| Basic Information | |
|---|---|
| Family ID | F085283 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 50 residues |
| Representative Sequence | DMRLGRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.90 % |
| % of genes near scaffold ends (potentially truncated) | 99.10 % |
| % of genes from short scaffolds (< 2000 bps) | 92.79 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.099 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (12.613 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.946 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (64.865 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 71.74% β-sheet: 0.00% Coil/Unstructured: 28.26% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF13413 | HTH_25 | 67.57 |
| PF13464 | DUF4115 | 13.51 |
| PF00994 | MoCF_biosynth | 12.61 |
| PF02464 | CinA | 3.60 |
| PF02834 | LigT_PEase | 0.90 |
| PF12760 | Zn_Tnp_IS1595 | 0.90 |
| PF02667 | SCFA_trans | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG1546 | Nicotinamide mononucleotide (NMN) deamidase PncC | Coenzyme transport and metabolism [H] | 3.60 |
| COG1514 | RNA 2',3'-cyclic phosphodiesterase (2'-5' RNA ligase) | Translation, ribosomal structure and biogenesis [J] | 0.90 |
| COG2031 | Short chain fatty acids transporter | Lipid transport and metabolism [I] | 0.90 |
| COG2978 | p-Aminobenzoyl-glutamate transporter AbgT | Coenzyme transport and metabolism [H] | 0.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.10 % |
| Unclassified | root | N/A | 0.90 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002155|JGI24033J26618_1075448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300002244|JGI24742J22300_10124564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300003990|Ga0055455_10025891 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1481 | Open in IMG/M |
| 3300005327|Ga0070658_10812200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
| 3300005328|Ga0070676_10123749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1627 | Open in IMG/M |
| 3300005328|Ga0070676_10938858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 646 | Open in IMG/M |
| 3300005329|Ga0070683_100273892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1605 | Open in IMG/M |
| 3300005332|Ga0066388_103829880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
| 3300005334|Ga0068869_101127849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 687 | Open in IMG/M |
| 3300005335|Ga0070666_10992024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300005339|Ga0070660_100466568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1048 | Open in IMG/M |
| 3300005339|Ga0070660_100665761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 872 | Open in IMG/M |
| 3300005341|Ga0070691_10411857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300005347|Ga0070668_100586450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300005353|Ga0070669_101197609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
| 3300005354|Ga0070675_100584106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1012 | Open in IMG/M |
| 3300005354|Ga0070675_100932055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 796 | Open in IMG/M |
| 3300005455|Ga0070663_100608637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 920 | Open in IMG/M |
| 3300005459|Ga0068867_100061030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2798 | Open in IMG/M |
| 3300005459|Ga0068867_102174135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300005530|Ga0070679_100177052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2105 | Open in IMG/M |
| 3300005535|Ga0070684_100289084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1503 | Open in IMG/M |
| 3300005546|Ga0070696_101263389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300005564|Ga0070664_100708101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 938 | Open in IMG/M |
| 3300005577|Ga0068857_100257918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1600 | Open in IMG/M |
| 3300005617|Ga0068859_100293982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1717 | Open in IMG/M |
| 3300005834|Ga0068851_10087877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1633 | Open in IMG/M |
| 3300005841|Ga0068863_102597433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300005842|Ga0068858_101625626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300005843|Ga0068860_100122722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2489 | Open in IMG/M |
| 3300006042|Ga0075368_10129273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
| 3300006852|Ga0075433_10252608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1564 | Open in IMG/M |
| 3300006852|Ga0075433_11702879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
| 3300006854|Ga0075425_101605551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 733 | Open in IMG/M |
| 3300006904|Ga0075424_100651150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1125 | Open in IMG/M |
| 3300006969|Ga0075419_11297892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
| 3300009093|Ga0105240_12074271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 590 | Open in IMG/M |
| 3300009094|Ga0111539_10716846 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300009162|Ga0075423_11761528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
| 3300009545|Ga0105237_11014402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
| 3300009870|Ga0131092_11170556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300010362|Ga0126377_13575182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| 3300010375|Ga0105239_10508611 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1370 | Open in IMG/M |
| 3300010396|Ga0134126_11795583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300011412|Ga0137424_1058133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300012896|Ga0157303_10025589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1041 | Open in IMG/M |
| 3300012897|Ga0157285_10076478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 875 | Open in IMG/M |
| 3300012910|Ga0157308_10011473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1825 | Open in IMG/M |
| 3300012912|Ga0157306_10241907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 631 | Open in IMG/M |
| 3300012943|Ga0164241_10436936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 940 | Open in IMG/M |
| 3300012951|Ga0164300_10469239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
| 3300012951|Ga0164300_11170846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 507 | Open in IMG/M |
| 3300012957|Ga0164303_10500087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 778 | Open in IMG/M |
| 3300012958|Ga0164299_10066838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1749 | Open in IMG/M |
| 3300012961|Ga0164302_10314929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1029 | Open in IMG/M |
| 3300012987|Ga0164307_10612703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 841 | Open in IMG/M |
| 3300012989|Ga0164305_12232423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
| 3300013102|Ga0157371_10457331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 939 | Open in IMG/M |
| 3300014312|Ga0075345_1193152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
| 3300014325|Ga0163163_11172312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
| 3300014745|Ga0157377_11678256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300014969|Ga0157376_11024352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 849 | Open in IMG/M |
| 3300015372|Ga0132256_101010686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 947 | Open in IMG/M |
| 3300015373|Ga0132257_100032635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 5660 | Open in IMG/M |
| 3300015374|Ga0132255_100980984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1266 | Open in IMG/M |
| 3300015374|Ga0132255_101325921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1086 | Open in IMG/M |
| 3300018076|Ga0184609_10568775 | Not Available | 511 | Open in IMG/M |
| 3300018469|Ga0190270_10772280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 964 | Open in IMG/M |
| 3300020081|Ga0206354_11706456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 939 | Open in IMG/M |
| 3300022892|Ga0247753_1021083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
| 3300022899|Ga0247795_1061642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300022915|Ga0247790_10058051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 901 | Open in IMG/M |
| 3300025907|Ga0207645_10788318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
| 3300025908|Ga0207643_10319344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 970 | Open in IMG/M |
| 3300025909|Ga0207705_10671895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
| 3300025913|Ga0207695_11497378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300025918|Ga0207662_10315459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1043 | Open in IMG/M |
| 3300025932|Ga0207690_10621591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 883 | Open in IMG/M |
| 3300025934|Ga0207686_11036326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300025937|Ga0207669_10624551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
| 3300025938|Ga0207704_11732147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300025944|Ga0207661_10672516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 952 | Open in IMG/M |
| 3300025949|Ga0207667_10226033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1917 | Open in IMG/M |
| 3300025949|Ga0207667_11743775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 588 | Open in IMG/M |
| 3300025986|Ga0207658_11797030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 559 | Open in IMG/M |
| 3300026041|Ga0207639_10027443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4149 | Open in IMG/M |
| 3300026041|Ga0207639_10484993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter | 1127 | Open in IMG/M |
| 3300026075|Ga0207708_11413942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300026089|Ga0207648_10124682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2265 | Open in IMG/M |
| 3300026089|Ga0207648_10130051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2216 | Open in IMG/M |
| 3300026089|Ga0207648_11655366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300026095|Ga0207676_10820125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 908 | Open in IMG/M |
| 3300027695|Ga0209966_1065577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 790 | Open in IMG/M |
| 3300028379|Ga0268266_11306800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 701 | Open in IMG/M |
| 3300028381|Ga0268264_10106997 | All Organisms → cellular organisms → Bacteria | 2442 | Open in IMG/M |
| 3300028587|Ga0247828_10174676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1099 | Open in IMG/M |
| 3300028589|Ga0247818_10838342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
| 3300028589|Ga0247818_11157520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300028597|Ga0247820_10312560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1031 | Open in IMG/M |
| 3300028809|Ga0247824_10233060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1016 | Open in IMG/M |
| 3300030336|Ga0247826_10453395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 959 | Open in IMG/M |
| 3300031226|Ga0307497_10708342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300031547|Ga0310887_10848422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300031562|Ga0310886_10186354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1121 | Open in IMG/M |
| 3300031913|Ga0310891_10359639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
| 3300031944|Ga0310884_10701489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 612 | Open in IMG/M |
| 3300032017|Ga0310899_10698680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
| 3300032401|Ga0315275_10585974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
| 3300033551|Ga0247830_10198896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1495 | Open in IMG/M |
| 3300033551|Ga0247830_10364672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300033551|Ga0247830_11244955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 12.61% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.21% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 6.31% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.41% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.41% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.70% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.70% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.80% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.90% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.90% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.90% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.90% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.90% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.90% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.90% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300003990 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24033J26618_10754482 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | DMRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| JGI24742J22300_101245642 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | GALRLDDMRLGRAGGRRTARLGXALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0055455_100258913 | 3300003990 | Natural And Restored Wetlands | IPVAVALGALAIWLGRTALRHDDARLGRAGGRRTARLGRALGVLGIALAATALVALCVYGLLTYLGER* |
| Ga0070658_108122001 | 3300005327 | Corn Rhizosphere | GRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0070676_101237491 | 3300005328 | Miscanthus Rhizosphere | ARGALRLDDMRLGRAGGRRTARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0070676_109388581 | 3300005328 | Miscanthus Rhizosphere | VGIALGILAVWLAREALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR* |
| Ga0070683_1002738921 | 3300005329 | Corn Rhizosphere | LGRGALRHDDVRLGRAGGRGSARVGRALGVLGIALAATCAVALAVYGILTYLGER* |
| Ga0066388_1038298802 | 3300005332 | Tropical Forest Soil | RAGGRRVAQFGRALGVLGIALAATGLVAVAVYGLLTYLGER* |
| Ga0068869_1011278492 | 3300005334 | Miscanthus Rhizosphere | ARGALRHDDVRLGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0070666_109920242 | 3300005335 | Switchgrass Rhizosphere | DIRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0070660_1004665681 | 3300005339 | Corn Rhizosphere | RLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0070660_1006657612 | 3300005339 | Corn Rhizosphere | RLGRAGGRRLARLGRALGVLGISLATTCAVALAVYGILTYLGER* |
| Ga0070691_104118572 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | EALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR* |
| Ga0070668_1005864502 | 3300005347 | Switchgrass Rhizosphere | DARLGRAGGRGAARLGQALAVLGIALAATALVALAVYGLLTYLGER* |
| Ga0070669_1011976092 | 3300005353 | Switchgrass Rhizosphere | LRHDDVRLGRAGGRGSARVGRALGVLGIALAATCAVALAVYGILTYLGER* |
| Ga0070675_1005841063 | 3300005354 | Miscanthus Rhizosphere | LGRAGGRRLARLGHGLGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0070675_1009320551 | 3300005354 | Miscanthus Rhizosphere | GGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0070663_1006086371 | 3300005455 | Corn Rhizosphere | RAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR* |
| Ga0068867_1000610301 | 3300005459 | Miscanthus Rhizosphere | LDDMRLGRAGGRRTARLGQALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0068867_1021741351 | 3300005459 | Miscanthus Rhizosphere | GLARSALHLDDMRLGRVGGRRLARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0070679_1001770521 | 3300005530 | Corn Rhizosphere | RAGGRRTARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0070684_1002890841 | 3300005535 | Corn Rhizosphere | VAIGLGRGALRHDDVRLGRAGGRGSARVGRALGVLGIALAATCAVALAVYGILTYLGER* |
| Ga0070696_1012633891 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | REALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR* |
| Ga0070664_1007081011 | 3300005564 | Corn Rhizosphere | IGLARGALRLDDMRLGRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0068857_1002579181 | 3300005577 | Corn Rhizosphere | RLGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0068859_1002939823 | 3300005617 | Switchgrass Rhizosphere | IRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0068851_100878773 | 3300005834 | Corn Rhizosphere | ALRLDDMRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0068863_1025974331 | 3300005841 | Switchgrass Rhizosphere | GRRLARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0068858_1016256261 | 3300005842 | Switchgrass Rhizosphere | AALRHDDARLGRAGGRGAARLGRALAVLGIALAATALVAIAVYGLLTYLGER* |
| Ga0068860_1001227224 | 3300005843 | Switchgrass Rhizosphere | RRLARLGRALGVIGISLAATCAVALAVYGILTYLGER* |
| Ga0075368_101292731 | 3300006042 | Populus Endosphere | GRGAARLGRALGVLGVALAATALVALAVYGLLTYLGER* |
| Ga0075433_102526083 | 3300006852 | Populus Rhizosphere | GLGRGALRHDDVRLGRAGGRGSARVGRALGVLGIALAATCAVALAVYGILTYLGER* |
| Ga0075433_117028792 | 3300006852 | Populus Rhizosphere | GLARGALRLDDIRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0075425_1016055511 | 3300006854 | Populus Rhizosphere | RGALRLDDMRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0075424_1006511503 | 3300006904 | Populus Rhizosphere | RTARLGRAFGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0075419_112978921 | 3300006969 | Populus Rhizosphere | TVGRALAVLGISLAATGLVALAVYGLLTYLGERT* |
| Ga0105240_120742712 | 3300009093 | Corn Rhizosphere | GRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0111539_107168463 | 3300009094 | Populus Rhizosphere | LARGALRHDDVRLGRAGGRGLAKAGRALAVLGISLAATGLVALTVYGLLTYLGERT* |
| Ga0075423_117615282 | 3300009162 | Populus Rhizosphere | TARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0105237_110144021 | 3300009545 | Corn Rhizosphere | VAVALGILSIWLARGALRHDDVRLGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0131092_111705562 | 3300009870 | Activated Sludge | LRLDDMRLGRAGGRRRARVGRALGVIGISLAATCAVALAVYGILTYLGER* |
| Ga0126377_135751821 | 3300010362 | Tropical Forest Soil | VGILLGALAIVLARRALRHDDMRLGRAGGRGASRVGWSLGVLGIALSATCLVALGVYGLLTYLGER* |
| Ga0105239_105086111 | 3300010375 | Corn Rhizosphere | GRGAARLGRALGVLGIALAATGLVAVAVYGLLTYLGDR* |
| Ga0134126_117955831 | 3300010396 | Terrestrial Soil | RGALRHDDVRLGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0137424_10581331 | 3300011412 | Soil | DDVRLGRAGGRGAARLGRALAVLGLALASTCLVALGVYGLLTYLGERG* |
| Ga0157303_100255891 | 3300012896 | Soil | LRLDDMRLGRAGGRRTARLGQALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0157285_100764782 | 3300012897 | Soil | LGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0157308_100114731 | 3300012910 | Soil | DMRLGRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0157306_102419071 | 3300012912 | Soil | IGLARGALRLDDMRLGRAGGRRAARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0164241_104369362 | 3300012943 | Soil | RHDDVRMGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0164300_104692392 | 3300012951 | Soil | ARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0164300_111708461 | 3300012951 | Soil | RLDDMRLGRAGGRRLARFGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0164303_105000872 | 3300012957 | Soil | ARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0164299_100668383 | 3300012958 | Soil | SIWLARGALRHDDVRLGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER* |
| Ga0164302_103149293 | 3300012961 | Soil | ARSALRLDDMRLGRAGGRRLARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0164307_106127032 | 3300012987 | Soil | RRTARLGQALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0164305_122324231 | 3300012989 | Soil | AFAIGLARGALRLDDMRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0157371_104573311 | 3300013102 | Corn Rhizosphere | LDDMRLGRAGGRRTARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0075345_11931522 | 3300014312 | Natural And Restored Wetlands | GAALAWGLGVAGIALAASATVALAVYGVLTYLGERGT* |
| Ga0163163_111723121 | 3300014325 | Switchgrass Rhizosphere | RTARLGRALGVLGISLAATCAVALAVYGILTYLGER* |
| Ga0157377_116782561 | 3300014745 | Miscanthus Rhizosphere | GAVAIGLARGALRLDDMRLGRAGGRRTARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0157376_110243521 | 3300014969 | Miscanthus Rhizosphere | LAIWLARGALRHDDARLGRAGGRGAARLGRAFGVLGIALASTGLVAVGVYGLLTYLGDR* |
| Ga0132256_1010106861 | 3300015372 | Arabidopsis Rhizosphere | AARLGRALGVLGIALAATALVALAVYGLLTYLGER* |
| Ga0132257_1000326358 | 3300015373 | Arabidopsis Rhizosphere | RLDDMRLGRAGGRRTARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0132255_1009809843 | 3300015374 | Arabidopsis Rhizosphere | ARLGQALAVLGIALAATALVALAVYGLLTYLGER* |
| Ga0132255_1013259211 | 3300015374 | Arabidopsis Rhizosphere | LARGALRLDDIRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER* |
| Ga0184609_105687753 | 3300018076 | Groundwater Sediment | DDLRLGRAGGRDAARVARALGVLGIALAATGVVALAVYELLTYLGER |
| Ga0190270_107722801 | 3300018469 | Soil | MRHDDVRLGRAGGRGAARLGRALAVLGLALASTCLVALGVYGLLTYLGERG |
| Ga0206354_117064562 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | WLARGALRHDDVRLGRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER |
| Ga0247753_10210832 | 3300022892 | Soil | GLGRGALRHDDVRLGRAGGRGSARVGRALGVLGIALAATCAVALAVYGILTYLGER |
| Ga0247795_10616422 | 3300022899 | Soil | RRTARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0247790_100580512 | 3300022915 | Soil | RAGGRRTARLGQALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207645_107883182 | 3300025907 | Miscanthus Rhizosphere | VGIALGILAVWLAREALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR |
| Ga0207643_103193442 | 3300025908 | Miscanthus Rhizosphere | RLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0207705_106718951 | 3300025909 | Corn Rhizosphere | RLGRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207695_114973782 | 3300025913 | Corn Rhizosphere | GRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207662_103154591 | 3300025918 | Switchgrass Rhizosphere | GALAIGIARGALRLNDMRLGRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGE |
| Ga0207690_106215911 | 3300025932 | Corn Rhizosphere | GGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207686_110363261 | 3300025934 | Miscanthus Rhizosphere | GGRRLARVGRALGVIGISLAATCAVALAVYGILTYLGER |
| Ga0207669_106245511 | 3300025937 | Miscanthus Rhizosphere | GLARGALRLDDIRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0207704_117321471 | 3300025938 | Miscanthus Rhizosphere | PLGVVLGVVALRLAQGAIRHDELRLGRAGGRGAARVGRALGVLGLALASTCLVALGVYGLLTYLGERS |
| Ga0207661_106725162 | 3300025944 | Corn Rhizosphere | RHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR |
| Ga0207667_102260333 | 3300025949 | Corn Rhizosphere | TARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207667_117437751 | 3300025949 | Corn Rhizosphere | IRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0207658_117970301 | 3300025986 | Switchgrass Rhizosphere | LDDMRLGRAGGRRLARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207639_100274436 | 3300026041 | Corn Rhizosphere | ALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR |
| Ga0207639_104849931 | 3300026041 | Corn Rhizosphere | LRLDDMRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0207708_114139422 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SARVGRALGVLGIALAATCAVALAVYGILTYLGER |
| Ga0207648_101246821 | 3300026089 | Miscanthus Rhizosphere | IARGALRLDDMRLGRAGGRRTARLGQALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207648_101300511 | 3300026089 | Miscanthus Rhizosphere | GGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0207648_116553662 | 3300026089 | Miscanthus Rhizosphere | GLARSALHLDDMRLGRVGGRRLARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0207676_108201251 | 3300026095 | Switchgrass Rhizosphere | RLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0209966_10655771 | 3300027695 | Arabidopsis Thaliana Rhizosphere | RLDEVRLGRAGGRRTARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0268266_113068001 | 3300028379 | Switchgrass Rhizosphere | GRAGGRRTARVGWALGVFAIALASTCLVALAVYGLLTYLGER |
| Ga0268264_101069971 | 3300028381 | Switchgrass Rhizosphere | RRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0247828_101746761 | 3300028587 | Soil | VGILAVWLAREALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR |
| Ga0247818_108383422 | 3300028589 | Soil | VGIVLGIVALRLAQGALRHDDVRLGRAGGRRAARLGRALGVLGLALASTCLVALGVYELLTYLGERS |
| Ga0247818_111575201 | 3300028589 | Soil | LRLERAGGRGAARVGRALGVLGIALGATALVSVSVYGFLTYLGER |
| Ga0247820_103125603 | 3300028597 | Soil | ALGILAVWLAREALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR |
| Ga0247824_102330601 | 3300028809 | Soil | MRLGRAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0247826_104533952 | 3300030336 | Soil | VLLGALAIGLARSALRHDDLRLERAGGRGAARVGRALGVLGIALGATALVSVSVYGFLTYLGER |
| Ga0307497_107083422 | 3300031226 | Soil | DMRLGRAGGRRSARLGRALGVLGISLAATCAVALAVYGILTYLGER |
| Ga0310887_108484221 | 3300031547 | Soil | VRLGRAGGRRAARLGRALGVLGLALASTCLVALGVYELLTYLGERS |
| Ga0310886_101863543 | 3300031562 | Soil | IPVGIALGILAVWLAREALRHDDARLGRAGGRGAARLGRALGVLGIALAATGLVAVGVYGLLTYLGDR |
| Ga0310891_103596392 | 3300031913 | Soil | ARGAFAIGLARGALRLDDLRLGGAGGRRLARLGRALGVLGISLGATCAVALAVYGILTYLGER |
| Ga0310884_107014891 | 3300031944 | Soil | LHAGVAIPVAVVLGFIALRLARGALRHDDVRLGRAGGRGLATVGRALAVLGISLAATGLVALTVYGLLTYLGERT |
| Ga0310899_106986802 | 3300032017 | Soil | FIALRLARGALRHDDVRLGRAGGRGLATVGRALAVLGISLAATGLVALTVYGLLTYLGER |
| Ga0315275_105859741 | 3300032401 | Sediment | DSVTLGRAGGRRTARAGWVLGVLGLCLASSALVAIAVYGVLTYVGSQD |
| Ga0247830_101988963 | 3300033551 | Soil | EGGAIWLARAALRHDDARLGRAGGRGAARLGRALGVLGIALAATALVALAVYGLLTYLGE |
| Ga0247830_103646721 | 3300033551 | Soil | LAIGLARSALRHDDLRLERAGGRGAARVGRALGVLGIALGATALVSVSVYGFLTYLGER |
| Ga0247830_112449552 | 3300033551 | Soil | GFAIPVAVVLGFVALRLARGALRHDDVRLGRAGGRGLATVGRALAVLGISLAATGLVALVVYGLLTYLGERT |
| ⦗Top⦘ |