| Basic Information | |
|---|---|
| Family ID | F085399 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MQWLEVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.45 % |
| % of genes near scaffold ends (potentially truncated) | 48.65 % |
| % of genes from short scaffolds (< 2000 bps) | 79.28 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.270 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (13.514 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.342 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.559 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.76% β-sheet: 0.00% Coil/Unstructured: 45.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00166 | Cpn10 | 3.60 |
| PF00271 | Helicase_C | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 3.60 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.27 % |
| All Organisms | root | All Organisms | 29.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001851|RCM31_10188665 | Not Available | 942 | Open in IMG/M |
| 3300002273|B570J29588_107210 | Not Available | 638 | Open in IMG/M |
| 3300002371|B570J29602_1005006 | Not Available | 827 | Open in IMG/M |
| 3300003375|JGI26470J50227_1048005 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 756 | Open in IMG/M |
| 3300003393|JGI25909J50240_1061877 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 764 | Open in IMG/M |
| 3300003490|JGI25926J51410_1051342 | Not Available | 712 | Open in IMG/M |
| 3300005581|Ga0049081_10128871 | Not Available | 933 | Open in IMG/M |
| 3300005662|Ga0078894_11632948 | Not Available | 531 | Open in IMG/M |
| 3300005805|Ga0079957_1110900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1472 | Open in IMG/M |
| 3300005943|Ga0073926_10052410 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300006029|Ga0075466_1190620 | Not Available | 512 | Open in IMG/M |
| 3300006037|Ga0075465_10101238 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 639 | Open in IMG/M |
| 3300006802|Ga0070749_10062397 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
| 3300006805|Ga0075464_10099420 | Not Available | 1670 | Open in IMG/M |
| 3300006805|Ga0075464_10525845 | Not Available | 725 | Open in IMG/M |
| 3300006917|Ga0075472_10342852 | Not Available | 738 | Open in IMG/M |
| 3300006920|Ga0070748_1200549 | Not Available | 729 | Open in IMG/M |
| 3300007165|Ga0079302_1043531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1046 | Open in IMG/M |
| 3300007165|Ga0079302_1103562 | Not Available | 594 | Open in IMG/M |
| 3300007538|Ga0099851_1197793 | Not Available | 733 | Open in IMG/M |
| 3300007542|Ga0099846_1342363 | Not Available | 508 | Open in IMG/M |
| 3300007559|Ga0102828_1004991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2568 | Open in IMG/M |
| 3300007622|Ga0102863_1057583 | Not Available | 1136 | Open in IMG/M |
| 3300007734|Ga0104986_1798 | Not Available | 32938 | Open in IMG/M |
| 3300007972|Ga0105745_1031982 | Not Available | 1379 | Open in IMG/M |
| 3300008266|Ga0114363_1027231 | Not Available | 2449 | Open in IMG/M |
| 3300008266|Ga0114363_1121780 | Not Available | 905 | Open in IMG/M |
| 3300008266|Ga0114363_1127171 | Not Available | 876 | Open in IMG/M |
| 3300008267|Ga0114364_1163934 | Not Available | 592 | Open in IMG/M |
| 3300008267|Ga0114364_1165802 | Not Available | 585 | Open in IMG/M |
| 3300008448|Ga0114876_1070925 | Not Available | 1482 | Open in IMG/M |
| 3300008448|Ga0114876_1133624 | Not Available | 931 | Open in IMG/M |
| 3300008450|Ga0114880_1135443 | Not Available | 906 | Open in IMG/M |
| 3300008999|Ga0102816_1173432 | Not Available | 671 | Open in IMG/M |
| 3300009085|Ga0105103_10160827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1189 | Open in IMG/M |
| 3300009111|Ga0115026_10807876 | Not Available | 734 | Open in IMG/M |
| 3300009151|Ga0114962_10360747 | Not Available | 795 | Open in IMG/M |
| 3300009152|Ga0114980_10152119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1372 | Open in IMG/M |
| 3300009163|Ga0114970_10175563 | Not Available | 1274 | Open in IMG/M |
| 3300009168|Ga0105104_10061077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2042 | Open in IMG/M |
| 3300009168|Ga0105104_10130531 | Not Available | 1356 | Open in IMG/M |
| 3300009168|Ga0105104_10903329 | Not Available | 518 | Open in IMG/M |
| 3300009183|Ga0114974_10256177 | Not Available | 1045 | Open in IMG/M |
| 3300009433|Ga0115545_1308808 | Not Available | 525 | Open in IMG/M |
| 3300009435|Ga0115546_1016650 | Not Available | 3194 | Open in IMG/M |
| 3300010354|Ga0129333_10580283 | Not Available | 975 | Open in IMG/M |
| 3300010354|Ga0129333_10630646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 928 | Open in IMG/M |
| 3300011010|Ga0139557_1036979 | Not Available | 852 | Open in IMG/M |
| 3300011984|Ga0119931_1024531 | Not Available | 701 | Open in IMG/M |
| 3300012282|Ga0157136_1004373 | Not Available | 952 | Open in IMG/M |
| 3300012665|Ga0157210_1048717 | Not Available | 648 | Open in IMG/M |
| 3300013004|Ga0164293_10760678 | Not Available | 617 | Open in IMG/M |
| (restricted) 3300013122|Ga0172374_1157800 | Not Available | 836 | Open in IMG/M |
| (restricted) 3300013128|Ga0172366_10229165 | Not Available | 1178 | Open in IMG/M |
| 3300014801|Ga0119946_1010879 | Not Available | 952 | Open in IMG/M |
| 3300014811|Ga0119960_1025941 | Not Available | 808 | Open in IMG/M |
| 3300017699|Ga0181345_100097 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3953 | Open in IMG/M |
| 3300017707|Ga0181363_1022861 | Not Available | 1217 | Open in IMG/M |
| 3300017754|Ga0181344_1164582 | Not Available | 630 | Open in IMG/M |
| 3300017778|Ga0181349_1243326 | Not Available | 603 | Open in IMG/M |
| 3300018420|Ga0181563_10662910 | Not Available | 577 | Open in IMG/M |
| 3300019783|Ga0181361_105226 | Not Available | 987 | Open in IMG/M |
| 3300019783|Ga0181361_115601 | Not Available | 598 | Open in IMG/M |
| 3300019784|Ga0181359_1000974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7185 | Open in IMG/M |
| 3300020048|Ga0207193_1203689 | Not Available | 1560 | Open in IMG/M |
| 3300020160|Ga0211733_10120056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2549 | Open in IMG/M |
| 3300020172|Ga0211729_10267054 | Not Available | 2631 | Open in IMG/M |
| 3300020183|Ga0194115_10023261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4688 | Open in IMG/M |
| 3300020506|Ga0208091_1013400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 995 | Open in IMG/M |
| 3300020549|Ga0207942_1009899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1281 | Open in IMG/M |
| 3300020571|Ga0208723_1026639 | Not Available | 869 | Open in IMG/M |
| 3300021960|Ga0222715_10177055 | Not Available | 1297 | Open in IMG/M |
| 3300021961|Ga0222714_10340251 | Not Available | 809 | Open in IMG/M |
| 3300021962|Ga0222713_10059891 | Not Available | 2864 | Open in IMG/M |
| 3300022179|Ga0181353_1063742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 950 | Open in IMG/M |
| 3300022190|Ga0181354_1053251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1346 | Open in IMG/M |
| 3300022752|Ga0214917_10009238 | Not Available | 9484 | Open in IMG/M |
| 3300023174|Ga0214921_10225780 | Not Available | 1132 | Open in IMG/M |
| 3300024490|Ga0255185_1014648 | Not Available | 1121 | Open in IMG/M |
| 3300025091|Ga0209616_1019178 | Not Available | 691 | Open in IMG/M |
| 3300027114|Ga0208009_1025530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1278 | Open in IMG/M |
| 3300027139|Ga0255082_1035200 | Not Available | 802 | Open in IMG/M |
| 3300027156|Ga0255078_1055910 | Not Available | 787 | Open in IMG/M |
| 3300027286|Ga0255129_1007761 | Not Available | 2221 | Open in IMG/M |
| 3300027290|Ga0255136_1073003 | Not Available | 505 | Open in IMG/M |
| 3300027333|Ga0255138_1005086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2825 | Open in IMG/M |
| 3300027743|Ga0209593_10008155 | All Organisms → Viruses | 4343 | Open in IMG/M |
| 3300027743|Ga0209593_10064922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1383 | Open in IMG/M |
| 3300027743|Ga0209593_10245568 | Not Available | 623 | Open in IMG/M |
| 3300027760|Ga0209598_10157253 | Not Available | 1002 | Open in IMG/M |
| 3300027769|Ga0209770_10230582 | Not Available | 723 | Open in IMG/M |
| 3300027797|Ga0209107_10053366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2271 | Open in IMG/M |
| 3300027804|Ga0209358_10064902 | All Organisms → cellular organisms → Bacteria | 2111 | Open in IMG/M |
| 3300027804|Ga0209358_10307126 | Not Available | 777 | Open in IMG/M |
| 3300027900|Ga0209253_10023741 | Not Available | 5162 | Open in IMG/M |
| 3300027963|Ga0209400_1010629 | All Organisms → Viruses | 5841 | Open in IMG/M |
| 3300027973|Ga0209298_10361898 | Not Available | 552 | Open in IMG/M |
| (restricted) 3300028044|Ga0247838_1040937 | Not Available | 2486 | Open in IMG/M |
| 3300028269|Ga0255193_1007278 | Not Available | 1650 | Open in IMG/M |
| 3300031707|Ga0315291_11246305 | Not Available | 604 | Open in IMG/M |
| 3300031758|Ga0315907_10198272 | Not Available | 1683 | Open in IMG/M |
| 3300031857|Ga0315909_10206165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1552 | Open in IMG/M |
| 3300031885|Ga0315285_10124758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2190 | Open in IMG/M |
| 3300031951|Ga0315904_10211694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1892 | Open in IMG/M |
| 3300031951|Ga0315904_10369877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1311 | Open in IMG/M |
| 3300032050|Ga0315906_10418750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1160 | Open in IMG/M |
| 3300032050|Ga0315906_11099589 | Not Available | 587 | Open in IMG/M |
| 3300032116|Ga0315903_10128237 | Not Available | 2367 | Open in IMG/M |
| 3300032163|Ga0315281_10279864 | Not Available | 1829 | Open in IMG/M |
| 3300032397|Ga0315287_10282870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1952 | Open in IMG/M |
| 3300034108|Ga0335050_0173486 | Not Available | 1148 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 13.51% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.11% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 6.31% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.31% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.31% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.41% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.50% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.50% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.50% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.60% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.70% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.70% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.70% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.80% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.90% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.90% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.90% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.90% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.90% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.90% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.90% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.90% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.90% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.90% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002273 | Freshwater microbial communities from Lake Mendota, WI - 29JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002371 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009433 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012282 | Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300014801 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Filtered water - FW | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017699 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020571 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027156 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027286 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d | Environmental | Open in IMG/M |
| 3300027290 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8d | Environmental | Open in IMG/M |
| 3300027333 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028044 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_15m | Environmental | Open in IMG/M |
| 3300028269 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM31_101886652 | 3300001851 | Marine Plankton | MQWLEVELKEVKRQLLQQDLEAAKQQNDVVLSDEEDPTFIAS* |
| B570J29588_1072102 | 3300002273 | Freshwater | TTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| B570J29602_10050061 | 3300002371 | Freshwater | SQWNKSYLEQGKLTTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| JGI26470J50227_10480052 | 3300003375 | Freshwater | MTADMQWLEVELKEIKRQLLQQDLENVKEQNTVVFNEEEDPSYIAS* |
| JGI25909J50240_10618771 | 3300003393 | Freshwater Lake | MQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| JGI25926J51410_10513422 | 3300003490 | Freshwater Lake | MQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS* |
| Ga0049081_101288712 | 3300005581 | Freshwater Lentic | MQWLEVELKEVKRQILQQDLEIARQENNLVLSEDEDPAFIAS* |
| Ga0078894_116329482 | 3300005662 | Freshwater Lake | MQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEEDPAFIAS* |
| Ga0079957_11109002 | 3300005805 | Lake | MQWLEVELKEVKRQMVQQDLEVAKQENNLVLSEEEDPAFIAS* |
| Ga0073926_100524101 | 3300005943 | Sand | MQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIA |
| Ga0075466_11906202 | 3300006029 | Aqueous | MQWLDVELKEVKRQILQQDLEAARQENNLVLSEDEDPA |
| Ga0075465_101012381 | 3300006037 | Aqueous | MQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS* |
| Ga0070749_100623975 | 3300006802 | Aqueous | MQWLEVELKEVKRQMVQQDLELAKQQNNVVLSEEEDPAFIAS* |
| Ga0075464_100994203 | 3300006805 | Aqueous | MQWLEVELKEVKRQILQQDLEIAKQENNLVLSEDEDPAFIAS* |
| Ga0075464_105258452 | 3300006805 | Aqueous | WNKLFLEQGRLTTDMQWLEVELKEVKRQMVQQDLELARQQNNVVLSEEEDPAFIAS* |
| Ga0075472_103428521 | 3300006917 | Aqueous | MQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPTFIAS* |
| Ga0070748_12005491 | 3300006920 | Aqueous | MQWLDVELKEVKRQILQQDLEAAKQENNLVLSEDEDPAFIAS* |
| Ga0079302_10435311 | 3300007165 | Deep Subsurface | GKLTTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEDEDPAFIAS* |
| Ga0079302_11035621 | 3300007165 | Deep Subsurface | GKLTTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| Ga0099851_11977932 | 3300007538 | Aqueous | MQWLDVELKEVKRQILQQDLEAARQQNNVVLSEEEDPTFIAS* |
| Ga0099846_13423632 | 3300007542 | Aqueous | MQWLEVELKEVKRQILQQDLEAAKQQNNVVLSEEEDPTFIAS |
| Ga0102828_10049913 | 3300007559 | Estuarine | MQWLDVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS* |
| Ga0102863_10575833 | 3300007622 | Estuarine | MQWLDVELKEVKRQILQQDLEAARQENNLVLSEDEDPAFIAS* |
| Ga0104986_17987 | 3300007734 | Freshwater | MQWLDVELKEVKRQILQQDLETARQQNNVVLSEEEDPAFIAS* |
| Ga0105745_10319823 | 3300007972 | Estuary Water | MQWLEVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| Ga0114363_10272311 | 3300008266 | Freshwater, Plankton | SQWNKSYLEQGRLTTDMQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS* |
| Ga0114363_11217803 | 3300008266 | Freshwater, Plankton | EQGKLTTDMQWLDVMLKEVKRQILQQDLENARQQNNVVLSEEEDPTFIAS* |
| Ga0114363_11271712 | 3300008266 | Freshwater, Plankton | SQWNKSYLEQGRLTTDMQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEEDPAFIAS* |
| Ga0114364_11639342 | 3300008267 | Freshwater, Plankton | RSYLEQGKLTTDMQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS* |
| Ga0114364_11658021 | 3300008267 | Freshwater, Plankton | YLEQGKLTTDMQWLEVELKEVKRQILQQDLDAARQENNFVLSEEEDPAFIAS* |
| Ga0114876_10709253 | 3300008448 | Freshwater Lake | MQWLEVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIA |
| Ga0114876_11336243 | 3300008448 | Freshwater Lake | EVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| Ga0114880_11354433 | 3300008450 | Freshwater Lake | RLTTDMQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS* |
| Ga0102816_11734323 | 3300008999 | Estuarine | MQWLEVELKEVKRQILQQDLDAAKQENNLVLSEEEDPAFIAS* |
| Ga0105103_101608272 | 3300009085 | Freshwater Sediment | MQWLDVELKEVKRQIVQQDLEAAKQEFNLVLSEEEDPAFIAS* |
| Ga0115026_108078762 | 3300009111 | Wetland | MQWLDVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS* |
| Ga0114962_103607472 | 3300009151 | Freshwater Lake | MQWLEVELKEVKRLMIQQDLEAAKQQNDVVFSEEEDPAFIAS* |
| Ga0114980_101521193 | 3300009152 | Freshwater Lake | MQWLEVELKEVKRQMVQQDLELARQQNNVVLSEEEDPAFIAS* |
| Ga0114970_101755633 | 3300009163 | Freshwater Lake | MQWLEVELKEVKRQILQQDLEFARQENNLVLSEEEDPAFIAS* |
| Ga0105104_100610773 | 3300009168 | Freshwater Sediment | MQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPSFIAS* |
| Ga0105104_101305313 | 3300009168 | Freshwater Sediment | MQWLDVMLKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| Ga0105104_109033292 | 3300009168 | Freshwater Sediment | MQWLEVELKEVKRQILQQDLENAKQQNNVVLSEEEDPAFIAS* |
| Ga0114974_102561771 | 3300009183 | Freshwater Lake | MQWLEVELKEVKRQMVQQDLELARQQNDVVFSEEEDPAFIAS* |
| Ga0115545_13088083 | 3300009433 | Pelagic Marine | MQWLDVELKEVKRQILQQDLEAAKQENNLVLSEEEDP |
| Ga0115546_10166505 | 3300009435 | Pelagic Marine | MQWLEVELKEVKRQILQQDLEAAKQENNLVLSEDEDPAFIAS* |
| Ga0129333_105802831 | 3300010354 | Freshwater To Marine Saline Gradient | KIDLESQWNKSYLEQGKLTTDMQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS* |
| Ga0129333_106306463 | 3300010354 | Freshwater To Marine Saline Gradient | ELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| Ga0139557_10369792 | 3300011010 | Freshwater | LEVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS* |
| Ga0119931_10245312 | 3300011984 | Drinking Water Treatment Plant | MQWLEVELKEVKRQILQQDLETARQQNNVVLSEEEDPAFIAS* |
| Ga0157136_10043732 | 3300012282 | Freshwater | NRSYLEQGKLTTDMQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS* |
| Ga0157210_10487171 | 3300012665 | Freshwater | MQWLEVELKEVKRQMVQQDLGVARQQNNVVLSEEEDPAFIAS* |
| Ga0164293_107606782 | 3300013004 | Freshwater | MQWLEVELKEVKRQILQQDLEAAKQENNLVLSEEEDPAFIAS* |
| (restricted) Ga0172374_11578002 | 3300013122 | Freshwater | MQWLEVELKEVKRQILQQDQEAARQENNLVLSEEEDPAFIAS* |
| (restricted) Ga0172366_102291652 | 3300013128 | Sediment | MQWLEVELKEVKRQILQQDQEAAKQENNLVLSEEEDPAFIAS* |
| Ga0119946_10108792 | 3300014801 | Aquatic | MQWLDVELKEVKRQILQQDLEIARQQNNVVLSEEEDPAFIAS* |
| Ga0119960_10259411 | 3300014811 | Aquatic | FPSHDRAEKINLESQWNKLFLEQGRLTTDMQWLEVELKEVKRQMVQQDLELARQQNNVVLSEEEDPAFIAS* |
| Ga0181345_1000975 | 3300017699 | Freshwater Lake | MQWLDVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS |
| Ga0181363_10228612 | 3300017707 | Freshwater Lake | MQWLEVELKEVKRQILQQDLEVAKQENNVVLSEEEDPAFIAS |
| Ga0181344_11645821 | 3300017754 | Freshwater Lake | MQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIA |
| Ga0181349_12433261 | 3300017778 | Freshwater Lake | NRSYLEQGKLTTDMQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS |
| Ga0181563_106629102 | 3300018420 | Salt Marsh | MQWLEVELKEVKRQMVQQDLELARQQNNVVLSEEEDPAFIAS |
| Ga0181361_1052263 | 3300019783 | Freshwater Lake | RMQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS |
| Ga0181361_1156012 | 3300019783 | Freshwater Lake | LEQGKLTTDMQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS |
| Ga0181359_10009745 | 3300019784 | Freshwater Lake | MQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS |
| Ga0207193_12036893 | 3300020048 | Freshwater Lake Sediment | MQWLEVELKEVKRQILQQDLEAAKQENNLVLSEEEDPAFIAS |
| Ga0211733_101200563 | 3300020160 | Freshwater | MQWLEVELKEVKRQILQQDLDAAKQENNLVLSEEEDPAFIAS |
| Ga0211729_102670541 | 3300020172 | Freshwater | QWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0194115_100232619 | 3300020183 | Freshwater Lake | MQWLEVELKEVKRQILQQDQEAARQENNLVLSEEEDPAFIAS |
| Ga0208091_10134003 | 3300020506 | Freshwater | EQGKLTTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEDEDPAFIAS |
| Ga0207942_10098993 | 3300020549 | Freshwater | WNKSYLEQGKLTTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEDEDPAFIAS |
| Ga0208723_10266392 | 3300020571 | Freshwater | TDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEDEDPAFIAS |
| Ga0222715_101770553 | 3300021960 | Estuarine Water | MQWLEVELKEVKRQILQQDLEIARQENNLVLSEDEDPAFIAS |
| Ga0222714_103402511 | 3300021961 | Estuarine Water | YLEQGRLTTDMQWLEVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0222713_100598912 | 3300021962 | Estuarine Water | MQWLEVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0181353_10637421 | 3300022179 | Freshwater Lake | SYLEQGRLTTDMQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS |
| Ga0181354_10532514 | 3300022190 | Freshwater Lake | QWNRSYLEQGKLTTDMQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS |
| Ga0214917_100092383 | 3300022752 | Freshwater | MQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPTFIAS |
| Ga0214921_102257802 | 3300023174 | Freshwater | MQWLEVELKEVKRQILQQDLEVARQQNNVVLSEEEDPAFIAS |
| Ga0255185_10146481 | 3300024490 | Freshwater | MQWLDVMLKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0209616_10191782 | 3300025091 | Freshwater | LTTDMQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEEDPAFIAS |
| Ga0208009_10255301 | 3300027114 | Deep Subsurface | LEQGKLTTDMQWLEVELKEVKRQILQQDLEAAKQENNLVLSEDEDPAFIAS |
| Ga0255082_10352002 | 3300027139 | Freshwater | WLEVELKEVKRQILQQDLDAAKQENNLVLSEEEDPAFIAS |
| Ga0255078_10559101 | 3300027156 | Freshwater | KIDLESQWNRSYLEQGKLTTDMQWLEVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0255129_10077612 | 3300027286 | Freshwater | MQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPTFIAS |
| Ga0255136_10730032 | 3300027290 | Freshwater | QWNKSYLEQGKLTTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0255138_10050863 | 3300027333 | Freshwater | MQWLDVELKEVKQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0209593_100081555 | 3300027743 | Freshwater Sediment | MQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPSFIAS |
| Ga0209593_100649224 | 3300027743 | Freshwater Sediment | LDVMLKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0209593_102455681 | 3300027743 | Freshwater Sediment | MQWLDVMLKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS |
| Ga0209598_101572531 | 3300027760 | Freshwater Lake | MQWLDVELKEIKRQMVQQDLEDARQENNLVLSEEEDPAFIAS |
| Ga0209770_102305821 | 3300027769 | Freshwater Lake | SQWNKSYLEQGKLTTDMQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0209107_100533664 | 3300027797 | Freshwater And Sediment | MQWLDVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIASKLVI |
| Ga0209358_100649025 | 3300027804 | Freshwater Lake | KIDLESQWNKSYLEQGRLTTDMQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS |
| Ga0209358_103071261 | 3300027804 | Freshwater Lake | KIDLESQWNKSYLEQGRLTTDMQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEEDPAFIAS |
| Ga0209253_100237414 | 3300027900 | Freshwater Lake Sediment | MQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEEDPTFIAS |
| Ga0209400_10106293 | 3300027963 | Freshwater Lake | MQWLEVELKEVKRQILQQDLEFARQENNLVLSEEEDPAFIAS |
| Ga0209298_103618981 | 3300027973 | Freshwater Lake | DVELKEVKRQILQQDLEAARQENNLVLSEEEDPAFIAS |
| (restricted) Ga0247838_10409371 | 3300028044 | Freshwater | MQWLDVMLKEVKRQILQQDLEAARQENNLVLSEEEDPAFIA |
| Ga0255193_10072783 | 3300028269 | Freshwater | MQWLEVELKEVKRQILQQDLEAARQENNLVLSEDEDPAFIAS |
| Ga0315291_112463052 | 3300031707 | Sediment | KIDLESQWNRSYLEQGKLTTDMQWLEVELKEVKRQILQQDLDAARQENNLVLSEEEDPAFIAS |
| Ga0315907_101982724 | 3300031758 | Freshwater | MQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEED |
| Ga0315909_102061651 | 3300031857 | Freshwater | DLESQWNKSYLEQGRLTTDMQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEEDPAFIA |
| Ga0315285_101247582 | 3300031885 | Sediment | MQWLDVMLKEVKREILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0315904_102116943 | 3300031951 | Freshwater | MQWLDVELKEVKRQILQQDLEAAKQENNLVLSEEEDPAFIAS |
| Ga0315904_103698771 | 3300031951 | Freshwater | EVELKEVKRQILQQDLEIARQENNLVLSEDEDPAFIAS |
| Ga0315906_104187501 | 3300032050 | Freshwater | RLTTDMQWLEVELKEVKRQILQQDLEAARQQNNVVLSEEEDPAFIAS |
| Ga0315906_110995892 | 3300032050 | Freshwater | WLDVELKEVKRQILQQDLEAARQENNLVLSEDEDPAFIAS |
| Ga0315903_101282375 | 3300032116 | Freshwater | SYLEQGRLTTDMQWLEVELKEVKRQILQQDLEVAKQENNLVLSEEEDPAFIAS |
| Ga0315281_102798641 | 3300032163 | Sediment | MQWLEVELKEVKRQILQQDLDAAKQENNLVLSEEEDPAFIA |
| Ga0315287_102828701 | 3300032397 | Sediment | TTDMQWLDVMLKEVKREILQQDLEAARQENNLVLSEEEDPAFIAS |
| Ga0335050_0173486_1041_1148 | 3300034108 | Freshwater | MQWLDVELKEVKRQILQQDLEAARQENNLVLSEEED |
| ⦗Top⦘ |