| Basic Information | |
|---|---|
| Family ID | F085434 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.78 % |
| % of genes near scaffold ends (potentially truncated) | 24.32 % |
| % of genes from short scaffolds (< 2000 bps) | 80.18 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.495 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.117 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.225 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.144 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.54% β-sheet: 0.00% Coil/Unstructured: 59.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00881 | Nitroreductase | 7.21 |
| PF00196 | GerE | 3.60 |
| PF04545 | Sigma70_r4 | 3.60 |
| PF08241 | Methyltransf_11 | 1.80 |
| PF02390 | Methyltransf_4 | 1.80 |
| PF12681 | Glyoxalase_2 | 1.80 |
| PF12847 | Methyltransf_18 | 0.90 |
| PF02771 | Acyl-CoA_dh_N | 0.90 |
| PF01575 | MaoC_dehydratas | 0.90 |
| PF03328 | HpcH_HpaI | 0.90 |
| PF01557 | FAA_hydrolase | 0.90 |
| PF13565 | HTH_32 | 0.90 |
| PF10819 | DUF2564 | 0.90 |
| PF05016 | ParE_toxin | 0.90 |
| PF13649 | Methyltransf_25 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0220 | tRNA G46 N7-methylase TrmB | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 1.80 |
| COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.80 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.90 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.90 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.90 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.50 % |
| Unclassified | root | N/A | 4.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2036165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 593 | Open in IMG/M |
| 3300000956|JGI10216J12902_111492777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 980 | Open in IMG/M |
| 3300004114|Ga0062593_100010091 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
| 3300004156|Ga0062589_101571736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 650 | Open in IMG/M |
| 3300004157|Ga0062590_101179957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 745 | Open in IMG/M |
| 3300004463|Ga0063356_100315647 | All Organisms → cellular organisms → Bacteria | 1949 | Open in IMG/M |
| 3300004463|Ga0063356_102209439 | Not Available | 838 | Open in IMG/M |
| 3300004479|Ga0062595_100161393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1323 | Open in IMG/M |
| 3300004643|Ga0062591_100243053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1366 | Open in IMG/M |
| 3300004643|Ga0062591_100644993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 946 | Open in IMG/M |
| 3300005093|Ga0062594_100377355 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300005180|Ga0066685_10426012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 921 | Open in IMG/M |
| 3300005181|Ga0066678_10417276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 891 | Open in IMG/M |
| 3300005289|Ga0065704_10572955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300005344|Ga0070661_101196385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 635 | Open in IMG/M |
| 3300005406|Ga0070703_10003944 | All Organisms → cellular organisms → Bacteria | 4202 | Open in IMG/M |
| 3300005440|Ga0070705_100323755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1114 | Open in IMG/M |
| 3300005444|Ga0070694_100549274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 925 | Open in IMG/M |
| 3300005444|Ga0070694_101785600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 524 | Open in IMG/M |
| 3300005450|Ga0066682_10068585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2184 | Open in IMG/M |
| 3300005467|Ga0070706_100109600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2569 | Open in IMG/M |
| 3300005468|Ga0070707_101425566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 659 | Open in IMG/M |
| 3300005518|Ga0070699_100072593 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
| 3300005536|Ga0070697_100120649 | All Organisms → cellular organisms → Bacteria | 2193 | Open in IMG/M |
| 3300005552|Ga0066701_10321149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 960 | Open in IMG/M |
| 3300005552|Ga0066701_10785743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
| 3300005559|Ga0066700_10900548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300005561|Ga0066699_11210151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300005568|Ga0066703_10778402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300005617|Ga0068859_100613306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1181 | Open in IMG/M |
| 3300006034|Ga0066656_10012682 | All Organisms → cellular organisms → Bacteria | 4311 | Open in IMG/M |
| 3300006049|Ga0075417_10002858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5329 | Open in IMG/M |
| 3300006049|Ga0075417_10219596 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300006049|Ga0075417_10642250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300006796|Ga0066665_10723309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 788 | Open in IMG/M |
| 3300006847|Ga0075431_100941472 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006876|Ga0079217_10298258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 891 | Open in IMG/M |
| 3300006894|Ga0079215_10763073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
| 3300006918|Ga0079216_10989158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300007004|Ga0079218_10068528 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
| 3300009012|Ga0066710_102122598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 824 | Open in IMG/M |
| 3300009089|Ga0099828_10869197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 806 | Open in IMG/M |
| 3300009090|Ga0099827_11969518 | Not Available | 508 | Open in IMG/M |
| 3300009137|Ga0066709_100033120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 5525 | Open in IMG/M |
| 3300009147|Ga0114129_10041677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6467 | Open in IMG/M |
| 3300010333|Ga0134080_10190758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 884 | Open in IMG/M |
| 3300010400|Ga0134122_10097986 | All Organisms → cellular organisms → Bacteria | 2317 | Open in IMG/M |
| 3300010400|Ga0134122_12448497 | Not Available | 570 | Open in IMG/M |
| 3300012174|Ga0137338_1150035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300012203|Ga0137399_11773597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300012204|Ga0137374_10184350 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
| 3300012204|Ga0137374_10436329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1032 | Open in IMG/M |
| 3300012204|Ga0137374_10803764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 697 | Open in IMG/M |
| 3300012205|Ga0137362_10850575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 780 | Open in IMG/M |
| 3300012355|Ga0137369_10163035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1757 | Open in IMG/M |
| 3300012355|Ga0137369_10170796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1708 | Open in IMG/M |
| 3300012355|Ga0137369_10947409 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300012358|Ga0137368_10336407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1008 | Open in IMG/M |
| 3300012359|Ga0137385_10375418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1215 | Open in IMG/M |
| 3300012685|Ga0137397_11328820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300012922|Ga0137394_10034387 | All Organisms → cellular organisms → Bacteria | 4134 | Open in IMG/M |
| 3300012922|Ga0137394_10124797 | All Organisms → cellular organisms → Bacteria | 2181 | Open in IMG/M |
| 3300012927|Ga0137416_11487493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300015371|Ga0132258_10473684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3126 | Open in IMG/M |
| 3300015374|Ga0132255_100623835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1596 | Open in IMG/M |
| 3300017654|Ga0134069_1204379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 675 | Open in IMG/M |
| 3300017656|Ga0134112_10381440 | Not Available | 579 | Open in IMG/M |
| 3300017997|Ga0184610_1188293 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300018028|Ga0184608_10180331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 920 | Open in IMG/M |
| 3300018071|Ga0184618_10169384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 901 | Open in IMG/M |
| 3300018078|Ga0184612_10389705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 701 | Open in IMG/M |
| 3300018082|Ga0184639_10208008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1037 | Open in IMG/M |
| 3300018429|Ga0190272_12630155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 551 | Open in IMG/M |
| 3300018431|Ga0066655_10056809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2041 | Open in IMG/M |
| 3300018482|Ga0066669_10102807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1989 | Open in IMG/M |
| 3300019259|Ga0184646_1403666 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300021972|Ga0193737_1027312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 811 | Open in IMG/M |
| 3300022534|Ga0224452_1206573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
| 3300022756|Ga0222622_10656020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 760 | Open in IMG/M |
| 3300022756|Ga0222622_11126774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 577 | Open in IMG/M |
| 3300022756|Ga0222622_11384839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 518 | Open in IMG/M |
| 3300025167|Ga0209642_10374810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 800 | Open in IMG/M |
| 3300025885|Ga0207653_10002099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6352 | Open in IMG/M |
| 3300025908|Ga0207643_10339300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 941 | Open in IMG/M |
| 3300025910|Ga0207684_10000249 | All Organisms → cellular organisms → Bacteria | 80711 | Open in IMG/M |
| 3300025922|Ga0207646_11252083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
| 3300025922|Ga0207646_11270545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 644 | Open in IMG/M |
| 3300025938|Ga0207704_11449248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 589 | Open in IMG/M |
| 3300026285|Ga0209438_1025703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1963 | Open in IMG/M |
| 3300026314|Ga0209268_1146903 | Not Available | 579 | Open in IMG/M |
| 3300026323|Ga0209472_1118011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1043 | Open in IMG/M |
| 3300026324|Ga0209470_1008136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6481 | Open in IMG/M |
| 3300027633|Ga0208988_1085867 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 787 | Open in IMG/M |
| 3300027637|Ga0209818_1094292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 785 | Open in IMG/M |
| 3300027639|Ga0209387_1039970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 996 | Open in IMG/M |
| 3300027645|Ga0209117_1120205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 704 | Open in IMG/M |
| 3300027678|Ga0209011_1162964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 622 | Open in IMG/M |
| 3300027681|Ga0208991_1047065 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300027873|Ga0209814_10027462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2333 | Open in IMG/M |
| 3300027873|Ga0209814_10063253 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1551 | Open in IMG/M |
| 3300027873|Ga0209814_10276131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 730 | Open in IMG/M |
| 3300027875|Ga0209283_10037817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3033 | Open in IMG/M |
| 3300028536|Ga0137415_11407148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300028536|Ga0137415_11419975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
| 3300028784|Ga0307282_10463142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 615 | Open in IMG/M |
| 3300028814|Ga0307302_10266004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 841 | Open in IMG/M |
| 3300028881|Ga0307277_10089936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1293 | Open in IMG/M |
| 3300028884|Ga0307308_10137202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1170 | Open in IMG/M |
| 3300031965|Ga0326597_10011262 | All Organisms → cellular organisms → Bacteria | 11865 | Open in IMG/M |
| 3300031965|Ga0326597_11307210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 709 | Open in IMG/M |
| 3300032180|Ga0307471_104090699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 6.31% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 5.41% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.70% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.80% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.90% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_20361652 | 3300000033 | Soil | MSEHRPVXEEPRVEEHKVXALLAXPVFLVTLFIIGLIATLGTSPRP* |
| JGI10216J12902_1114927773 | 3300000956 | Soil | MTEHRPVHEEPRLEDHKVYALLAIPVFLVTIFIIGLIAIF |
| Ga0062593_1000100911 | 3300004114 | Soil | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTVPRP* |
| Ga0062589_1015717361 | 3300004156 | Soil | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTAPRP* |
| Ga0062590_1011799571 | 3300004157 | Soil | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGT |
| Ga0063356_1003156474 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSEHRPVHEEPRLEDHKVYALLAIPVFLVTIFIIGLIAVLGTAPRP* |
| Ga0063356_1022094391 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MSEHRPVHEEPRLEDHKVYALLAIPVFLVTIFIIGLIAVFGTSPRP* |
| Ga0062595_1001613934 | 3300004479 | Soil | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPRP* |
| Ga0062591_1002430533 | 3300004643 | Soil | MSEQRPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTAPRP* |
| Ga0062591_1006449932 | 3300004643 | Soil | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP* |
| Ga0062594_1003773552 | 3300005093 | Soil | MSEHRPVHEESRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP* |
| Ga0066685_104260121 | 3300005180 | Soil | VSEHRPVREERRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0066678_104172761 | 3300005181 | Soil | MAEHGPVHEESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP* |
| Ga0065704_105729552 | 3300005289 | Switchgrass Rhizosphere | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTAPRP* |
| Ga0070661_1011963852 | 3300005344 | Corn Rhizosphere | MSEHRPVQEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTAPRP* |
| Ga0070703_100039448 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATL |
| Ga0070705_1003237552 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEHRPVHEEPRVEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP* |
| Ga0070694_1005492741 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPRP* |
| Ga0070694_1017856001 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEHGPVREESRLEEHKVYALLAIPIFIVTVFIIGLLTLFGTSPRP* |
| Ga0066682_100685851 | 3300005450 | Soil | MAEHRPVHEESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP* |
| Ga0070706_1001096002 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEHGPVHEESRLEEHKVYALLAIPIFIVTIFIIGLLTMFGTSPRP* |
| Ga0070707_1014255662 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEHPPVHEEPRLEDHKVYALLAIPVFLVTIFIIALIAMLGTSPRP* |
| Ga0070699_1000725936 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSP |
| Ga0070697_1001206493 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | TAVDGGRMSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTAPRP* |
| Ga0066701_103211492 | 3300005552 | Soil | RLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP* |
| Ga0066701_107857432 | 3300005552 | Soil | LEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0066700_109005482 | 3300005559 | Soil | MSEQRPAREESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0066699_112101511 | 3300005561 | Soil | MSDHPPVHEESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0066703_107784022 | 3300005568 | Soil | MSEHPPVHEESRLEEHKVYVLLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0068859_1006133064 | 3300005617 | Switchgrass Rhizosphere | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPR |
| Ga0066656_100126823 | 3300006034 | Soil | VSEHRPVREERRLEEHKVYAPLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0075417_100028585 | 3300006049 | Populus Rhizosphere | MSEHRPVREEPRLEDHKVYALLAIPVFLVTIFIIVLIAALGTSPRP* |
| Ga0075417_102195962 | 3300006049 | Populus Rhizosphere | MSEHRSVHEEPRIEEHKVYALLAIPIFIVTIFIVALLATLGTSPRP* |
| Ga0075417_106422501 | 3300006049 | Populus Rhizosphere | MSEHRPVHEEPRIEEHKVYALLAIPIFVVTVFIIALIAIFGTAPRP* |
| Ga0066665_107233091 | 3300006796 | Soil | VTLSEHRPAREESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0075431_1009414722 | 3300006847 | Populus Rhizosphere | LSEHRPVNEKPRVEEHLVYALLAIPIFLVTIFIVALLATLGTAPRP* |
| Ga0079217_102982582 | 3300006876 | Agricultural Soil | MSERRPVHEEPRLEDHKVYALLAIPVFLVTILIIVLLAIFGTSPGP* |
| Ga0079215_107630732 | 3300006894 | Agricultural Soil | MSEHRPVHEEPRLEDHKVYALLAIPVFLVTIFIVVLLAIFGTSPRP* |
| Ga0079216_109891582 | 3300006918 | Agricultural Soil | MSEHRPVREEPRVEDHKVYALLAIPVFLVTIFIVVLLAVLGTSPQP* |
| Ga0079218_100685283 | 3300007004 | Agricultural Soil | VHEEPRLEDHKVYLLLALPVFLVTIFIIVLLAIFGTAPGP* |
| Ga0066710_1021225982 | 3300009012 | Grasslands Soil | MSEQRPAREESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP |
| Ga0099828_108691972 | 3300009089 | Vadose Zone Soil | MAEHGPVREESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP* |
| Ga0099827_119695181 | 3300009090 | Vadose Zone Soil | MSEHRPVHEESRLEEHKVYALLAIPIFLVTIFIIGLLATFGTSPRP* |
| Ga0066709_1000331203 | 3300009137 | Grasslands Soil | LSEHRPAREESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0114129_100416772 | 3300009147 | Populus Rhizosphere | MSEHRPVHEEPRIEEHKVYALLAIPIFLVTVFIIVLIAIFGTAPRP* |
| Ga0134080_101907581 | 3300010333 | Grasslands Soil | MSEHRPVHEESRLEEHRVYALLAIPIFLVTIFIIGLLTMFGTSPRP* |
| Ga0134122_100979865 | 3300010400 | Terrestrial Soil | MSEHEPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP* |
| Ga0134122_124484971 | 3300010400 | Terrestrial Soil | EPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPRP* |
| Ga0137338_11500351 | 3300012174 | Soil | MSEHRPVHEEPRLEEHKVYALLAIPVFLVTILIIALIAIFGTSPRP* |
| Ga0137399_117735971 | 3300012203 | Vadose Zone Soil | MSEHPPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGSAPRP* |
| Ga0137374_101843505 | 3300012204 | Vadose Zone Soil | MSDHRPVREEPRVEEHRVYALLAIPVFLVTILIVVLIATLGTAPRP* |
| Ga0137374_104363291 | 3300012204 | Vadose Zone Soil | MSEHRPVREEPRIEEHKVYALLAIPVFLVTLLIIGLIATLGTAPRP* |
| Ga0137374_108037641 | 3300012204 | Vadose Zone Soil | SNRSVGGQMSEQRPVHEEPREEEHKVYVLLAIPVFLVTIFIIGLIAMLGTSPRP* |
| Ga0137362_108505751 | 3300012205 | Vadose Zone Soil | MSEHRPVHEESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP* |
| Ga0137369_101630355 | 3300012355 | Vadose Zone Soil | MSDHRPVREEPRVEEHRVYALLAIPVFLVTILIVVLIATLGAAPRP* |
| Ga0137369_101707961 | 3300012355 | Vadose Zone Soil | VHEEPREEEHKVYVLLAIPVFLVTIFIIGLIAMLGTSPRP* |
| Ga0137369_109474092 | 3300012355 | Vadose Zone Soil | MSEQRPVHEEPREEEHKVYVLLAIPVFLVTIFIIGLIAMLGTSPRP* |
| Ga0137368_103364071 | 3300012358 | Vadose Zone Soil | MSERRPVREEPRLEEHKLYALLALPVFLVTSFIIALIAMLGTSPRP* |
| Ga0137385_103754183 | 3300012359 | Vadose Zone Soil | MSEHRPAREESRLEEHKVYVLLAIPIFLVTIFIIGLIATFGTSPRP* |
| Ga0137397_113288202 | 3300012685 | Vadose Zone Soil | MSENRPVREEPRLEDHKVYALLAIPVFLVTLFIIGLIATLGTSPRP* |
| Ga0137394_100343871 | 3300012922 | Vadose Zone Soil | MSDHRPVHEEPRIEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP* |
| Ga0137394_101247971 | 3300012922 | Vadose Zone Soil | MSDHRPVHEEPRIEEHKVYALLAIPVFLVTIFIIGLIATLGSAPRP* |
| Ga0137416_114874932 | 3300012927 | Vadose Zone Soil | EHPPVREEPRVEEHKVYALLAIPVFIVTLFIIGLIATLGTSPRP* |
| Ga0132258_104736845 | 3300015371 | Arabidopsis Rhizosphere | MSEHRPVPEEPRLEEHKVYALLAIPVFLVTLLIIGLIATLGTSPRP* |
| Ga0132255_1006238354 | 3300015374 | Arabidopsis Rhizosphere | MSERRPVPEEPRLEEHKVYALLAIPVFLVTLLIIGLIATLG |
| Ga0134069_12043791 | 3300017654 | Grasslands Soil | MSEHRPVHEESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP |
| Ga0134112_103814401 | 3300017656 | Grasslands Soil | MSEHRPVHEESRLEEHKVYALLAIPIFLVTIFIIGLLTMFGTSPRP |
| Ga0184610_11882931 | 3300017997 | Groundwater Sediment | MSEHRPVHEEPRLEDHKVYALLAIPVFLVTIFIIGLIAIFGTSPRP |
| Ga0184608_101803313 | 3300018028 | Groundwater Sediment | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPRP |
| Ga0184618_101693842 | 3300018071 | Groundwater Sediment | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP |
| Ga0184612_103897051 | 3300018078 | Groundwater Sediment | MSEHRPVHEEARLEDHKVYALLAIPVFLVTIFIVVLLATLGTSPRP |
| Ga0184639_102080083 | 3300018082 | Groundwater Sediment | MSEHRPVHEEARLEDHKVYALLAIPIFLVTIFIVALLATLGTSPRP |
| Ga0190272_126301551 | 3300018429 | Soil | MSEQRPVHEEPRLEDHKVYALLAIPVFLVTIFIIGLIAMFGTSPRP |
| Ga0066655_100568093 | 3300018431 | Grasslands Soil | MAEHRPVHEESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP |
| Ga0066669_101028073 | 3300018482 | Grasslands Soil | MAAHRPVHEESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP |
| Ga0184646_14036662 | 3300019259 | Groundwater Sediment | GGPMSEHRPVHEEQRLEDHKVYALLAIPVFLVTIFIIGLIAIFGTSPRP |
| Ga0193737_10273121 | 3300021972 | Soil | MSEQRPVHEESRLEDHKVYALLAIPVFLVTIFIVVLLATLGTSPRP |
| Ga0224452_12065731 | 3300022534 | Groundwater Sediment | MSEHRPVHEEPRLEDHKVYALLAIPVFLVTIFIVVLLATLGTSPRP |
| Ga0222622_106560201 | 3300022756 | Groundwater Sediment | VHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPRP |
| Ga0222622_111267741 | 3300022756 | Groundwater Sediment | HEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPRP |
| Ga0222622_113848391 | 3300022756 | Groundwater Sediment | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIA |
| Ga0209642_103748103 | 3300025167 | Soil | MSEHRPVHEEPRVEDHKVYALLAIPVFLVTIFIVVLLAVLGTSPRP |
| Ga0207653_100020996 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTAPRP |
| Ga0207643_103393001 | 3300025908 | Miscanthus Rhizosphere | MSEHRPVHEESRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP |
| Ga0207684_1000024976 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEHGPVHEESRLEEHKVYALLAIPIFIVTIFIIGLLTMFGTSPRP |
| Ga0207646_112520832 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSKHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTVPRP |
| Ga0207646_112705452 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEHPPVHEEPRLEDHKVYALLAIPVFLVTIFIIALIAMLGTSPRP |
| Ga0207704_114492482 | 3300025938 | Miscanthus Rhizosphere | MSEHRPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTAPRP |
| Ga0209438_10257035 | 3300026285 | Grasslands Soil | MSEHRPLHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP |
| Ga0209268_11469032 | 3300026314 | Soil | VHEESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP |
| Ga0209472_11180112 | 3300026323 | Soil | MAEHGPVHEESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP |
| Ga0209470_10081365 | 3300026324 | Soil | VSEHRPVREERRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP |
| Ga0208988_10858671 | 3300027633 | Forest Soil | MSEHPPVHEEPRVEEHKVYALLAIPVFIVTLFIIGLIATLGTSPRP |
| Ga0209818_10942922 | 3300027637 | Agricultural Soil | MSERRPVHEEPRLEDHKVYALLAIPVFLVTILIIVLLAIFGTSPGP |
| Ga0209387_10399704 | 3300027639 | Agricultural Soil | MSEHRPVHEEPRLEDHKVYLLLALPVFLVTIFIIVLLAIFGTSPGP |
| Ga0209117_11202052 | 3300027645 | Forest Soil | MSEHRPVHEEPRIEEHKVYALLAVPVFIVTLFIIGLIATLGSSPRP |
| Ga0209011_11629641 | 3300027678 | Forest Soil | MSEHPPVHEEPRIEEHKVYALLAIPVFIVTLFIIGLIAT |
| Ga0208991_10470653 | 3300027681 | Forest Soil | MSEHPPVHEEPRIEEHKVYALLAIPVFIVTLFIIGLIATLGTSPRP |
| Ga0209814_100274625 | 3300027873 | Populus Rhizosphere | MSEHRPVREEPRLEDHKVYALLAIPVFLVTIFIIVLIAALGTSPRP |
| Ga0209814_100632534 | 3300027873 | Populus Rhizosphere | MSEHRSVHEEPRIEEHKVYALLAIPVFLVTLFIIGLIATLGTAPRP |
| Ga0209814_102761312 | 3300027873 | Populus Rhizosphere | MSEHRPVHEEPRIEEHKVYALLAIPIFVVTVFIIALIAIFGTAPRP |
| Ga0209283_100378175 | 3300027875 | Vadose Zone Soil | MAEHGPVREESRLEEHKVYALLAIPIFIVTIFIIGLLTLFGTSPRP |
| Ga0137415_114071482 | 3300028536 | Vadose Zone Soil | MSEHPPVHEESRLEEHKVYALLAIPIFLVTIFIIGLLTLFGTSPRP |
| Ga0137415_114199752 | 3300028536 | Vadose Zone Soil | EHPPVREEPRVEEHKVYALLAIPVFIVTLFIIGLIATLGTSPRP |
| Ga0307282_104631421 | 3300028784 | Soil | PVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP |
| Ga0307302_102660041 | 3300028814 | Soil | GGRMSEHRPVHEEPRVEEHKVYALLAIPVFLVTLFIIGLIATLGTSPRP |
| Ga0307277_100899362 | 3300028881 | Soil | MSEHGPVREEPRLEDHKVYALLAIPVFLVTLFIIGLIATLGTSPRP |
| Ga0307308_101372022 | 3300028884 | Soil | LVLDSPDGGRMSEHRPVHEEPRVEEHKVYALLAIPVFLVTIFIIGLIATLGTSPRP |
| Ga0326597_100112629 | 3300031965 | Soil | LSEHRPVNEKPRVEEHLVYALLAIPIFLVTIFIVVLLAVLGTSPRP |
| Ga0326597_113072101 | 3300031965 | Soil | EHRPVNEKPRVEEHKVYALLAIPIFLVTIFIVVLLAVLGTSPRP |
| Ga0307471_1040906992 | 3300032180 | Hardwood Forest Soil | MSEHRPVHEEARIEEHKVYALLAIPVFLVTIFIIGLIATLGTAPRP |
| ⦗Top⦘ |