NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F084885

Metagenome / Metatranscriptome Family F084885

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F084885
Family Type Metagenome / Metatranscriptome
Number of Sequences 112
Average Sequence Length 35 residues
Representative Sequence MKLYLIFALIDTLILLAYPFVFVMGKVRQLLGFKR
Number of Associated Samples 87
Number of Associated Scaffolds 112

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.96 %
% of genes near scaffold ends (potentially truncated) 6.25 %
% of genes from short scaffolds (< 2000 bps) 61.61 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.036 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(16.071 % of family members)
Environment Ontology (ENVO) Unclassified
(32.143 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(31.250 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.21%    β-sheet: 0.00%    Coil/Unstructured: 50.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 112 Family Scaffolds
PF00483NTP_transferase 55.36
PF01926MMR_HSR1 14.29
PF08439Peptidase_M3_N 4.46
PF03741TerC 3.57
PF06071YchF-GTPase_C 2.68
PF00690Cation_ATPase_N 2.68
PF08378NERD 1.79
PF00702Hydrolase 0.89
PF02653BPD_transp_2 0.89
PF01370Epimerase 0.89
PF03413PepSY 0.89
PF08282Hydrolase_3 0.89
PF03848TehB 0.89
PF00436SSB 0.89
PF00005ABC_tran 0.89
PF10672Methyltrans_SAM 0.89
PF01040UbiA 0.89
PF00583Acetyltransf_1 0.89
PF01555N6_N4_Mtase 0.89
PF00756Esterase 0.89

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 112 Family Scaffolds
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 4.46
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 3.57
COG0012Ribosome-binding ATPase YchF, GTP1/OBG familyTranslation, ribosomal structure and biogenesis [J] 2.68
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 2.68
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.89
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.89
COG0629Single-stranded DNA-binding proteinReplication, recombination and repair [L] 0.89
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.89
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.89
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.89
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.89
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.89
COG2965Primosomal replication protein NReplication, recombination and repair [L] 0.89
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.89

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.04 %
UnclassifiedrootN/A16.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001372|YBBDRAFT_1136006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales5482Open in IMG/M
3300001372|YBBDRAFT_1140391All Organisms → cellular organisms → Bacteria → Terrabacteria group2579Open in IMG/M
3300001372|YBBDRAFT_1156800All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300001372|YBBDRAFT_1181067All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300002120|C687J26616_10114890All Organisms → cellular organisms → Bacteria859Open in IMG/M
3300002124|C687J26631_10061283All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300002124|C687J26631_10097425All Organisms → cellular organisms → Bacteria999Open in IMG/M
3300003993|Ga0055468_10045589All Organisms → cellular organisms → Bacteria1095Open in IMG/M
3300005529|Ga0070741_10000481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi145280Open in IMG/M
3300005827|Ga0074478_1774340All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300005829|Ga0074479_10079756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi48170Open in IMG/M
3300005829|Ga0074479_10401118All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300005831|Ga0074471_10421700Not Available500Open in IMG/M
3300005831|Ga0074471_10498977All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005836|Ga0074470_10296873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae1736Open in IMG/M
3300005836|Ga0074470_10705452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1565Open in IMG/M
3300005836|Ga0074470_11463491All Organisms → cellular organisms → Bacteria → Terrabacteria group2761Open in IMG/M
3300005840|Ga0068870_10205244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1197Open in IMG/M
3300006755|Ga0079222_10221387All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300006844|Ga0075428_100016508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales8152Open in IMG/M
3300006844|Ga0075428_100044089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila4903Open in IMG/M
3300006844|Ga0075428_100335626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1624Open in IMG/M
3300006844|Ga0075428_101027502Not Available872Open in IMG/M
3300006844|Ga0075428_101168293All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300006845|Ga0075421_100104780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales3558Open in IMG/M
3300006865|Ga0073934_10000094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales255253Open in IMG/M
3300006954|Ga0079219_10272175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1025Open in IMG/M
3300009081|Ga0105098_10003995All Organisms → cellular organisms → Bacteria5302Open in IMG/M
3300009131|Ga0115027_10614235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi803Open in IMG/M
3300009148|Ga0105243_10010676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila6962Open in IMG/M
3300009157|Ga0105092_10014408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila4146Open in IMG/M
3300009157|Ga0105092_10676366All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300009168|Ga0105104_10033635All Organisms → cellular organisms → Bacteria2861Open in IMG/M
3300009179|Ga0115028_10147469All Organisms → cellular organisms → Bacteria1419Open in IMG/M
3300009678|Ga0105252_10199233Not Available857Open in IMG/M
3300010044|Ga0126310_10040022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae2535Open in IMG/M
3300010166|Ga0126306_10009669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila6052Open in IMG/M
3300010362|Ga0126377_11015560All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300010391|Ga0136847_11828627All Organisms → cellular organisms → Bacteria4727Open in IMG/M
3300010399|Ga0134127_10005150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila9473Open in IMG/M
3300011402|Ga0137356_1006733All Organisms → cellular organisms → Bacteria1968Open in IMG/M
3300011407|Ga0137450_1113177All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300011410|Ga0137440_1067089All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300011413|Ga0137333_1000521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila10091Open in IMG/M
3300011413|Ga0137333_1072175All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300011419|Ga0137446_1044909All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300011420|Ga0137314_1098127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi718Open in IMG/M
3300011422|Ga0137425_1143003Not Available594Open in IMG/M
3300011424|Ga0137439_1003355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila2055Open in IMG/M
3300011429|Ga0137455_1242889All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter532Open in IMG/M
3300011444|Ga0137463_1009451All Organisms → cellular organisms → Bacteria3318Open in IMG/M
3300012038|Ga0137431_1159278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi646Open in IMG/M
3300012231|Ga0137465_1019799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila1961Open in IMG/M
3300012355|Ga0137369_10083151All Organisms → cellular organisms → Bacteria2678Open in IMG/M
3300012530|Ga0136635_10000851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila9077Open in IMG/M
3300013306|Ga0163162_12036430All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300014269|Ga0075302_1170904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi539Open in IMG/M
3300014314|Ga0075316_1003281All Organisms → cellular organisms → Bacteria2832Open in IMG/M
3300014326|Ga0157380_11393044All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300014745|Ga0157377_10924622All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300014877|Ga0180074_1040715All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300014878|Ga0180065_1022573Not Available1282Open in IMG/M
3300014883|Ga0180086_1141414Not Available626Open in IMG/M
3300015054|Ga0137420_1406114All Organisms → cellular organisms → Bacteria1503Open in IMG/M
3300015259|Ga0180085_1027851All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1584Open in IMG/M
3300018052|Ga0184638_1016368All Organisms → cellular organisms → Bacteria2579Open in IMG/M
3300018052|Ga0184638_1162124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae803Open in IMG/M
3300018052|Ga0184638_1183752All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300018059|Ga0184615_10211582All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300018059|Ga0184615_10400690All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300018084|Ga0184629_10060105Not Available1764Open in IMG/M
3300018084|Ga0184629_10140404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1217Open in IMG/M
3300018465|Ga0190269_10004289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila6480Open in IMG/M
3300019884|Ga0193741_1002480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila5195Open in IMG/M
3300021090|Ga0210377_10000026All Organisms → cellular organisms → Bacteria145915Open in IMG/M
3300021090|Ga0210377_10000447All Organisms → cellular organisms → Bacteria39781Open in IMG/M
3300021333|Ga0210324_1219094All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300021333|Ga0210324_1343935Not Available629Open in IMG/M
3300025159|Ga0209619_10003591All Organisms → cellular organisms → Bacteria11150Open in IMG/M
3300025310|Ga0209172_10000008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi739805Open in IMG/M
3300025314|Ga0209323_10298344Not Available1009Open in IMG/M
3300025910|Ga0207684_10088650Not Available2636Open in IMG/M
3300026022|Ga0208649_1029971Not Available512Open in IMG/M
3300026116|Ga0207674_10095482Not Available2959Open in IMG/M
3300026320|Ga0209131_1002406All Organisms → cellular organisms → Bacteria12700Open in IMG/M
3300026535|Ga0256867_10324285Not Available541Open in IMG/M
3300027163|Ga0209878_1019852Not Available905Open in IMG/M
3300027511|Ga0209843_1088736Not Available525Open in IMG/M
3300027716|Ga0209682_10028483All Organisms → cellular organisms → Bacteria1338Open in IMG/M
3300027723|Ga0209703_1124517All Organisms → cellular organisms → Bacteria979Open in IMG/M
3300027735|Ga0209261_10111900All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300027831|Ga0209797_10025843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2672Open in IMG/M
3300027831|Ga0209797_10084709All Organisms → cellular organisms → Bacteria1392Open in IMG/M
3300027880|Ga0209481_10016961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3185Open in IMG/M
3300027909|Ga0209382_10710526Not Available1080Open in IMG/M
3300027909|Ga0209382_10739354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1054Open in IMG/M
3300027956|Ga0209820_1008620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae2493Open in IMG/M
(restricted) 3300027995|Ga0233418_10144639Not Available751Open in IMG/M
(restricted) 3300028043|Ga0233417_10459220Not Available594Open in IMG/M
3300028678|Ga0302165_10055826All Organisms → cellular organisms → Bacteria1045Open in IMG/M
3300030619|Ga0268386_10630611Not Available711Open in IMG/M
3300031229|Ga0299913_10040448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4428Open in IMG/M
3300031232|Ga0302323_100900422All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300031576|Ga0247727_10017666All Organisms → cellular organisms → Bacteria11324Open in IMG/M
3300031576|Ga0247727_10019668All Organisms → cellular organisms → Bacteria10437Open in IMG/M
3300031576|Ga0247727_10139249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2383Open in IMG/M
3300031576|Ga0247727_10286145All Organisms → cellular organisms → Bacteria1412Open in IMG/M
3300031902|Ga0302322_100911634All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300032157|Ga0315912_10006389All Organisms → cellular organisms → Bacteria10557Open in IMG/M
3300033233|Ga0334722_10032675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila4277Open in IMG/M
3300033412|Ga0310810_10199998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2260Open in IMG/M
3300033482|Ga0316627_100322648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1282Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil16.07%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.04%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)7.14%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.25%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment5.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.36%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment3.57%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine3.57%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm3.57%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.68%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.68%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.79%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.79%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.79%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.79%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.79%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.89%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.89%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.89%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.89%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.89%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.89%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.89%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.89%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.89%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.89%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300002124Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011407Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT454_2EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014269Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1EnvironmentalOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021333Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.191 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026022Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300027163Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027723Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028678Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_2EnvironmentalOpen in IMG/M
3300030619Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq)EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
YBBDRAFT_113600663300001372Marine EstuarineMKLYIIFALIDLLIVLAYPFVFILSKLRQILGFKR*
YBBDRAFT_114039143300001372Marine EstuarineMKLNLIFALIDALILLAYPIVYLLSKIRRLFGFKR*
YBBDRAFT_115680023300001372Marine EstuarineMKLKLIFVLIDTLILLAYPFVFLFTKVRQLIGFKR*
YBBDRAFT_118106713300001372Marine EstuarineMEAHMKLNLIFALIDALILLAYPIVYLSTKIRRLLGFKR*
C687J26616_1011489023300002120SoilMKLYIIFALIDLFILLAYPIVFVSGKVRQLLRFKR*
C687J26631_1006128323300002124SoilMKLHIIFALIDLLILLAYPFVFISTKVRQLWGFKR*
C687J26631_1009742513300002124SoilMRLNLIFVLIDFLIILAYPFVFLAGKVRQLLKFKR*
Ga0055468_1004558913300003993Natural And Restored WetlandsMKLNLLFALIDFLILLAYPFVYISGKIRQLAKNKRWSRNEI*
Ga0070741_100004811373300005529Surface SoilMKLYLIFLLLDSLILLTYPVVYVANKIRRLLKSKR*
Ga0074478_177434023300005827Sediment (Intertidal)MKLYIIFALIDLLILLAYPFVFLFTKIRQLFGFKR*
Ga0074479_10079756103300005829Sediment (Intertidal)MKLYILFALIDLLILLAYPFVFLISKIRNALQAHK*
Ga0074479_1040111833300005829Sediment (Intertidal)MKLNLIFLLLDILILLAYPFVFLFSKIRQLFGFKR*
Ga0074471_1042170013300005831Sediment (Intertidal)MKFYLISVLIDVLILLAYPIVFVAGKLRQLFGFKR*
Ga0074471_1049897723300005831Sediment (Intertidal)MKIYLFFALIDLLIVLAYPFVFVFGKLRQIPGFKR*
Ga0074470_1029687313300005836Sediment (Intertidal)MKLNLIFALIDALILLVYPIVYLLSKIRRLFGFKR*
Ga0074470_1070545223300005836Sediment (Intertidal)MKLKLIFALIDTLILLAYPIVFMTGKIRQFLGFKR*
Ga0074470_1146349143300005836Sediment (Intertidal)MKLNLIFALIDALILLAYPIVYLSTKIRRLLGFKR*
Ga0068870_1020524433300005840Miscanthus RhizosphereMKLYILFALIDALILLAYPFVFVMAKVRQFMGFKR*
Ga0079222_1022138713300006755Agricultural SoilMRLNLIFVLIDFLIILAYPFVFLAEKVRQLLKFKR*
Ga0075428_10001650813300006844Populus RhizosphereMKLYLLMALIDTLILLAYPFIFLFSKVRRFLDFKR*
Ga0075428_10004408953300006844Populus RhizosphereMRLNLIFVLIDFLIILAYPFVFISEKVRQLLKIKR*
Ga0075428_10033562633300006844Populus RhizosphereMKLYLIITLMDALILLAYPFVFLFSKIRRFLGFKR*
Ga0075428_10102750223300006844Populus RhizosphereMKLYLLFALIDALILLAYPFVFLFSKVRQFMGFKR*
Ga0075428_10116829313300006844Populus RhizosphereMRLNLIFVLIDFLIILAYPFVFIADKVRQLLKIKR*
Ga0075421_10010478043300006845Populus RhizosphereMKLYLIFALIDALILLAYPFIFLFSKVRQFLGFKR*
Ga0073934_100000941603300006865Hot Spring SedimentMKLQMIFVLIDILILLAYPFVFIAAKVRQFLHFKR*
Ga0079219_1027217513300006954Agricultural SoilMKLYLLFALMDVLTLLAYPFVFLFLKIRHFLGFKR*
Ga0105098_1000399523300009081Freshwater SedimentMKLYLIFLLIDVFILLAYPFVFISGKVRQLLKFKR*
Ga0115027_1061423513300009131WetlandMKLYLIFALIDTLILLAYPIVFVMGKIRQLFGFKR*
Ga0105243_1001067653300009148Miscanthus RhizosphereMKLYFMFALIDLFTLLAYPFVFISGKVRQLLKIKR*
Ga0105092_1001440823300009157Freshwater SedimentMRLNLIFVLIDLFIVLAYPFVFVSGKVRQLFKIKR*
Ga0105092_1067636613300009157Freshwater SedimentMKLNLLFVLIDILILVAYPFVFVSGKVRQLLKIKR*
Ga0105104_1003363533300009168Freshwater SedimentMKLYLIFALIDLLIVLAYPFVFVFGKVRQLLKIKR*
Ga0115028_1014746923300009179WetlandMKLYLIFALIDTLILVAYPIVYLISKIRQLFGFKR*
Ga0105252_1019923323300009678SoilMKLYLLFALIDTLILLAYPFVYVASKMRQFMGFKR*
Ga0126310_1004002243300010044Serpentine SoilMRLNLIFALIDFLIILAYPFVFIFGKVRQLLKFKR*
Ga0126306_1000966953300010166Serpentine SoilMRLNLIFVLIDFLIILAYPFVFIFEKVRQLLKFKR*
Ga0126377_1101556023300010362Tropical Forest SoilMKLYLIFALMDLLILLAYPFVFLFSKMRKFLSFKR*
Ga0136847_1182862763300010391Freshwater SedimentMKLYLIFALIDTLILLAYPFVFVMGKVRQLLGFKR*
Ga0134127_1000515043300010399Terrestrial SoilMKLYLIIALIDTLILLAYPFIFLFSKVRRFLDFKR*
Ga0137356_100673323300011402SoilMKLYLLFALIDTLILLAYPIVFVMGKIRQLFGFKR*
Ga0137450_111317713300011407SoilMKLQLIFILIDVLILLAYPFVFVEGKVRQFLKIKR*
Ga0137440_106708913300011410SoilRHKMKLYLLFALIDTLILLAYPFVYVASKMRQFMGFKR*
Ga0137333_1000521113300011413SoilMKLYLIFVLIDTLILVAYPIVFVMGKIRQLFGFKR*
Ga0137333_107217523300011413SoilMKLYIIFALIDTLILLAYPIVFVLGKIRQLFGFKR*
Ga0137446_104490923300011419SoilMKLYIIFALIDMLILLAYPIVFVLGKIRQLFGFKR*
Ga0137314_109812713300011420SoilMKLYLIFALIDALILLAYPIVYVASKIRQLFGFKR*
Ga0137425_114300313300011422SoilMKLYVIFALIDALILLAYPFVFVIGKIRQLFGFKR*
Ga0137439_100335513300011424SoilMKLYLLFALIDLVILLAYPFVFLLAKLRQFLGFKR*
Ga0137455_124288913300011429SoilMKLYILFALIDALILLAYPFVFVMAKVRQFMAFKR*
Ga0137463_100945163300011444SoilMKLNIIFAFIDLFIVLAYPFVFLFTKIRQLFGFKR*
Ga0137431_115927833300012038SoilMEVKMKLYLLFALIDTLILLAYPFVYVASKMRQFMGFKR*
Ga0137465_101979943300012231SoilMKLYLIFALIDTLILVAYPIVYLTSKIRQLFGFKR*
Ga0137369_1008315123300012355Vadose Zone SoilMRLSLIFALIDVLIILAYPFVFLVEKLRQLLKIKR*
Ga0136635_1000085133300012530Polar Desert SandMKLYFLFALMDLFILLAYPIVFVSGKVRQLLHFKR*
Ga0163162_1203643013300013306Switchgrass RhizosphereVMRLSLLSALIDLLIILAYPFVFLAGKLHQLFKIKR*
Ga0075302_117090433300014269Natural And Restored WetlandsMEAHMKLNLIFALIDALILLAYPIVYLLSKIRRLFGFKR*
Ga0075316_100328123300014314Natural And Restored WetlandsMKLNLIFLLIDALVLLAFPFVFLYHKLRQMLGFKR*
Ga0157380_1139304433300014326Switchgrass RhizosphereMKLYLLFALIDTLILLAYPFVYVASKMRHFMGFKR*
Ga0157377_1092462213300014745Miscanthus RhizosphereKLYLIFALIDVLIILAYPFVFISAKVRQFFKIKR*
Ga0180074_104071523300014877SoilMRLKLIFALIDSLILLAYPIIYLFSKIRRFFGFKR*
Ga0180065_102257313300014878SoilMKLYLLFALIDTLILLAYPFVYVASKMRHFLGFKR*
Ga0180086_114141423300014883SoilMKLYIIFAMIDLLILLAYTIVFITRKVRQFIGFKR*
Ga0137420_140611433300015054Vadose Zone SoilMFGMEVNMRLNIIFLLIDTLILLAYPFVYVMGKIRQFLGFKR*
Ga0180085_102785123300015259SoilMKLYLYIALIDALILLAYPFVFLFSKVRQFLGFKR*
Ga0184638_101636823300018052Groundwater SedimentMKLYFMFALIDLFTLLAYPFVFISGKVRQLLKIKR
Ga0184638_116212413300018052Groundwater SedimentPLDVKMKLYFIFALIDLLILIAYPFVFISGKVRQLLKFKR
Ga0184638_118375213300018052Groundwater SedimentMKLYMIFALIDALILLAYPFVFVMAKVRQFMGFKR
Ga0184615_1021158223300018059Groundwater SedimentMKLYMLFVLIDLMILLAYPFVFILAKLRQFLGFKR
Ga0184615_1040069023300018059Groundwater SedimentMKLYIIFAMIDLLILLAYPIVFIAGKVRQFIGFKR
Ga0184629_1006010523300018084Groundwater SedimentMKLYLIFALIDALILLAYPIVYVASKIRQLFGFKR
Ga0184629_1014040423300018084Groundwater SedimentMKLYLIFALIDALILVAYPFVYLISKVRQFIGFKR
Ga0190269_1000428923300018465SoilMKLQVIFILIDIAILLAYPFVFVAGKMRQFLKFKR
Ga0193741_100248043300019884SoilMKLYFLFALMDLFILLAYPIVFVSGKVRQLLHFKR
Ga0210377_10000026513300021090Groundwater SedimentMKLYLIFALIDTLILIAYPIVYLISKIRQFMGFKR
Ga0210377_10000447353300021090Groundwater SedimentMKLQIIFTLIDILILLAYPFVFVAAKVRQLLNFKR
Ga0210324_121909423300021333EstuarineMKLYIIFVLIDVLILLAYPFVFLFTKIRQLFGFKR
Ga0210324_134393523300021333EstuarineMKLYLIFALIDVLIILAYPFVFISAKVRQFLKIKR
Ga0209619_10003591123300025159SoilMKLYIIFALIDLFILLAYPIVFVSGKVRQLLRFKR
Ga0209172_100000085743300025310Hot Spring SedimentMKLQMIFVLIDILILLAYPFVFIAAKVRQFLHFKR
Ga0209323_1029834413300025314SoilMKLQIIFIIIDILILLAYPVVFLVNKIRQFFQINR
Ga0207684_1008865033300025910Corn, Switchgrass And Miscanthus RhizosphereMRLYLIFALIDVLIVLAYPFVFVAGKLHQLFKIKR
Ga0208649_102997123300026022Rice Paddy SoilMKLYLIFLLIDVLVLLAYPFVYVIHKIRTIFQVKR
Ga0207674_1009548223300026116Corn RhizosphereMRLYLIFALIDVLIILAYPFVFIAGKLHQLFKIKR
Ga0209131_100240683300026320Grasslands SoilMKLYLLFALMDALTLLAYPFVFLFSKIRHFLGFKR
Ga0256867_1032428513300026535SoilMKLSLIFILIDIVILVAYPIVFLMGKMRQFLKIKR
Ga0209878_101985223300027163Groundwater SandMKLYFLFALIDLFIVLAYPIVFVSGKVRQLLHFKR
Ga0209843_108873623300027511Groundwater SandMKLYLIFALIDALILLAYPFIFLFSKVRQFLGFKR
Ga0209682_1002848323300027716Wetland SedimentMKLKLIFVLIDMLILLAYPIVFVVGKTRQLFGFKR
Ga0209703_112451723300027723Freshwater SedimentMKLHFIFMLIDLLILIAYPFVFISGKVRQLLGIKR
Ga0209261_1011190023300027735Wetland SedimentMKLKLIFVIIDMLILLAYPIVFVVGKTRQLFGFKR
Ga0209797_1002584343300027831Wetland SedimentMKLYLIFALIDTLILVAYPIVYLISKVRQFMGFKR
Ga0209797_1008470933300027831Wetland SedimentMKLNLIFVLIDVLIVLAYPFVYIAGKLRQFPKIRR
Ga0209481_1001696143300027880Populus RhizosphereMRLNLIFVLIDFLIILAYPFVFISEKVRQLLKIKR
Ga0209382_1071052623300027909Populus RhizosphereMKLYLLMALIDTLILLAYPFIFLFSKVRRFLDFKR
Ga0209382_1073935423300027909Populus RhizosphereMKLYLLFALIDALILLAYPFVFLFSKVRQFMGFKR
Ga0209820_100862033300027956Freshwater SedimentMKLYLIFLLIDVFILLAYPFVFISGKVRQLLKFKR
(restricted) Ga0233418_1014463923300027995SedimentMKLQIIFVLIDVLILLAYPFVFISAKVRQLLHFKR
(restricted) Ga0233417_1045922013300028043SedimentMKLYVIFALIDLLILLVYPILFITAKVRQLLGFKR
Ga0302165_1005582623300028678FenMRLYIIFALIDLLIVVAYPIVYVLGKIRQLFGFKR
Ga0268386_1063061123300030619SoilMKLSLIFALIDIMILVAYPIVFLMGKMRQFLNIKR
Ga0299913_1004044833300031229SoilMKLNLIFVLIDVLIVLAYPFVFLFGKVRQLLKNKG
Ga0302323_10090042223300031232FenMKLKLIFALIDTLILLAYPIVFVMEKVRQIFGFKR
Ga0247727_1001766623300031576BiofilmMKLYLLFALIDVMILLAYPFVYLISKVRQFMGFKR
Ga0247727_1001966853300031576BiofilmMKLYIIFALIDLLILLAYPFVFLAGKVRQLLGFKR
Ga0247727_1013924923300031576BiofilmMKLYIIFALIDLLILLAYPFVFPAGKVRQLLGFKR
Ga0247727_1028614523300031576BiofilmMKLYLLFALIDMLILLAYPIVYMASKLRQFFGFKR
Ga0302322_10091163413300031902FenMKLKLIFALIDTLILLAYPIVFVMGKVRQIFGFKR
Ga0315912_1000638933300032157SoilMKLYVIFALIDALILLAYPFVFLFTKLRQLFGFKR
Ga0334722_1003267553300033233SedimentMKLYLIFLLLDSLILLTYPVVYVANKIRRLLKSKR
Ga0310810_1019999843300033412SoilMRLSLILALIDVLIILAYPFVFLAAKLHQLFKIKR
Ga0316627_10032264833300033482SoilMKLYIIFAMIDLLILLAYPIVFIVGKVRQVLGFRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.