| Basic Information | |
|---|---|
| Family ID | F085156 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 111 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MMGLAGEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 111 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 53.15 % |
| % of genes near scaffold ends (potentially truncated) | 71.17 % |
| % of genes from short scaffolds (< 2000 bps) | 90.09 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (53.153 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (27.928 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.045 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (75.676 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 111 Family Scaffolds |
|---|---|---|
| PF00268 | Ribonuc_red_sm | 51.35 |
| PF02867 | Ribonuc_red_lgC | 27.93 |
| PF01510 | Amidase_2 | 1.80 |
| PF03477 | ATP-cone | 0.90 |
| PF02881 | SRP54_N | 0.90 |
| COG ID | Name | Functional Category | % Frequency in 111 Family Scaffolds |
|---|---|---|---|
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 51.35 |
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 27.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 53.15 % |
| All Organisms | root | All Organisms | 46.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1003349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 4463 | Open in IMG/M |
| 3300000928|OpTDRAFT_10141240 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300001275|B570J13894_1023888 | Not Available | 575 | Open in IMG/M |
| 3300002351|B570J29582_1023929 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300003277|JGI25908J49247_10034171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1416 | Open in IMG/M |
| 3300003395|JGI25917J50250_1001666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 6314 | Open in IMG/M |
| 3300003412|JGI25912J50252_10110496 | Not Available | 656 | Open in IMG/M |
| 3300003431|JGI25913J50563_1000656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 6941 | Open in IMG/M |
| 3300003493|JGI25923J51411_1041258 | Not Available | 855 | Open in IMG/M |
| 3300004762|Ga0007749_1200983 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300004763|Ga0007746_1062195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2715 | Open in IMG/M |
| 3300004796|Ga0007763_10060283 | Not Available | 697 | Open in IMG/M |
| 3300004796|Ga0007763_10088808 | Not Available | 817 | Open in IMG/M |
| 3300005517|Ga0070374_10382769 | Not Available | 708 | Open in IMG/M |
| 3300005517|Ga0070374_10516953 | Not Available | 595 | Open in IMG/M |
| 3300007545|Ga0102873_1192458 | Not Available | 613 | Open in IMG/M |
| 3300007559|Ga0102828_1050294 | Not Available | 968 | Open in IMG/M |
| 3300007622|Ga0102863_1113177 | Not Available | 797 | Open in IMG/M |
| 3300007636|Ga0102856_1013490 | Not Available | 1156 | Open in IMG/M |
| 3300007718|Ga0102852_1077418 | Not Available | 645 | Open in IMG/M |
| 3300007962|Ga0102907_1039948 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1290 | Open in IMG/M |
| 3300008052|Ga0102893_1213264 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300008055|Ga0108970_10786396 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1163 | Open in IMG/M |
| 3300008119|Ga0114354_1266648 | Not Available | 538 | Open in IMG/M |
| 3300008261|Ga0114336_1201429 | Not Available | 835 | Open in IMG/M |
| 3300008996|Ga0102831_1259565 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009184|Ga0114976_10368583 | Not Available | 756 | Open in IMG/M |
| 3300009185|Ga0114971_10334130 | Not Available | 870 | Open in IMG/M |
| 3300009187|Ga0114972_10070838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2342 | Open in IMG/M |
| 3300010966|Ga0137675_1020408 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300012352|Ga0157138_1056308 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300012727|Ga0157531_1164695 | Not Available | 1126 | Open in IMG/M |
| 3300012768|Ga0138276_1036201 | Not Available | 535 | Open in IMG/M |
| 3300012770|Ga0138291_1130357 | Not Available | 782 | Open in IMG/M |
| 3300012772|Ga0138287_1230153 | Not Available | 568 | Open in IMG/M |
| 3300012773|Ga0138290_1067609 | Not Available | 903 | Open in IMG/M |
| 3300013006|Ga0164294_11159392 | Not Available | 518 | Open in IMG/M |
| 3300013063|Ga0157558_123308 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1602 | Open in IMG/M |
| 3300013076|Ga0157551_1144993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1647 | Open in IMG/M |
| 3300013079|Ga0157536_1034375 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300013372|Ga0177922_10208724 | Not Available | 783 | Open in IMG/M |
| 3300013372|Ga0177922_11196970 | Not Available | 683 | Open in IMG/M |
| 3300018790|Ga0187842_1155549 | Not Available | 677 | Open in IMG/M |
| 3300018790|Ga0187842_1220597 | Not Available | 552 | Open in IMG/M |
| 3300018868|Ga0187844_10306261 | Not Available | 662 | Open in IMG/M |
| 3300019093|Ga0187843_10247927 | Not Available | 741 | Open in IMG/M |
| 3300020141|Ga0211732_1541786 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300020501|Ga0208590_1004813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1881 | Open in IMG/M |
| 3300020523|Ga0208226_1034095 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300020532|Ga0208601_1046506 | Not Available | 609 | Open in IMG/M |
| 3300020542|Ga0208857_1050849 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300020565|Ga0208718_1019089 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1395 | Open in IMG/M |
| 3300021108|Ga0214162_1014340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1443 | Open in IMG/M |
| 3300021108|Ga0214162_1060952 | Not Available | 621 | Open in IMG/M |
| 3300021312|Ga0210306_1219549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1592 | Open in IMG/M |
| 3300021317|Ga0210309_1084367 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021325|Ga0210301_1317074 | Not Available | 982 | Open in IMG/M |
| 3300021336|Ga0210307_1268659 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1274 | Open in IMG/M |
| 3300021845|Ga0210297_1030082 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300022748|Ga0228702_1092096 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300024343|Ga0244777_10170232 | Not Available | 1404 | Open in IMG/M |
| 3300024343|Ga0244777_10526495 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300024343|Ga0244777_10829108 | Not Available | 544 | Open in IMG/M |
| 3300024348|Ga0244776_10031435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 4269 | Open in IMG/M |
| 3300024358|Ga0255173_1080972 | Not Available | 540 | Open in IMG/M |
| 3300024485|Ga0256318_1073471 | Not Available | 733 | Open in IMG/M |
| 3300024487|Ga0255222_1016269 | Not Available | 1064 | Open in IMG/M |
| 3300024537|Ga0255225_1054831 | Not Available | 675 | Open in IMG/M |
| 3300024558|Ga0255232_1026313 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1177 | Open in IMG/M |
| 3300024560|Ga0256306_1067147 | Not Available | 857 | Open in IMG/M |
| 3300024560|Ga0256306_1098998 | Not Available | 683 | Open in IMG/M |
| 3300024571|Ga0256302_1103312 | Not Available | 670 | Open in IMG/M |
| 3300024572|Ga0255268_1075474 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 847 | Open in IMG/M |
| 3300024849|Ga0255230_1019571 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1189 | Open in IMG/M |
| 3300024856|Ga0256304_1107479 | Not Available | 559 | Open in IMG/M |
| 3300025742|Ga0255248_1024518 | Not Available | 698 | Open in IMG/M |
| 3300025744|Ga0255245_1009085 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1220 | Open in IMG/M |
| 3300025746|Ga0255241_1018528 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300025757|Ga0256313_1041009 | Not Available | 685 | Open in IMG/M |
| 3300027121|Ga0255074_1037161 | Not Available | 605 | Open in IMG/M |
| 3300027129|Ga0255067_1005887 | All Organisms → cellular organisms → Bacteria | 1981 | Open in IMG/M |
| 3300027139|Ga0255082_1005742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 2301 | Open in IMG/M |
| 3300027143|Ga0255105_1001683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 5561 | Open in IMG/M |
| 3300027145|Ga0255114_1019882 | Not Available | 1316 | Open in IMG/M |
| 3300027154|Ga0255111_1007834 | Not Available | 2543 | Open in IMG/M |
| 3300027155|Ga0255081_1030789 | Not Available | 1182 | Open in IMG/M |
| 3300027206|Ga0208023_1058280 | Not Available | 630 | Open in IMG/M |
| 3300027210|Ga0208802_1018859 | Not Available | 948 | Open in IMG/M |
| 3300027239|Ga0208807_1052990 | Not Available | 554 | Open in IMG/M |
| 3300027418|Ga0208022_1113817 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300027538|Ga0255085_1071050 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300027578|Ga0255075_1052775 | Not Available | 731 | Open in IMG/M |
| 3300027589|Ga0255123_1017736 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1523 | Open in IMG/M |
| 3300027600|Ga0255117_1002790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 4928 | Open in IMG/M |
| 3300027659|Ga0208975_1194893 | Not Available | 544 | Open in IMG/M |
| (restricted) 3300027730|Ga0247833_1235356 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300027746|Ga0209597_1362655 | Not Available | 538 | Open in IMG/M |
| 3300027754|Ga0209596_1059012 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1962 | Open in IMG/M |
| 3300027756|Ga0209444_10205484 | Not Available | 712 | Open in IMG/M |
| 3300027772|Ga0209768_10293796 | Not Available | 686 | Open in IMG/M |
| 3300027963|Ga0209400_1037691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. Rim28 | 2618 | Open in IMG/M |
| (restricted) 3300027977|Ga0247834_1094541 | Not Available | 1358 | Open in IMG/M |
| 3300028097|Ga0255261_1011286 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300028255|Ga0255226_1010068 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1159 | Open in IMG/M |
| 3300028255|Ga0255226_1032316 | Not Available | 674 | Open in IMG/M |
| 3300029697|Ga0256301_1018573 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1154 | Open in IMG/M |
| 3300029697|Ga0256301_1035028 | Not Available | 852 | Open in IMG/M |
| 3300031786|Ga0315908_10784899 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300034104|Ga0335031_0509914 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300034106|Ga0335036_0646322 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300034121|Ga0335058_0634733 | Not Available | 594 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 27.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 18.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.71% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.01% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.11% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.31% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.80% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.90% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.90% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.90% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.90% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.90% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300001275 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300002351 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
| 3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004762 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004763 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
| 3300007718 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 | Environmental | Open in IMG/M |
| 3300007962 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008119 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
| 3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
| 3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012727 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012772 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012773 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140212_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013063 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES051 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013076 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES042 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013079 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES022 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300018790 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_41 | Environmental | Open in IMG/M |
| 3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
| 3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020501 | Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020523 | Freshwater microbial communities from Lake Mendota, WI - 18MAY2011 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021317 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021325 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021336 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021845 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R876 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300024485 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024560 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024571 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024572 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024849 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024856 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025742 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025744 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025746 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025757 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027143 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8h | Environmental | Open in IMG/M |
| 3300027145 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027206 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027239 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027538 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027578 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h | Environmental | Open in IMG/M |
| 3300027589 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
| 3300028097 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028255 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10033492 | 3300000736 | Freshwater And Sediment | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| OpTDRAFT_101412402 | 3300000928 | Freshwater And Marine | MMGLTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| B570J13894_10238881 | 3300001275 | Freshwater | GAGVAAVMIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| B570J29582_10239292 | 3300002351 | Freshwater | GEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| JGI25908J49247_100341713 | 3300003277 | Freshwater Lake | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| JGI25917J50250_10016666 | 3300003395 | Freshwater Lake | MMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| JGI25912J50252_101104962 | 3300003412 | Freshwater Lake | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDN |
| JGI25913J50563_10006567 | 3300003431 | Freshwater Lake | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| JGI25923J51411_10412581 | 3300003493 | Freshwater Lake | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISN |
| Ga0007749_12009831 | 3300004762 | Freshwater Lake | EAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0007746_10621952 | 3300004763 | Freshwater Lake | MMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCSAGVDESFQDNIEISNV* |
| Ga0007763_100602832 | 3300004796 | Freshwater Lake | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDN |
| Ga0007763_100888082 | 3300004796 | Freshwater Lake | MIGLAGEEELNEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0070374_103827691 | 3300005517 | Freshwater Lake | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEIS |
| Ga0070374_105169532 | 3300005517 | Freshwater Lake | MIGLAGEEALKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEIS |
| Ga0102873_11924583 | 3300007545 | Estuarine | VGADGAGVAAVMIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0102828_10502941 | 3300007559 | Estuarine | RGGELKEDRSARRSAGVPLGGKLGIAVCNAGVDESFQDNIEISNV* |
| Ga0102863_11131771 | 3300007622 | Estuarine | MMGLAGEEELKEDRSARRSAGRPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0102856_10134902 | 3300007636 | Estuarine | MMGLVGEDELKEDRSARRSAGWPLGGKFGIAGCNAGADESFQDNIEISNV* |
| Ga0102852_10774182 | 3300007718 | Estuarine | MMGLAGEDELKEDRSARRSADGPLGGKLGIAGCDAGVDESFQDNIEISNV* |
| Ga0102907_10399483 | 3300007962 | Estuarine | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDE |
| Ga0102893_12132642 | 3300008052 | Estuarine | FAVKEDRSARRSTDGPLGGKLGIAGCNAGADESFQDNIEISNE* |
| Ga0108970_107863962 | 3300008055 | Estuary | MMGLAGEAELKEDRSARRSAGGPLGGKLGITGCNAGVDESFQDNIEISNV* |
| Ga0114354_12666481 | 3300008119 | Freshwater, Plankton | MMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDVSFQDNIEISNE* |
| Ga0114336_12014292 | 3300008261 | Freshwater, Plankton | MMGLAGEAELKEDRSARRSADGPLGGKLGIAGCSAGVDESFQDNIEISNV* |
| Ga0102831_12595652 | 3300008996 | Estuarine | LKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0114976_103685833 | 3300009184 | Freshwater Lake | MKGLTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0114971_103341302 | 3300009185 | Freshwater Lake | MDALMMGLARGGELKEDRSARRSAGVPLGGKLGIAVCNAGVDESFQDNIEISNE* |
| Ga0114972_100708382 | 3300009187 | Freshwater Lake | MMGLTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEITNV* |
| Ga0137675_10204081 | 3300010966 | Pond Fresh Water | AEAPAENEDRSAKRSADGPLGGKLGIAGCNAGLEESSQDNIEISNE* |
| Ga0157138_10563082 | 3300012352 | Freshwater | PAENEDRSAKRSADGPLGGKLGIAGCNAGLEESSQDNIEISNE* |
| Ga0157531_11646951 | 3300012727 | Freshwater | AVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0138276_10362012 | 3300012768 | Freshwater Lake | MMGLAGEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNI |
| Ga0138291_11303572 | 3300012770 | Freshwater Lake | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNADVDESFQDNIEISNV* |
| Ga0138287_12301531 | 3300012772 | Freshwater Lake | MMGLEVLMLAAALKEDRSAKRSADGPLGGKLGIAG |
| Ga0138290_10676092 | 3300012773 | Freshwater Lake | MGLTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0164294_111593921 | 3300013006 | Freshwater | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNI |
| Ga0157558_1233081 | 3300013063 | Freshwater | VGVLNEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0157551_11449932 | 3300013076 | Freshwater | MMGLAGEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV* |
| Ga0157536_10343751 | 3300013079 | Freshwater | GAGVAALMMGLTVEAELKEDRSARRSAGGPLGGKLGITGCNAGVDESFQDNIEISNV* |
| Ga0177922_102087242 | 3300013372 | Freshwater | MIGLAGEAELKEDRSARRSAGGPLGGKLGIAGCSAGVDESFQDNIEISNV* |
| Ga0177922_111969702 | 3300013372 | Freshwater | MIGLAGEEELNEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIE |
| Ga0187842_11555491 | 3300018790 | Freshwater | MMGLTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0187842_12205972 | 3300018790 | Freshwater | MMGLAVEAELKEDRSARRSADGPLGGQLGIAGCNAGVDESFQDNIEIS |
| Ga0187844_103062612 | 3300018868 | Freshwater | MMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDVSFQDNIEISNE |
| Ga0187843_102479272 | 3300019093 | Freshwater | MIGLAGEEELKEYRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0211732_15417861 | 3300020141 | Freshwater | AAVMIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0208590_10048132 | 3300020501 | Freshwater | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0208226_10340952 | 3300020523 | Freshwater | ELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0208601_10465061 | 3300020532 | Freshwater | VGADGAGVAAVMIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISN |
| Ga0208857_10508492 | 3300020542 | Freshwater | GLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0208718_10190892 | 3300020565 | Freshwater | MMGLEGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0214162_10143402 | 3300021108 | Freshwater | MMGLAVEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0214162_10609522 | 3300021108 | Freshwater | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDE |
| Ga0210306_12195492 | 3300021312 | Estuarine | MMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCSAGVDESFQDNIEISNV |
| Ga0210309_10843671 | 3300021317 | Estuarine | ELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0210301_13170741 | 3300021325 | Estuarine | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDES |
| Ga0210307_12686592 | 3300021336 | Estuarine | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESF |
| Ga0210297_10300822 | 3300021845 | Estuarine | LTVEAPALNEDRSTKRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0228702_10920961 | 3300022748 | Freshwater | AVACMGLACATEAEEALNEDRSAKRSADRPLGGKLGIAGCNAGLDESSQDNIEISNV |
| Ga0244777_101702321 | 3300024343 | Estuarine | PALNEDRSTKRSADGPLGGKLGIAGCNAGLDESSQDNIEISNE |
| Ga0244777_105264951 | 3300024343 | Estuarine | GLARGGELKEDRSARRSAGVPLGGKLGIAVCNAGVDESFQDNIEISNV |
| Ga0244777_108291082 | 3300024343 | Estuarine | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQYNIEISN |
| Ga0244776_100314351 | 3300024348 | Estuarine | AGVAAGMMGLVGEDELKEDRSARRSAGWPLGGKFGIAGCNAGADESFQDNIEISNV |
| Ga0255173_10809722 | 3300024358 | Freshwater | ATEAEEALNEDRSAKRSADRPLGGKLGIAGCNAGLDESSQDNIEISNV |
| Ga0256318_10734711 | 3300024485 | Freshwater | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNVLIMKA |
| Ga0255222_10162693 | 3300024487 | Freshwater | DGAGVAALMMGLTVEAELKEDRSARRSADGPLGEKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255225_10548312 | 3300024537 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQD |
| Ga0255232_10263132 | 3300024558 | Freshwater | MMGLTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDN |
| Ga0256306_10671471 | 3300024560 | Freshwater | VEAELKEDRSARRSADGPLGEKLGIAGCNAGVDESFQDNIEISNV |
| Ga0256306_10989982 | 3300024560 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQ |
| Ga0256302_11033121 | 3300024571 | Freshwater | MIGLAGEEELNEDRSARRSADGPLGGKLGIAGCNAGVDESFQ |
| Ga0255268_10754741 | 3300024572 | Freshwater | AEEALNEDRSAKRSADRPLGGKLGIAGCNAGLDESSQDNIEISNV |
| Ga0255230_10195711 | 3300024849 | Freshwater | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEIS |
| Ga0256304_11074791 | 3300024856 | Freshwater | GVAALMMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255248_10245182 | 3300025742 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEIS |
| Ga0255245_10090852 | 3300025744 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIE |
| Ga0255241_10185282 | 3300025746 | Freshwater | DGAGVAAVMIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0256313_10410092 | 3300025757 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDE |
| Ga0255074_10371613 | 3300027121 | Freshwater | GAGVAALMMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255067_10058872 | 3300027129 | Freshwater | LAGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255082_10057422 | 3300027139 | Freshwater | MMGLTVEAELKEDRSARRSADGPLGEKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255105_10016831 | 3300027143 | Freshwater | VAAVMIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255114_10198822 | 3300027145 | Freshwater | GEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255111_10078341 | 3300027154 | Freshwater | AGEAELKEDRSARRSAGGPLGGKLGIAGCSAGVDESFQDNIEISNV |
| Ga0255081_10307892 | 3300027155 | Freshwater | GADGAGVAAVMIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0208023_10582802 | 3300027206 | Estuarine | MMGLVGEDELKEDRSARRSAGWPLGGKFGIAGCNAGADESFQDNIEISDM |
| Ga0208802_10188592 | 3300027210 | Estuarine | MMGLAVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIE |
| Ga0208807_10529902 | 3300027239 | Estuarine | LMKGLTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0208022_11138171 | 3300027418 | Estuarine | KEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255085_10710501 | 3300027538 | Freshwater | MMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255075_10527751 | 3300027578 | Freshwater | MIGLAGEEELNEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255123_10177364 | 3300027589 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNVLI |
| Ga0255117_10027905 | 3300027600 | Freshwater | AAVMIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0208975_11948931 | 3300027659 | Freshwater Lentic | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIE |
| (restricted) Ga0247833_12353561 | 3300027730 | Freshwater | AVMIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0209597_13626553 | 3300027746 | Freshwater Lake | GMAALMMGLARGGELKEDRSARRSAGVPLGGKLGIAVCNAGVDESFQDNIEISNV |
| Ga0209596_10590122 | 3300027754 | Freshwater Lake | LTVEAELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0209444_102054841 | 3300027756 | Freshwater Lake | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISN |
| Ga0209768_102937961 | 3300027772 | Freshwater Lake | MIGLAGEEELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEI |
| Ga0209400_10376912 | 3300027963 | Freshwater Lake | MMGLTVEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| (restricted) Ga0247834_10945412 | 3300027977 | Freshwater | LGGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNIEISNV |
| Ga0255261_10112861 | 3300028097 | Freshwater | GLAGEAELKEDRSARRSAGGPLGGKLGIAGCSAGVDESFQDNIEISNV |
| Ga0255226_10100681 | 3300028255 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVD |
| Ga0255226_10323161 | 3300028255 | Freshwater | MMGLAGEAELKEDRSARRSAGGPLGGKLGITGCNAGVDE |
| Ga0256301_10185731 | 3300029697 | Freshwater | MIGLAGEEELNEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNI |
| Ga0256301_10350282 | 3300029697 | Freshwater | MIGLAGEEELKEDRSARRSADGPLGGKLGIAGCNAGVDESFQDNI |
| Ga0315908_107848991 | 3300031786 | Freshwater | LKEDRSARRSAGGPLGGKLGIAGCNACVDVSFQDNIEISNE |
| Ga0335031_0509914_38_223 | 3300034104 | Freshwater | VGADGAGVAALMMGLAGEAELKEDRSARRSAGGPLGGKLGIAGCNAGVDESFQDNIEISN |
| Ga0335036_0646322_1_150 | 3300034106 | Freshwater | TVNEDRSAKRSADGPLGGKLGIAGCNAGLDDSSQDNIEISNEWIMKACD |
| Ga0335058_0634733_450_593 | 3300034121 | Freshwater | LVDVFAVKEDRSARRSADGPLGGKLGIAGCNAGADESFQDNIEISNE |
| ⦗Top⦘ |