| Basic Information | |
|---|---|
| Family ID | F085385 |
| Family Type | Metagenome |
| Number of Sequences | 111 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MYAIQEVAMWMLLGVLTGFTGGYTLGLKEGKREGFIRGKIAARKNAESR |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.98 % |
| % of genes near scaffold ends (potentially truncated) | 18.02 % |
| % of genes from short scaffolds (< 2000 bps) | 66.67 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (45.946 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.523 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.054 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (47.748 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.44% β-sheet: 0.00% Coil/Unstructured: 41.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF05257 | CHAP | 20.72 |
| PF01844 | HNH | 3.60 |
| PF03354 | TerL_ATPase | 2.70 |
| PF04860 | Phage_portal | 1.80 |
| PF12850 | Metallophos_2 | 0.90 |
| PF04586 | Peptidase_S78 | 0.90 |
| PF05065 | Phage_capsid | 0.90 |
| PF05869 | Dam | 0.90 |
| PF14279 | HNH_5 | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 2.70 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.90 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.05 % |
| Unclassified | root | N/A | 45.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002835|B570J40625_100770793 | Not Available | 850 | Open in IMG/M |
| 3300003277|JGI25908J49247_10093886 | Not Available | 727 | Open in IMG/M |
| 3300003413|JGI25922J50271_10055317 | Not Available | 883 | Open in IMG/M |
| 3300004481|Ga0069718_15573812 | Not Available | 1605 | Open in IMG/M |
| 3300004481|Ga0069718_15699356 | Not Available | 887 | Open in IMG/M |
| 3300005581|Ga0049081_10062582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1401 | Open in IMG/M |
| 3300005582|Ga0049080_10115421 | Not Available | 909 | Open in IMG/M |
| 3300005584|Ga0049082_10269610 | Not Available | 572 | Open in IMG/M |
| 3300005662|Ga0078894_10686292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300006802|Ga0070749_10189708 | Not Available | 1181 | Open in IMG/M |
| 3300006805|Ga0075464_10319144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300006805|Ga0075464_10746705 | Not Available | 607 | Open in IMG/M |
| 3300006805|Ga0075464_10755011 | Not Available | 603 | Open in IMG/M |
| 3300006805|Ga0075464_10896042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300006805|Ga0075464_11052362 | Not Available | 512 | Open in IMG/M |
| 3300006863|Ga0075459_1038154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
| 3300006920|Ga0070748_1089840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
| 3300006920|Ga0070748_1269052 | Not Available | 610 | Open in IMG/M |
| 3300007708|Ga0102859_1014110 | Not Available | 2020 | Open in IMG/M |
| 3300007708|Ga0102859_1049266 | All Organisms → Viruses → Predicted Viral | 1165 | Open in IMG/M |
| 3300007708|Ga0102859_1108176 | Not Available | 802 | Open in IMG/M |
| 3300007734|Ga0104986_1432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14961 | Open in IMG/M |
| 3300008107|Ga0114340_1012351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4192 | Open in IMG/M |
| 3300008114|Ga0114347_1013708 | Not Available | 3985 | Open in IMG/M |
| 3300008266|Ga0114363_1001407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14251 | Open in IMG/M |
| 3300008266|Ga0114363_1005301 | Not Available | 6614 | Open in IMG/M |
| 3300008266|Ga0114363_1038737 | Not Available | 1961 | Open in IMG/M |
| 3300008450|Ga0114880_1157598 | Not Available | 810 | Open in IMG/M |
| 3300009037|Ga0105093_10140657 | Not Available | 1202 | Open in IMG/M |
| 3300009082|Ga0105099_10159416 | Not Available | 1275 | Open in IMG/M |
| 3300009164|Ga0114975_10058860 | Not Available | 2254 | Open in IMG/M |
| 3300009181|Ga0114969_10233056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1115 | Open in IMG/M |
| 3300009181|Ga0114969_10341493 | Not Available | 872 | Open in IMG/M |
| 3300009183|Ga0114974_10004309 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10644 | Open in IMG/M |
| 3300009183|Ga0114974_10279322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
| 3300009184|Ga0114976_10087402 | All Organisms → Viruses → Predicted Viral | 1791 | Open in IMG/M |
| 3300009184|Ga0114976_10471091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300009419|Ga0114982_1057828 | Not Available | 1217 | Open in IMG/M |
| 3300009419|Ga0114982_1069477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
| 3300010885|Ga0133913_10321228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4099 | Open in IMG/M |
| 3300012665|Ga0157210_1002253 | All Organisms → cellular organisms → Bacteria | 5125 | Open in IMG/M |
| 3300012665|Ga0157210_1012731 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
| 3300012665|Ga0157210_1048056 | Not Available | 653 | Open in IMG/M |
| 3300013005|Ga0164292_10237766 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300013005|Ga0164292_10511556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 786 | Open in IMG/M |
| 3300014811|Ga0119960_1021468 | Not Available | 837 | Open in IMG/M |
| 3300014811|Ga0119960_1047536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 699 | Open in IMG/M |
| 3300017722|Ga0181347_1129648 | Not Available | 700 | Open in IMG/M |
| 3300017754|Ga0181344_1000606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14114 | Open in IMG/M |
| 3300017766|Ga0181343_1010375 | Not Available | 3010 | Open in IMG/M |
| 3300017774|Ga0181358_1049887 | Not Available | 1587 | Open in IMG/M |
| 3300017785|Ga0181355_1376482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300019784|Ga0181359_1008829 | Not Available | 3498 | Open in IMG/M |
| 3300020048|Ga0207193_1548246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 768 | Open in IMG/M |
| 3300020205|Ga0211731_10502351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2605 | Open in IMG/M |
| 3300020205|Ga0211731_10601549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6889 | Open in IMG/M |
| 3300020551|Ga0208360_1011164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
| 3300021963|Ga0222712_10004613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14313 | Open in IMG/M |
| 3300024289|Ga0255147_1029655 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
| 3300024298|Ga0255178_1014480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1683 | Open in IMG/M |
| 3300024306|Ga0255148_1032689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300024352|Ga0255142_1058567 | Not Available | 588 | Open in IMG/M |
| 3300024354|Ga0255171_1047507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300024496|Ga0255151_1000975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7168 | Open in IMG/M |
| 3300024509|Ga0255175_1073310 | Not Available | 617 | Open in IMG/M |
| 3300025889|Ga0208644_1342196 | Not Available | 574 | Open in IMG/M |
| 3300025889|Ga0208644_1362424 | Not Available | 548 | Open in IMG/M |
| 3300027710|Ga0209599_10050839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
| 3300027710|Ga0209599_10138232 | Not Available | 646 | Open in IMG/M |
| 3300027710|Ga0209599_10214856 | Not Available | 521 | Open in IMG/M |
| 3300027732|Ga0209442_1276251 | Not Available | 590 | Open in IMG/M |
| 3300027734|Ga0209087_1038106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2260 | Open in IMG/M |
| 3300027759|Ga0209296_1106578 | Not Available | 1328 | Open in IMG/M |
| 3300027764|Ga0209134_10178046 | Not Available | 732 | Open in IMG/M |
| 3300027836|Ga0209230_10614932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300027900|Ga0209253_10406633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
| 3300027969|Ga0209191_1079563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
| 3300027971|Ga0209401_1045396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2023 | Open in IMG/M |
| 3300028025|Ga0247723_1001560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13317 | Open in IMG/M |
| 3300028025|Ga0247723_1072224 | Not Available | 927 | Open in IMG/M |
| 3300028394|Ga0304730_1027884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2962 | Open in IMG/M |
| 3300031758|Ga0315907_10058353 | Not Available | 3373 | Open in IMG/M |
| 3300031787|Ga0315900_10123899 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2454 | Open in IMG/M |
| 3300031857|Ga0315909_10009939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10211 | Open in IMG/M |
| 3300031857|Ga0315909_10097579 | Not Available | 2543 | Open in IMG/M |
| 3300031857|Ga0315909_10918126 | Not Available | 538 | Open in IMG/M |
| 3300031951|Ga0315904_10301021 | Not Available | 1503 | Open in IMG/M |
| 3300032116|Ga0315903_11018034 | Not Available | 578 | Open in IMG/M |
| 3300033993|Ga0334994_0003672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11002 | Open in IMG/M |
| 3300033993|Ga0334994_0007172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7804 | Open in IMG/M |
| 3300033993|Ga0334994_0225707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300033993|Ga0334994_0339316 | Not Available | 748 | Open in IMG/M |
| 3300033993|Ga0334994_0396617 | Not Available | 668 | Open in IMG/M |
| 3300034061|Ga0334987_0003657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14654 | Open in IMG/M |
| 3300034062|Ga0334995_0069459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2780 | Open in IMG/M |
| 3300034062|Ga0334995_0766769 | Not Available | 533 | Open in IMG/M |
| 3300034093|Ga0335012_0302449 | Not Available | 811 | Open in IMG/M |
| 3300034101|Ga0335027_0002783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15306 | Open in IMG/M |
| 3300034101|Ga0335027_0003316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14172 | Open in IMG/M |
| 3300034101|Ga0335027_0044952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3607 | Open in IMG/M |
| 3300034101|Ga0335027_0145720 | All Organisms → Viruses → Predicted Viral | 1745 | Open in IMG/M |
| 3300034102|Ga0335029_0002362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14986 | Open in IMG/M |
| 3300034102|Ga0335029_0003183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13013 | Open in IMG/M |
| 3300034102|Ga0335029_0140794 | Not Available | 1661 | Open in IMG/M |
| 3300034103|Ga0335030_0006139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9342 | Open in IMG/M |
| 3300034104|Ga0335031_0070341 | Not Available | 2496 | Open in IMG/M |
| 3300034104|Ga0335031_0142165 | All Organisms → Viruses → Predicted Viral | 1664 | Open in IMG/M |
| 3300034104|Ga0335031_0258180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1152 | Open in IMG/M |
| 3300034104|Ga0335031_0487980 | Not Available | 752 | Open in IMG/M |
| 3300034112|Ga0335066_0306107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
| 3300034121|Ga0335058_0041634 | All Organisms → Viruses → Predicted Viral | 2695 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.52% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.71% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 9.91% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.31% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 6.31% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.50% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.50% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.70% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.70% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.70% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.80% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.80% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 1.80% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.80% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.90% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024354 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d | Environmental | Open in IMG/M |
| 3300024496 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300024509 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8d | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1007707932 | 3300002835 | Freshwater | MYAFQEVAMWMLLGVLTGFVGGYSLGMKEGKREGFIRGKIAARTLKEYRD* |
| JGI25908J49247_100938862 | 3300003277 | Freshwater Lake | MYTLGEVAAWLLIGVLMGFISGYTLGLKEGKREGFVRGKIAARKGDR* |
| JGI25922J50271_100553172 | 3300003413 | Freshwater Lake | MYSIGEVAMWLLIGVAIGFTFGYTAGLKEGKREGFIRGKIAARKAVR* |
| Ga0069718_155738122 | 3300004481 | Sediment | MYAFQEVAMWMLLGVLAGFTAGYTMGLKDGKREGFIRGKIAGRKNAEIR* |
| Ga0069718_156993562 | 3300004481 | Sediment | MYAIQEVAMWMLLGVLTGFTGGYTLGLKEGKREGFIRGKIAARKNAESR* |
| Ga0049081_100625821 | 3300005581 | Freshwater Lentic | MYAFQEVAMWMLFGVFTGFMAGYAIGRKEGKREGFIRGKVAARRNVEIR* |
| Ga0049080_101154213 | 3300005582 | Freshwater Lentic | EVAMWMLFGVFTGFMAGYAIGRKEGKREGFIRGKVAARRNVEIR* |
| Ga0049082_102696101 | 3300005584 | Freshwater Lentic | MYTLGEVAAWLLLGVLMGFTSGYTLGLKEGKREGFIRGRIAGRKNAEIR* |
| Ga0078894_106862922 | 3300005662 | Freshwater Lake | MYTIMEVAAWMMLGVLTGFTGGYTVGLKEGKREGFIRGKIAARRNAEIR* |
| Ga0070749_101897084 | 3300006802 | Aqueous | MYTITEVAAWMMLGILTGFTGGYTLGLKEGKREGYIRGKIAGRRNAEYRD* |
| Ga0075464_103191443 | 3300006805 | Aqueous | MYTFQEVAMWMLLGVAIGFVSGYTAGLKEGKREGFIRGKIAARKKMELR* |
| Ga0075464_107467051 | 3300006805 | Aqueous | NMYTFQEVAMWMLLGILTGFTGGYTMGLKEGKREGFIRGKIAARRNAEIR* |
| Ga0075464_107550111 | 3300006805 | Aqueous | MYTFQEVAMWMLLGILSGFTGGYTLGLKEGKREGYIRGKIAGRRNAEYRD* |
| Ga0075464_108960422 | 3300006805 | Aqueous | MYTFMEVAMWMLLGVGIGFVSGFTAGLKEGKREGYIRGKIAGRRKAE |
| Ga0075464_110523621 | 3300006805 | Aqueous | KMYTFQEVAMWMLLGVAIGFVSGYTAGLKEGKREGFIRGKIAARRNAEIR* |
| Ga0075459_10381542 | 3300006863 | Aqueous | MYAFQEVAMWMLIGVLVGFTAGYTAGLKEGKREGFIRGKIAARKNAETR* |
| Ga0070748_10898401 | 3300006920 | Aqueous | MYTFMEVAMWMLLGAGIGFVSGFTAGLKEGKREGYIRGKIAGRRKAEYRD* |
| Ga0070748_12690521 | 3300006920 | Aqueous | MYTIGEVAMWMMLGVLVGFTSGYTLGLKEGKREGFIRGKIAARRNAEIR* |
| Ga0102859_10141105 | 3300007708 | Estuarine | MYTLGEVAAWLLLGVLIGFTSGYTLGLKEGKREGFIRGKIAARKNAEIR* |
| Ga0102859_10492661 | 3300007708 | Estuarine | VAMWMLLGVLAGFTGGYTMGLKDGKREGFIRGKIAGRKNVEIQ* |
| Ga0102859_11081762 | 3300007708 | Estuarine | MYTLGEVAAWLLLGVLMGFISGYTLGLKEGKREGFVRGRIAGRKNVEIR* |
| Ga0104986_14325 | 3300007734 | Freshwater | MYAIQEVAMWMLIASTIGFTIGYTVGLKEGKREGFIRGKIAARKSSEVR* |
| Ga0114340_10123516 | 3300008107 | Freshwater, Plankton | MYAIQEVAMWMLLGVLTGFVSGYTLGLKEGKREGFIRGKIAARKSLESR* |
| Ga0114347_10137085 | 3300008114 | Freshwater, Plankton | MYTIMEVAAWMMLGILTGFTGGYTLGLKEGKREGFIRGKIAARKAVNQ* |
| Ga0114363_100140716 | 3300008266 | Freshwater, Plankton | MYTIMEVAAWMMLGILTGFTGGYTLGLKEGKREGFIRGKIAARKNMEVR* |
| Ga0114363_10053013 | 3300008266 | Freshwater, Plankton | MYAFQEVAMWMLLGILSGFTGGYTLGLKEGKREGYIRGKIAGRRNAEYRD* |
| Ga0114363_10387373 | 3300008266 | Freshwater, Plankton | MYAFQEVAMWMLLGVLTGFVGGYSLGLKEGKREGFIRGKIAARKNAETR* |
| Ga0114880_11575981 | 3300008450 | Freshwater Lake | WMLLGVLTGFVGGYTLGQKDGKREGYIRGKIAGSRKAEYRD* |
| Ga0105093_101406571 | 3300009037 | Freshwater Sediment | METAAWMGLGIMSGFVGGYSLGMKEGKREGFIRGKVAARRSAEYRD* |
| Ga0105099_101594161 | 3300009082 | Freshwater Sediment | METAAWMGLGIMSGFVGGYSLGMKEGKREGFIRGKIAARRSAEYRD* |
| Ga0114975_100588602 | 3300009164 | Freshwater Lake | MYAFHEVAMWMLLGVLVGFTAGYTAGLKEGKREGFIRGKIAARRNQEIR* |
| Ga0114969_102330562 | 3300009181 | Freshwater Lake | MYTFQEAAIWMLLGVLTGFIAGYTAGLKEGKREGFIRGKIAARRNAEIR* |
| Ga0114969_103414932 | 3300009181 | Freshwater Lake | MYTFQEVTMWILLGVFLGFIVGYTAGLKEGKREGFIRGKIASRKKAEIR* |
| Ga0114974_100043094 | 3300009183 | Freshwater Lake | MYAFSEIVAWSLLGVLTGFTGGYASGFKEGKREGFIRGRIAASRKAVSQ* |
| Ga0114974_102793222 | 3300009183 | Freshwater Lake | MEVAMWMLLGVGIGFVSGFTAGLKEGKREGYIRGKIAGRRKAEYRD* |
| Ga0114976_100874024 | 3300009184 | Freshwater Lake | LIGVFMGFIVGYTAGLKEGKREGFIRGKIASRRKAEI* |
| Ga0114976_104710912 | 3300009184 | Freshwater Lake | MYTFQEVAMWMLLGVAIGFISGYTAGLKEGKREGFIRGKIAARRKAEIQ* |
| Ga0114982_10578284 | 3300009419 | Deep Subsurface | MYTIGEVAMWMMLGVLVGFTSGYTLGLKEGKREGFIRGKIAARKNMEVR* |
| Ga0114982_10694774 | 3300009419 | Deep Subsurface | MYAFQEVAMWMLIGVAIGFTFGYTLGLKEGKREGYIRGKIAGRRVAEYRD* |
| Ga0133913_103212284 | 3300010885 | Freshwater Lake | MYAFSEIVAWSLLGVLTGFTGGYASGFKEGRREGFIRGRIAASRKAVSQ* |
| Ga0157210_10022538 | 3300012665 | Freshwater | MYTFQEVAMWMLLGVAIGFVSGYTAGLKEGKREGFIRGKIAARRNAEIR* |
| Ga0157210_10127312 | 3300012665 | Freshwater | MYSIGEVAMWLLIGVAIGFTFGYTAGLKEGKREGFIRGKIAARKAVQ* |
| Ga0157210_10480562 | 3300012665 | Freshwater | MYTFQEVAIWMLLGVLTGFIAGYTAGLKEGKREGYIRGKIAGRRKAEYRD* |
| Ga0164292_102377664 | 3300013005 | Freshwater | MYSMGEVAMWLLISVAIGFTFGYTAGLKEGKREGFIRGKIAARKAVR* |
| Ga0164292_105115562 | 3300013005 | Freshwater | MMYSIGEVAMWLLIGVAIGFTFGYTAGLKEGKREGFIRGKIAARKAVR* |
| Ga0119960_10214681 | 3300014811 | Aquatic | FPSHDQGAKMYTFQEVAMWMLLGVAIGFVSGYTAGLKEGKREGFIRGKIAARRNAEIR* |
| Ga0119960_10475362 | 3300014811 | Aquatic | MYTFQEVAIWMLLGVLTGFIAGYTAGLKEGKREGFIRGKIAARRKAEIR* |
| Ga0181347_11296481 | 3300017722 | Freshwater Lake | LGEVAAWLLIGVLMGFISGYTLGLKEGKREGFVRGKIAARKGDR |
| Ga0181344_100060616 | 3300017754 | Freshwater Lake | MYTFQEVAMWMLLGVAIGFVSGYTAGLKEGKREGFIRGKIAARRNAEIR |
| Ga0181343_10103754 | 3300017766 | Freshwater Lake | MWMLLGVAIGFVSGYTAGLKEGKREGFIRGKIAARRNAEIR |
| Ga0181358_10498872 | 3300017774 | Freshwater Lake | MYTLGEVAAWLLIGVLMGFISAYTLGLKEGKREGFVRGKIAARKGDR |
| Ga0181355_13764822 | 3300017785 | Freshwater Lake | MYTIGEVAMWMLFGVFTGFMAGYAIGRKEGKREGFIRGKVAARRNVEIR |
| Ga0181359_10088293 | 3300019784 | Freshwater Lake | MYTLGEVAAWLLIGVLMGFISGYTLGLKEGKREGFVRGKIAARKGDR |
| Ga0207193_15482461 | 3300020048 | Freshwater Lake Sediment | MYSIGEVAMWLLIGVAIGFTFGYTAGLKEGKREGFIRGKSAARKAVR |
| Ga0211731_105023516 | 3300020205 | Freshwater | MYTITEVAAWLMLGVLTGFVGGYSLGLKEGKREGFIRGKIAARRSVEQR |
| Ga0211731_1060154910 | 3300020205 | Freshwater | MYTFQEVAMWMLLGVAIGFISGYTAGLKEGKREGFIRGKIAARKKMEIR |
| Ga0208360_10111642 | 3300020551 | Freshwater | MYTLAETAMWMLLGVGIGFTTGYTVGLKEGKREGFIRGKIAARRSLESR |
| Ga0222712_1000461316 | 3300021963 | Estuarine Water | MYTIQEVAIWMLLGVLAGFMAGYANGLREGKREGFIRGKVAARRNAEIR |
| Ga0255147_10296554 | 3300024289 | Freshwater | EVAMWLLIGVGIGFVGGYTAGLKEGKREGFIRGKIAARRSLESR |
| Ga0255178_10144802 | 3300024298 | Freshwater | MYTIGEVAMWLLIGVGIGFVGGYTAGLKEGKREGFIRGKIAARRSLESR |
| Ga0255148_10326891 | 3300024306 | Freshwater | MYAFQEVAMWMLIGVLVGFTTGYTAGLKEGKREGFIRGKIAARRNAEIR |
| Ga0255142_10585672 | 3300024352 | Freshwater | AMWLLIGVGIGFVGGYTAGLKEGKREGFIRGKIAARRSLESR |
| Ga0255171_10475072 | 3300024354 | Freshwater | MYAFQEVAMWMLIGVLVGFAAGYTAGLKEGKREGFIRGKIAARKIKEYRD |
| Ga0255151_10009752 | 3300024496 | Freshwater | MWLLIGVGIGFVGGYTAGLKEGKREGFIRGKIAARRSLESR |
| Ga0255175_10733101 | 3300024509 | Freshwater | GEVAMWLLIGVGIGFVGGYTAGLKEGKREGFIRGKIAARRSLESR |
| Ga0208644_13421962 | 3300025889 | Aqueous | MYTLAETAMWMLLGVGIGFATGYTVGLKEGKREGFIRGKIAARKSLESR |
| Ga0208644_13624242 | 3300025889 | Aqueous | MYAFQEVAAWMLLGVLVGFTAGYTLGLKDGKREGFIRGKIAARKNVEIR |
| Ga0209599_100508391 | 3300027710 | Deep Subsurface | MYAFQEVAMWMLIGVAIGFTFGYTLGLKEGKREGYIRGKIAGRRVAEYRD |
| Ga0209599_101382321 | 3300027710 | Deep Subsurface | MYTIGEVAMWMMLGVLVGFTSGYTLGLKEGKREGFIRGKIAARKNMEVR |
| Ga0209599_102148561 | 3300027710 | Deep Subsurface | YTIAEVGMWILIASTMGFTIGYTVGLKEGKREGFIRGKIAARRSLESR |
| Ga0209442_12762511 | 3300027732 | Freshwater Lake | LLIGVLMGFISGYTLGLKEGKREGFVRGKIAARKGDR |
| Ga0209087_10381063 | 3300027734 | Freshwater Lake | MYTFQEVAMWILIGVFMGFIVGYTAGLKEGKREGFIRGKIASRRKVEIQ |
| Ga0209296_11065783 | 3300027759 | Freshwater Lake | MYAFSEIVAWSLLGVLTGFTGGYASGFKEGKREGFIRGRIAASRKAVSQ |
| Ga0209134_101780462 | 3300027764 | Freshwater Lake | MYSIGEVAMWLLIGVAMGFTFGYTAGLKEGKREGFIRGKIAARKAVR |
| Ga0209230_106149322 | 3300027836 | Freshwater And Sediment | MYTLQEVAMWMLLGVGIGFASGYTAGLKEGKREGFIRGKIAARKAVK |
| Ga0209253_104066332 | 3300027900 | Freshwater Lake Sediment | MYTFQEVAMWMLLGVAIGFISGYTAGLKEGKREGFIRGKIAARRNAEIR |
| Ga0209191_10795634 | 3300027969 | Freshwater Lake | MYAFHEVAMWMLLGVLVGFTAGYTAGLKEGKREGFIRGKIAARRNQEIR |
| Ga0209401_10453966 | 3300027971 | Freshwater Lake | MYTFQEVAMWILLGVFSGFIVGYTAGLKEGKREGFIRGKIASRRKAEIQ |
| Ga0247723_100156016 | 3300028025 | Deep Subsurface Sediment | MYTIAEVGMWILIASTMGFTIGYTVGLKEGKREGFIRGKIAARRSLESR |
| Ga0247723_10722242 | 3300028025 | Deep Subsurface Sediment | MYTFQEVAMWMLMGVAIGFTFGYTLGLKEGKREGYIRGKIAGRRVSEYRD |
| Ga0304730_10278848 | 3300028394 | Freshwater Lake | MYTFQEVAMWILIGVLMGFIVGYTAGLKEGKREGFIRGKIASRRKAEIQ |
| Ga0315907_100583537 | 3300031758 | Freshwater | MYTIMEVAAWMMLGILTGFTGGYTLGLKEGKREGFIRGKIAARKAVNQ |
| Ga0315900_101238992 | 3300031787 | Freshwater | MYAIQEVAMWMLLGVLTGFVSGYTLGLKEGKREGFIRGKIAARKSLESR |
| Ga0315909_1000993914 | 3300031857 | Freshwater | MYAFQEVAMWMLLGILSGFTGGYTLGLKEGKREGYIRGKIAGRRNAEYRD |
| Ga0315909_100975795 | 3300031857 | Freshwater | MYAFQEVAMWMLLGVLTGFVGGYSLGLKEGKREGFIRGKIAARKNAETR |
| Ga0315909_109181262 | 3300031857 | Freshwater | MYAFQEVAMWMLLGVLTGFVGGYTLGQKDGKREGYIRGKIAGSRKAEYRD |
| Ga0315904_103010212 | 3300031951 | Freshwater | MEVAAWMMLGILTGFTGGYTLGLKEGKREGFIRGKIAARKAVNQ |
| Ga0315903_110180342 | 3300032116 | Freshwater | MYTIMEVAAWMMLGILTGFTGGYTLGLKEGKREGFIRGKIAARKNMEVR |
| Ga0334994_0003672_2817_2960 | 3300033993 | Freshwater | MYSIGEVAMWLLIGVAIGFTFGYTAGLKEGKREGFIRGKIAARKAVQ |
| Ga0334994_0007172_5451_5600 | 3300033993 | Freshwater | MYSIGEVAMWILISSLMGFTIGYTVGLKEGKREGFIRGKIAARKSLESR |
| Ga0334994_0225707_323_472 | 3300033993 | Freshwater | MYALQEVAAWMLFGVLTGFMSGYAIGRREGKREGFIRGKVAARRNVEIR |
| Ga0334994_0339316_201_353 | 3300033993 | Freshwater | MYAFQEVAMWMLLGVLTGFVGGYSLGMKEGKREGFIRGKIAARTLKEYRD |
| Ga0334994_0396617_318_464 | 3300033993 | Freshwater | MMYSIGEVAMWLLIGVAIGFTFGYTAGLKEGKREGFIRGKIAARKAVR |
| Ga0334987_0003657_2947_3096 | 3300034061 | Freshwater | MYALQEVAAWMLFGVLAGFTGGYTLGLKEGKREGFIRGRIAGRKNAEIR |
| Ga0334995_0069459_2547_2696 | 3300034062 | Freshwater | MYAFQEVAMWMLLGVLTGFVGGYSIGLKEGKREGFIRGKIAARKNMEQR |
| Ga0334995_0766769_287_430 | 3300034062 | Freshwater | MYALQEVAAWMLLGVLAGFTGGYTLGLKEGKREGFVRGKIAARKEIR |
| Ga0335012_0302449_683_811 | 3300034093 | Freshwater | MYAFQEVAMWMLLGVLAGFTGGYTMGLKDGKREGFIRGKIAGR |
| Ga0335027_0002783_2947_3096 | 3300034101 | Freshwater | MYALQEVAAWMLFGVLAGFTSGYALGLKEGKREGFIRGRIAGRKNAEIR |
| Ga0335027_0003316_11563_11715 | 3300034101 | Freshwater | MYAFQEVAMWMLFGVFTGFMAGYAIGRKEGKREGFIRGRIAANRKAEYRD |
| Ga0335027_0044952_3496_3606 | 3300034101 | Freshwater | MWLLIGVAIGFTFGYTAGLKEGKREGFIRGKIAARKA |
| Ga0335027_0145720_511_654 | 3300034101 | Freshwater | MYSIGEVAMWLLIGVAIGFTAGYTAGLKEGKREGFIRGKIAARKAVR |
| Ga0335029_0002362_4465_4614 | 3300034102 | Freshwater | MYAFQEVAMWMLLGVLVGFTAGYTLGLKDGKREGFIRGKIAGRKNVEIQ |
| Ga0335029_0003183_1318_1470 | 3300034102 | Freshwater | MYTIMEVAAWMMLGILTGFTGGYTLGQKEGKREGYIRGKIAGSRKAEYRD |
| Ga0335029_0140794_427_579 | 3300034102 | Freshwater | MYAFQEVAMWMLLGVLTGFVGGYSLGMKEGKREGFIRGKIAARTIREYRD |
| Ga0335030_0006139_2332_2481 | 3300034103 | Freshwater | MYAFQEVAMWMLFGVFTGFMAGYAIGRKEGKREGFIRGKVAARRNAEIR |
| Ga0335031_0070341_10_135 | 3300034104 | Freshwater | MWMLLGVLAGFTAGYTMGLKDGKREGFIRGKIAGRKNAEIR |
| Ga0335031_0142165_1379_1522 | 3300034104 | Freshwater | MYSIGEVAMWLLIGVAIGFTSGYTAGLKEGKREGFIRGKIAARKAVR |
| Ga0335031_0258180_143_292 | 3300034104 | Freshwater | MYAFQEVAMWMLLGVLTGFVGGYSIGIKEGKREGFIRGKIAARKNMEQR |
| Ga0335031_0487980_62_211 | 3300034104 | Freshwater | MYAFQEVAMWMLLGVLAGFTGGYTMGLKDGKREGFIRGKIAGRKNAEIR |
| Ga0335066_0306107_766_897 | 3300034112 | Freshwater | MYTIAEVGMWILIASTMGFTIGYTVGLKEGKREGFIRGKIAARR |
| Ga0335058_0041634_33_182 | 3300034121 | Freshwater | MYAFQEVAMWMLLGVLAGFTAGYTMGLKDGKREGFIRGKIAARKNAESR |
| ⦗Top⦘ |