFNGVPAGTFIATANESGVLYVPFKGLKDGRLRLRLLAK* |
| Ga0132256_1023709862 | 3300015372 | Arabidopsis Rhizosphere | NGGPGGTFTGTANESGVLYVPFKGQKDGRLRLRMLAGR* |
| Ga0184621_102083612 | 3300018054 | Groundwater Sediment | GRANWRGGLFNGVPGGSYTGAANGSGVLYLPFKGEKDGRLRVRILS |
| Ga0066669_107852401 | 3300018482 | Grasslands Soil | GGLFNGVPIGTYIGDANASGVLYLPFKGRKEGRLRVRLIT |
| Ga0207710_100915182 | 3300025900 | Switchgrass Rhizosphere | GGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR |
| Ga0207687_102592513 | 3300025927 | Miscanthus Rhizosphere | LFNGVPGGMFIATANDSGVLYVPFEGQKDGRLRIRMLSR |
| Ga0207701_100462724 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL |
| Ga0207670_101034923 | 3300025936 | Switchgrass Rhizosphere | TGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRILGTN |
| Ga0207670_101672961 | 3300025936 | Switchgrass Rhizosphere | TGGRANWRGGLFNGVPGGIFIATANESGVLYVPFAGQKDGRLRIRMLGR |
| Ga0207691_114891342 | 3300025940 | Miscanthus Rhizosphere | PAGTSIGTANESGVLYVPFKGQKDGRLRVRMLASR |
| Ga0207711_118595961 | 3300025941 | Switchgrass Rhizosphere | HAKYELQMTGGRANWRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRVLATR |
| Ga0207689_100181271 | 3300025942 | Miscanthus Rhizosphere | WRGGLFNGVPAGTFIGTANESGVLYVPFKGQKDGRLRLRLLASR |
| Ga0207689_100593751 | 3300025942 | Miscanthus Rhizosphere | PYAKYELQMTGGRANWRGGLFNGVPGGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG |
| Ga0207641_107100431 | 3300026088 | Switchgrass Rhizosphere | VPAGTFIGTANESGVLYVPFKGQKDGRLRLRVLATR |
| Ga0207676_121270892 | 3300026095 | Switchgrass Rhizosphere | RGGLFNGVPSGNFIGAANGSGVLYLPFKGQKDGRLRVRMLG |
| Ga0209590_108732171 | 3300027882 | Vadose Zone Soil | QMTGGRANWRGGLFNGVPVGSYIGAANGSGIMYLPFKGQKDGRLRLRLLSSE |
| Ga0268264_101776033 | 3300028381 | Switchgrass Rhizosphere | TGGRANWRGGLFNGVPAGTLIATANESGVLYVPFKGQKDGRLRLRLLASR |
| Ga0268264_104614372 | 3300028381 | Switchgrass Rhizosphere | QMTGGRANWRGGLFNGVPAGTFIATANDSGVLFAPFAGEKDGRLRIHMLSAN |
| Ga0268264_119937512 | 3300028381 | Switchgrass Rhizosphere | LAKYELQMTGGRANWRGGLFNGVPGGTFIATANSSGVLFIPFQGQKDGRLRLRIL |
| Ga0268264_123091992 | 3300028381 | Switchgrass Rhizosphere | YELQMTGGRANWRGGLFNGVPAGTSIGTANESGVLYVPFKGQKDGRLRVRMLASR |
| Ga0268241_101225332 | 3300030511 | Soil | GGRANWRGGLFNGVPAGTFTGTANESGVLYVPFQGQKDGRLRIRMLATR |
| Ga0310902_104494462 | 3300032012 | Soil | GLFNGVPGGNFIGSANSSGVMFLPFQGEKDGRLRVRMLAPQ |
| Ga0310902_106689671 | 3300032012 | Soil | QMTGGRANWRGGLFNGVPGGSYIGTANGSGVMYLPFKGQKDGRLRLRLLTSE |
| Ga0308173_111683701 | 3300032074 | Soil | GVPAGTLIANANESGVLYVPFKGQKDGRLRLRLLAER |
| ⦗Top⦘ |