| Basic Information | |
|---|---|
| Family ID | F085494 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSQENVEIVRRGVETWNRRDLTTWLALFSSDAEIDWSRARGPLKGVYR |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.99 % |
| % of genes near scaffold ends (potentially truncated) | 97.30 % |
| % of genes from short scaffolds (< 2000 bps) | 96.40 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (81.081 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.018 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.432 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.649 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.63% β-sheet: 5.26% Coil/Unstructured: 67.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF12680 | SnoaL_2 | 30.63 |
| PF04828 | GFA | 19.82 |
| PF03466 | LysR_substrate | 2.70 |
| PF07883 | Cupin_2 | 0.90 |
| PF05067 | Mn_catalase | 0.90 |
| PF06443 | SEF14_adhesin | 0.90 |
| PF12681 | Glyoxalase_2 | 0.90 |
| PF14534 | DUF4440 | 0.90 |
| PF00296 | Bac_luciferase | 0.90 |
| PF13463 | HTH_27 | 0.90 |
| PF01638 | HxlR | 0.90 |
| PF13466 | STAS_2 | 0.90 |
| PF13545 | HTH_Crp_2 | 0.90 |
| PF01627 | Hpt | 0.90 |
| PF02837 | Glyco_hydro_2_N | 0.90 |
| PF14340 | DUF4395 | 0.90 |
| PF12802 | MarR_2 | 0.90 |
| PF13847 | Methyltransf_31 | 0.90 |
| PF00582 | Usp | 0.90 |
| PF04030 | ALO | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 19.82 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.90 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.90 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.90 |
| COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.90 |
| COG3546 | Mn-containing catalase (includes spore coat protein CotJC) | Inorganic ion transport and metabolism [P] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.78 % |
| Unclassified | root | N/A | 16.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2044078004|PVR_F548DK201D7VKV | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 519 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig96741 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig580277 | Not Available | 670 | Open in IMG/M |
| 2170459023|GZGNO2B01CC54P | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 527 | Open in IMG/M |
| 3300000559|F14TC_108295452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 521 | Open in IMG/M |
| 3300000956|JGI10216J12902_108780761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 540 | Open in IMG/M |
| 3300000956|JGI10216J12902_114293945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1193 | Open in IMG/M |
| 3300000956|JGI10216J12902_116423836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 860 | Open in IMG/M |
| 3300001990|JGI24737J22298_10092330 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
| 3300002568|C688J35102_120282962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 967 | Open in IMG/M |
| 3300004081|Ga0063454_101100487 | Not Available | 649 | Open in IMG/M |
| 3300004153|Ga0063455_100154088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1061 | Open in IMG/M |
| 3300004156|Ga0062589_100391490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 1124 | Open in IMG/M |
| 3300004157|Ga0062590_101892496 | Not Available | 615 | Open in IMG/M |
| 3300004479|Ga0062595_101353240 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 645 | Open in IMG/M |
| 3300004479|Ga0062595_101976945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 562 | Open in IMG/M |
| 3300004643|Ga0062591_101620990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. TB 26 | 653 | Open in IMG/M |
| 3300004643|Ga0062591_102163672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 578 | Open in IMG/M |
| 3300004800|Ga0058861_11716028 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005093|Ga0062594_101190992 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300005093|Ga0062594_103029821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 525 | Open in IMG/M |
| 3300005331|Ga0070670_100607801 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005457|Ga0070662_101716544 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005545|Ga0070695_100113441 | All Organisms → cellular organisms → Bacteria | 1843 | Open in IMG/M |
| 3300005546|Ga0070696_101874879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300005549|Ga0070704_102054026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300005564|Ga0070664_100279576 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300005578|Ga0068854_100257492 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300005937|Ga0081455_10847512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
| 3300005981|Ga0081538_10107780 | All Organisms → Viruses → Predicted Viral | 1378 | Open in IMG/M |
| 3300006048|Ga0075363_100412000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 795 | Open in IMG/M |
| 3300006051|Ga0075364_10851726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 621 | Open in IMG/M |
| 3300006791|Ga0066653_10265090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → unclassified Propionibacteriales → Propionibacteriales bacterium | 874 | Open in IMG/M |
| 3300006845|Ga0075421_102350962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 559 | Open in IMG/M |
| 3300006852|Ga0075433_10547935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 1017 | Open in IMG/M |
| 3300006854|Ga0075425_100156690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2611 | Open in IMG/M |
| 3300006854|Ga0075425_100871861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1030 | Open in IMG/M |
| 3300006854|Ga0075425_101444540 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006903|Ga0075426_11072624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300007076|Ga0075435_101096678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 696 | Open in IMG/M |
| 3300009090|Ga0099827_11697142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 550 | Open in IMG/M |
| 3300009098|Ga0105245_11779063 | Not Available | 669 | Open in IMG/M |
| 3300009098|Ga0105245_11924159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 645 | Open in IMG/M |
| 3300009100|Ga0075418_13025749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 512 | Open in IMG/M |
| 3300009147|Ga0114129_10049570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5899 | Open in IMG/M |
| 3300009147|Ga0114129_12382656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300009156|Ga0111538_10275077 | Not Available | 2131 | Open in IMG/M |
| 3300009176|Ga0105242_10959565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 860 | Open in IMG/M |
| 3300009177|Ga0105248_11377284 | Not Available | 798 | Open in IMG/M |
| 3300009553|Ga0105249_10574331 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300009840|Ga0126313_11615523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 540 | Open in IMG/M |
| 3300010036|Ga0126305_10135909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1517 | Open in IMG/M |
| 3300010037|Ga0126304_11277539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 503 | Open in IMG/M |
| 3300010038|Ga0126315_10242663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 1097 | Open in IMG/M |
| 3300010040|Ga0126308_10124109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1607 | Open in IMG/M |
| 3300010040|Ga0126308_10727670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 684 | Open in IMG/M |
| 3300010041|Ga0126312_10677710 | Not Available | 744 | Open in IMG/M |
| 3300010042|Ga0126314_10576725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 820 | Open in IMG/M |
| 3300010042|Ga0126314_10856672 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010371|Ga0134125_11017112 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300010371|Ga0134125_11584192 | Not Available | 713 | Open in IMG/M |
| 3300010399|Ga0134127_10861233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 959 | Open in IMG/M |
| 3300010403|Ga0134123_11640601 | Not Available | 692 | Open in IMG/M |
| 3300012198|Ga0137364_10378913 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300012198|Ga0137364_10444422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 972 | Open in IMG/M |
| 3300012198|Ga0137364_10716338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300012198|Ga0137364_11281188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 546 | Open in IMG/M |
| 3300012200|Ga0137382_10386085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 985 | Open in IMG/M |
| 3300012208|Ga0137376_10875629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 772 | Open in IMG/M |
| 3300012353|Ga0137367_11082616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300012902|Ga0157291_10212294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 620 | Open in IMG/M |
| 3300012955|Ga0164298_10831229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 664 | Open in IMG/M |
| 3300012955|Ga0164298_11118150 | Not Available | 591 | Open in IMG/M |
| 3300012955|Ga0164298_11468873 | Not Available | 531 | Open in IMG/M |
| 3300012960|Ga0164301_11714807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 525 | Open in IMG/M |
| 3300012961|Ga0164302_10171255 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300012972|Ga0134077_10558339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300012987|Ga0164307_10255617 | All Organisms → Viruses → Predicted Viral | 1225 | Open in IMG/M |
| 3300012987|Ga0164307_11275633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 613 | Open in IMG/M |
| 3300012988|Ga0164306_10827828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 748 | Open in IMG/M |
| 3300014325|Ga0163163_10034703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4888 | Open in IMG/M |
| 3300014326|Ga0157380_10156452 | All Organisms → cellular organisms → Bacteria | 1976 | Open in IMG/M |
| 3300014968|Ga0157379_11723160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 614 | Open in IMG/M |
| 3300015077|Ga0173483_10425312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 688 | Open in IMG/M |
| 3300015358|Ga0134089_10269345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 700 | Open in IMG/M |
| 3300018081|Ga0184625_10401749 | Not Available | 707 | Open in IMG/M |
| 3300018422|Ga0190265_12351635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300018481|Ga0190271_10727564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1116 | Open in IMG/M |
| 3300020022|Ga0193733_1041723 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1296 | Open in IMG/M |
| 3300024288|Ga0179589_10049343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1576 | Open in IMG/M |
| 3300025885|Ga0207653_10347375 | Not Available | 579 | Open in IMG/M |
| 3300025903|Ga0207680_10873342 | Not Available | 645 | Open in IMG/M |
| 3300025916|Ga0207663_10239683 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300025925|Ga0207650_10549598 | Not Available | 968 | Open in IMG/M |
| 3300025927|Ga0207687_11584859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 562 | Open in IMG/M |
| 3300025939|Ga0207665_10666594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300025940|Ga0207691_10810436 | Not Available | 786 | Open in IMG/M |
| 3300025961|Ga0207712_10960222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 757 | Open in IMG/M |
| 3300026089|Ga0207648_10691082 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 945 | Open in IMG/M |
| 3300026121|Ga0207683_10210676 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300028720|Ga0307317_10154584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300028784|Ga0307282_10483156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300028819|Ga0307296_10443544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
| 3300028824|Ga0307310_10578962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 570 | Open in IMG/M |
| 3300028884|Ga0307308_10327591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300028889|Ga0247827_11131434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 539 | Open in IMG/M |
| 3300031099|Ga0308181_1093881 | Not Available | 639 | Open in IMG/M |
| 3300031114|Ga0308187_10468649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae | 512 | Open in IMG/M |
| 3300032180|Ga0307471_103141801 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 586 | Open in IMG/M |
| 3300033004|Ga0335084_11364297 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300033551|Ga0247830_11371827 | Not Available | 565 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.02% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.11% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 8.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 7.21% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.70% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.80% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.90% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.90% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Switchgrass, Maize And Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere | 0.90% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2044078004 | Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL | Host-Associated | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2170459023 | Grass soil microbial communities from Rothamsted Park, UK - FA3 (control condition) | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| PVR_723810 | 2044078004 | Switchgrass, Maize And Miscanthus Rhizosphere | MSQENVEVVRRATEAWNRRDWITLSALWRSDGVLDWSRARGPFKGVYRGEGER |
| A5_c1_01340970 | 2124908044 | Soil | MSKENVEVVQRGIETWNRRDLTTWLALFSSDAEIDWTH |
| KansclcFeb2_03105150 | 2124908045 | Soil | MSEENVEAVRRHTEAWNRRDLTTWLALSSSDAEIDWSRSRGPLKGVYRGHGELEAFWDAF |
| FA3_08988160 | 2170459023 | Grass Soil | MSGENVEIVRRHVEAWNRRDLKTWLATFRSDAEIDWS |
| F14TC_1082954521 | 3300000559 | Soil | MSQENAEVARRHQEAWNRRDLRTWLDLYRSDAEIDWSRAR |
| JGI10216J12902_1087807611 | 3300000956 | Soil | MSQENVEIVRRHTEAFNRRDLRTWLALFRSDAEIDWSRA |
| JGI10216J12902_1142939454 | 3300000956 | Soil | MSQENVETVRRHNEAWNRRDLTTWLASFSSGGEIDWSRSR |
| JGI10216J12902_1164238361 | 3300000956 | Soil | MSQENVEVVRRHTEAFNRRDLRTWLALFRSDAEIDWSRA |
| JGI24737J22298_100923302 | 3300001990 | Corn Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGH |
| C688J35102_1202829623 | 3300002568 | Soil | MSRENVEVVRRNQEAWNRRDLRTWLASFRCDAEIDWSRARGPFKGVY |
| Ga0063454_1011004872 | 3300004081 | Soil | MSQENVEVVRSHLEAWNRRDKAAYVASFRSDAEIDWSRARALYSGVYRGR |
| Ga0063455_1001540881 | 3300004153 | Soil | MSQENVEIVRRGVETWNRRDLTTWLALFSSDAEIDWSRARGPLKGVYR |
| Ga0062589_1003914902 | 3300004156 | Soil | MSHENVEVAQRNQDAWNRRDLTTWLATFRSDAEIDWSRARGLFRGVYRGPQEHRV |
| Ga0062590_1018924961 | 3300004157 | Soil | MSQENVEVVLRGIDAYNRRDWITESAVWRSDGVIDWSRAQGPLK |
| Ga0062595_1013532401 | 3300004479 | Soil | MSQENVEIIRRHVKAWNRRDLGAWLALFASEAEIDWSRSRGPLKGVYRGH |
| Ga0062595_1019769451 | 3300004479 | Soil | MSQENVELVRRGVETWNRRDLTTWLALFSSDAEIDWSRARGPL |
| Ga0062591_1016209901 | 3300004643 | Soil | MSQENVEVVRRGIEAFNRRDLKTWLTTFRSDAEIDWSRARGPLKGVYRGHGELE |
| Ga0062591_1021636721 | 3300004643 | Soil | MSQENVEVVRRAVEAWNRRDRRAWLALFRSDAELDWSRARGPLK |
| Ga0058861_117160281 | 3300004800 | Host-Associated | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHRELE |
| Ga0062594_1011909921 | 3300005093 | Soil | VAMSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRA |
| Ga0062594_1030298211 | 3300005093 | Soil | MSQENVEVVRRHAQAWNRRDMAALSALWRSDAEIDWSRARGPLKGVYRGRGERETFWNEFYS |
| Ga0070670_1006078011 | 3300005331 | Switchgrass Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHRELEGFCDAF |
| Ga0070662_1017165442 | 3300005457 | Corn Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHCELEG |
| Ga0070695_1001134411 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VAMSEENVETVRRQNEAFNRRDLKAWLASYHRDAEIDWSRA |
| Ga0070696_1018748791 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENVEVVRRHFDAWNRGDLTGWLDTFRSDAEIDWSRSRG |
| Ga0070704_1020540262 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQENVEIVRRMNEAWNGRDHGAWLAAYSPEAEIDWSRSRGPLKGVYRG |
| Ga0070664_1002795763 | 3300005564 | Corn Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHR |
| Ga0068854_1002574921 | 3300005578 | Corn Rhizosphere | VAMSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSR |
| Ga0081455_108475122 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSQKNVEVVWRGIQAFNGRDLTRALSVWSADAEIDWSRSEGPFKGVYRGHAEL |
| Ga0081538_101077804 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MSQENVELVRGGIDAVNRRDLTKLSAMWRSDGEIDWSQARGPLKGVYRGQR |
| Ga0075363_1004120002 | 3300006048 | Populus Endosphere | MSQENVDVVRRMFEAFNRRDRITLEALWRSDAVIDWSRARGTAEGCLSR* |
| Ga0075364_108517262 | 3300006051 | Populus Endosphere | MSQENVDVVRRHIEAWNRGDLTAFLATFRSDAEIDWSRA |
| Ga0066653_102650902 | 3300006791 | Soil | MESGKLPRDTARTMSEENVEVVRKSIEAGNRRDLATERALWRSDAEVDWSRSRGPLKGVYRGREEV |
| Ga0075421_1023509621 | 3300006845 | Populus Rhizosphere | IEAFNRRDLRTWLATYSSDAEIDWSRARGPFKGVYCGRSGQEAFWEVSDI* |
| Ga0075433_105479351 | 3300006852 | Populus Rhizosphere | MSQENVEIVRRHIEAFNRRDLSTWVALFSSDAEIDWSRARGPFKGFY |
| Ga0075425_1001566906 | 3300006854 | Populus Rhizosphere | MSQENVELVRRGVETWNRRDLTTWLALFSSDAEIDW |
| Ga0075425_1008718611 | 3300006854 | Populus Rhizosphere | MSQENVEVVRRANEAWNRRDWITLSALWRSDGVLDWSRARGPFKGVY |
| Ga0075425_1014445401 | 3300006854 | Populus Rhizosphere | MSQENVEVVRRNIEAFNRRDLRTWLATYSSDAEIDWSRARGPFKGVY |
| Ga0075426_110726242 | 3300006903 | Populus Rhizosphere | MSQENVEVVRRGIEAFNRRDVKTWLTTFRSDAEIDWSRARGPLKGVYRGHGELE |
| Ga0075435_1010966783 | 3300007076 | Populus Rhizosphere | MSVGNVETVRRHNDAWNRRDLATWLASFRSGGEIDWSRSRGPLKGVIAVIES |
| Ga0099827_116971421 | 3300009090 | Vadose Zone Soil | MSEENVEIVRRGIETWNRRDLTAWLASFDSDAEIDWSRARGPLKG |
| Ga0105245_117790632 | 3300009098 | Miscanthus Rhizosphere | MSQENLEIVRRNIEAFNGRDLRAWLATFRSDGEMDWSRA |
| Ga0105245_119241592 | 3300009098 | Miscanthus Rhizosphere | MSQENVEVVRRSIAAWNRRDLRTWLASFSSDAEIDWSRARGPLKGVYRGPGEIETLWKEFFF |
| Ga0075418_130257492 | 3300009100 | Populus Rhizosphere | MSEENVEVVQRGIETWNRRDLATWLASFSSDAEIDWTHARGPL |
| Ga0114129_100495708 | 3300009147 | Populus Rhizosphere | MSEENVEIVQRGIETWNRRDLTTWLALFSSDAEIDWSRARGPLKGVY |
| Ga0114129_123826561 | 3300009147 | Populus Rhizosphere | MSQENVEVVQRHVEAWNRRDMATLSTLWRSDAEIDW |
| Ga0111538_102750776 | 3300009156 | Populus Rhizosphere | MSQENVEIVRRHHEARNRRDLITLLALWHSDAEIDWSRSRGPL |
| Ga0105242_109595651 | 3300009176 | Miscanthus Rhizosphere | MSQENVEVVRRHAQAWNRRDMAALSALWRSDAEIDWSRARGPLKG |
| Ga0105248_113772841 | 3300009177 | Switchgrass Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRG |
| Ga0105249_105743314 | 3300009553 | Switchgrass Rhizosphere | MSEENVETVRRYNDAWNRRDLTAWLAVLSSGAEVDWSRSRGPLKGVYRGPGELEVFWD |
| Ga0126313_116155231 | 3300009840 | Serpentine Soil | MSQENVEIVQRHIEAFNRRDLRTWLATFHPDAEIDWSRARGPFKGVY |
| Ga0126305_101359091 | 3300010036 | Serpentine Soil | MSQENVEIVRRHIEAWNRRDLTAWLDLFHSDAEIDWSRARGLFKGVYRGRGGHEAFW |
| Ga0126304_112775392 | 3300010037 | Serpentine Soil | MSEENVEMVRLGLEAWNRRDLTTWLSSFHPDGEIDWSRSRGPLMGVYRGHDGLR |
| Ga0126315_102426631 | 3300010038 | Serpentine Soil | MSREKVEVVRRSIAAWNRRDLTAWMAGFHPDAEIDWSRSRGPLKGVYRDEGLRASGLTLV |
| Ga0126308_101241091 | 3300010040 | Serpentine Soil | MSQENVEIVRRHIEAWNRRDLTAWLDLFHSDAEIDWSRARGL |
| Ga0126308_107276702 | 3300010040 | Serpentine Soil | MSQENIEIVRRHIEAWNRRDLPTLLALWRSDAEIDWSRARGPLKGV* |
| Ga0126312_106777101 | 3300010041 | Serpentine Soil | MSEENVEAVRRHREAWNRQELTAWLASFHPDGELDWSRSRGPLKGV |
| Ga0126314_105767253 | 3300010042 | Serpentine Soil | MPGENVAAVRRHNEAWNRGDLTAWLASFSSDPEIDWSRARGLLKGVYRGRSELEAFWEAF |
| Ga0126314_108566721 | 3300010042 | Serpentine Soil | MSQEDVEVVRRSIEAWNRRDMAAFLVEFHREAELDWSRSRAPFKGVYR |
| Ga0134125_110171123 | 3300010371 | Terrestrial Soil | MSEENVETVRRYNDAWNRRDLTAWLALLSSGAEVDWSRSRGPLKGVYRGPGE |
| Ga0134125_115841922 | 3300010371 | Terrestrial Soil | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHRQLEGFCDAFWS |
| Ga0134127_108612332 | 3300010399 | Terrestrial Soil | MSQENVEVVQRGIETWNRRDLTTWLALFSSDAEIDWS |
| Ga0134123_116406012 | 3300010403 | Terrestrial Soil | MSEENVETVRRYNDAWNRRDLTAWLAVLSSGAEVDWSRSRGPLKGVYRGPGEL |
| Ga0137364_103789132 | 3300012198 | Vadose Zone Soil | MSQENVETVRRHNDAWNRRDLTAWLATFHSNSEIDWSRSRGPLKGVYRGHG |
| Ga0137364_104444222 | 3300012198 | Vadose Zone Soil | MSEENVEVVRRHNDAWNRRDLTAWLATFHSNSEIDWSRSRGPLKGVYRGHG |
| Ga0137364_107163381 | 3300012198 | Vadose Zone Soil | MSQENVEIVRRWIDAWNRRDLTTWLASFSNGGEIDWSRSRGPLKGVYSG |
| Ga0137364_112811881 | 3300012198 | Vadose Zone Soil | MSQENVEIVRRHIDAWNRRDLKVWLDCFHPEAELDWSRSRGPLR |
| Ga0137382_103860853 | 3300012200 | Vadose Zone Soil | MSQENVEIVRRHIDAWNRRDWKAWLDSFAPEAELDWSRSRGPLKGLYH |
| Ga0137376_108756291 | 3300012208 | Vadose Zone Soil | MSQETIEFVRSNIEAWNRRDLTTWLDTFRSDAEIDWSRARGPLKGVYRGHDELKAFW |
| Ga0137367_110826161 | 3300012353 | Vadose Zone Soil | MSEENVEVVRRHNEAWNQRDLSSVLVLWRSDAEIDWSRSR |
| Ga0157291_102122941 | 3300012902 | Soil | MSRENVDVVRRGIEAFNRRDLKTWLTTFRSDAEIDWSRARGPLKGVYRGHGELE |
| Ga0164298_108312291 | 3300012955 | Soil | MSQENVETVRRGIEAWNRRDLTTWLAGFGPNAEIDWSRS |
| Ga0164298_111181501 | 3300012955 | Soil | MSQENVDVVLRMFEAFNQRDRITLEALWRSDAVIDWSRARG |
| Ga0164298_114688732 | 3300012955 | Soil | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPV |
| Ga0164301_117148071 | 3300012960 | Soil | MSQENVEIVRRMNEAWNGRDHGAWLAAYSPEAEIDWSR |
| Ga0164302_101712551 | 3300012961 | Soil | MSQENVEVVRRSIAAWNRRDLRTWLASFSSDAEIDWSRARGPLKGVYRGPGE |
| Ga0134077_105583391 | 3300012972 | Grasslands Soil | MSQENIDVVRRNQEAWNRRDLRAWLASFRSDAEIDWSRARRPLKG |
| Ga0164307_102556171 | 3300012987 | Soil | MSQENIEIVQRHVEAWNRRDLKAWLDMFHSGAEIDWSRSRAPHK |
| Ga0164307_112756331 | 3300012987 | Soil | MSQENVEVVRRSIAAWNRRDLRTWLASFSSDAEIDWSRARGPLKG |
| Ga0164306_108278282 | 3300012988 | Soil | MSQENVEIVRRAIDALNRRDLDEFLQCLNPEAELDWSRSLGVEAGVY |
| Ga0163163_100347031 | 3300014325 | Switchgrass Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHREL |
| Ga0157380_101564521 | 3300014326 | Switchgrass Rhizosphere | MLEENVETVRQQNDAFNRRDLKAWVASYHRAAEIDWSRAEGPVNGVYRGHRELEGF |
| Ga0157379_117231602 | 3300014968 | Switchgrass Rhizosphere | MSQENIEIVQRHVEAWNRRDLKAWLDMFHSGAEIDWSRSRAPHKGVYRGRREHEAFWGVF |
| Ga0173483_104253122 | 3300015077 | Soil | MSQENVEIVRRGVETWNRRDLATWLALFSADAEIDWSRAR |
| Ga0134089_102693452 | 3300015358 | Grasslands Soil | MSQENVEVVLRQHEAWNRRDLRTWLASFRSDAEIDWSRARGPFKGVYRGYDGFETFWEVF |
| Ga0184625_104017491 | 3300018081 | Groundwater Sediment | MSEENFETVRRYNDAWNRRDLTAWLALLSSGAEVDWSRSQGPLKGV |
| Ga0190265_123516351 | 3300018422 | Soil | MSQENVEIVRAHFDARNRRDLTTLLTLWRSDGEIDWSRSRGPLRGVYRG |
| Ga0190271_107275641 | 3300018481 | Soil | MSEENVEIVRRSIEIWNRRDLTAELTFWSSDAETDWSRATGPFKGIYRGHHELEAFWNE |
| Ga0193733_10417231 | 3300020022 | Soil | MSEENVATVRRHTEAWNRRDLATWLASFASDGEIDWSRSRGPLNGVYRDEGELEV |
| Ga0179589_100493432 | 3300024288 | Vadose Zone Soil | MSEENVEAVQRNIEAWNRRDLTAWLASFHPDAEID |
| Ga0207653_103473751 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENVEVVRSHLEAWNRRDKAAYVASFRSDAEIDWSRARAPYRGLYRGREQQKAF |
| Ga0207680_108733421 | 3300025903 | Switchgrass Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHRQLEGFC |
| Ga0207663_102396831 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHRELEGFCDAFWSTFDD |
| Ga0207650_105495982 | 3300025925 | Switchgrass Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHRQLEGF |
| Ga0207687_115848592 | 3300025927 | Miscanthus Rhizosphere | VVRRHAQAWNRRDMAALSALWRSDAEIDWSRARGPLKGVYRGRGERETFWNEFYSTFE |
| Ga0207665_106665941 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEENVEVVRSHLEAWNRRDKAAYVASFRSDAEIDWSRARAPYRGLYRGREQ |
| Ga0207691_108104361 | 3300025940 | Miscanthus Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHCELEGFC |
| Ga0207712_109602222 | 3300025961 | Switchgrass Rhizosphere | MSQENVEVVQRHVEAWNRRDMATLSTLWRSDAEIDWSRARGPMKGVYRGRGERETFWN |
| Ga0207648_106910821 | 3300026089 | Miscanthus Rhizosphere | MSQENVEIVLRSIEVWNRRDLRAWLAMFSSDAEIDWSRSRAPHKGVYRGQG |
| Ga0207683_102106761 | 3300026121 | Miscanthus Rhizosphere | MSEENVETVRRQNEAFNRRDLKAWVASYHRDAEIDWSRAEGPVNGVYRGHRELEGFCD |
| Ga0307317_101545841 | 3300028720 | Soil | MSEENVEVVRRNQDAWNRCDLRTWLASFRSDGEIDWSRSRGPLKGFYRGTGE |
| Ga0307282_104831562 | 3300028784 | Soil | MEVVRRNIEAFNRRDLRTWLATYRSDGEIDWSRARGPDKGVYRGHGELETFWDAWLT |
| Ga0307296_104435442 | 3300028819 | Soil | MSQENVEVVRRNIEAFNRRDLRTWLATFRSDAEIDWSRARGPQKGVYRGRAGHEAFWEVW |
| Ga0307310_105789621 | 3300028824 | Soil | MSQENVEVVRRHAEAWNRRDLRTWLASFRSDAEIDWSRARGPFKGVYRGPGEHEAF |
| Ga0307308_103275911 | 3300028884 | Soil | MEVVRRNIEAFNRRDLRTWLATFRSDAEIDWSRAR |
| Ga0247827_111314342 | 3300028889 | Soil | MSQENVEIVKAVLDAWKRRDLTTMLALWRADGEIDWSRSRGPLKRVYRG |
| Ga0308181_10938811 | 3300031099 | Soil | MSEENVETVRRHTESWNRRDLTTWLDSFSSGGEIDWSRSRGPLKGVYRGHGELE |
| Ga0308187_104686491 | 3300031114 | Soil | MSQENVEVVKRHVEAWNRRDLGAYLASFASDAEVDWSRSRAPHKG |
| Ga0307471_1031418011 | 3300032180 | Hardwood Forest Soil | MSEENVETVRRWTEEWNRREQTAWLASLHQDAEIDWSRA |
| Ga0335084_113642971 | 3300033004 | Soil | MSQENVEVVREAIDAWNRRDSQAWVEVFNPEAELDWSRSRG |
| Ga0247830_113718272 | 3300033551 | Soil | MSQEAVEIARRQNDAWNRRDLGAWLASYGPEAEMDWSRSRGPLK |
| ⦗Top⦘ |