Metagenome / Metatranscriptome Family F084863

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F084863
Family Type	Metagenome / Metatranscriptome
Number of Sequences	112
Average Sequence Length	42 residues
Representative Sequence	MTRTFGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR
Number of Associated Samples	86
Number of Associated Scaffolds	112

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	74.11 %
% of genes near scaffold ends (potentially truncated)	25.00 %
% of genes from short scaffolds (< 2000 bps)	86.61 %
Associated GOLD sequencing projects	78
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (91.964 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.071 % of family members)
Environment Ontology (ENVO)	Unclassified (33.036 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (51.786 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.58
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 112 Family Scaffolds
PF04074	DUF386	74.11
PF06723	MreB_Mbl	5.36
PF08281	Sigma70_r4_2	0.89
PF01740	STAS	0.89
PF16864	Dimerisation2	0.89
PF05957	DUF883	0.89
PF03446	NAD_binding_2	0.89
PF13298	LigD_N	0.89

COG ID	Name	Functional Category	% Frequency in 112 Family Scaffolds
COG2731	Beta-galactosidase, beta subunit	Carbohydrate transport and metabolism [G]	74.11
COG1077	Cell shape-determining ATPase MreB, actin-like superfamily	Cell cycle control, cell division, chromosome partitioning [D]	5.36
COG4575	Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family	Translation, ribosomal structure and biogenesis [J]	0.89

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	91.96 %
Unclassified	root	N/A	8.04 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	91.96 %
Unclassified	root	N/A	8.04 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	91.96 %
Unclassified	root	N/A	8.04 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	21.43 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	19.64 %
Unclassified	root	N/A	8.04 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.36 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.89 %

Name	Rank	Taxonomy	Distribution
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	19.64 %
Unclassified	root	N/A	8.04 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	6.25 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.89 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %

Name	Rank	Taxonomy	Distribution
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	19.64 %
Unclassified	root	N/A	8.04 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.57 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.89 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %

Name	Rank	Taxonomy	Distribution
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	16.96 %
Unclassified	root	N/A	8.04 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.57 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	2.68 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.89 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %

Name	Rank	Taxonomy	Distribution
Pirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae	16.96 %
Unclassified	root	N/A	8.04 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.57 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	2.68 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.89 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %

Name	Rank	Taxonomy	Distribution
Lignipirellula	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula	12.50 %
Unclassified	root	N/A	8.04 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Candidatus Laterigemmans	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans	4.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.57 %
unclassified Planctomycetaceae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae	2.68 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.89 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %

Name	Rank	Taxonomy	Distribution
Lignipirellula cremea	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	12.50 %
Unclassified	root	N/A	8.04 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	6.25 %
Candidatus Laterigemmans baculatus	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus	4.46 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3.57 %
Planctomycetaceae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	2.68 %
bacterium	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	0.89 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.89 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886011\|MRS1b_contig_472085	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
2162886012\|MBSR1b_contig_2865279	All Organisms → cellular organisms → Bacteria	851	Open in IMG/M
2228664021\|ICCgaii200_c0780051	All Organisms → cellular organisms → Bacteria → Acidobacteria	1268	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_101587588	All Organisms → cellular organisms → Bacteria	2928	Open in IMG/M
3300000789\|JGI1027J11758_12471337	All Organisms → cellular organisms → Bacteria	791	Open in IMG/M
3300000890\|JGI11643J12802_10240036	All Organisms → cellular organisms → Bacteria	2295	Open in IMG/M
3300000955\|JGI1027J12803_101371222	All Organisms → cellular organisms → Bacteria	821	Open in IMG/M
3300000956\|JGI10216J12902_100328352	All Organisms → cellular organisms → Bacteria	2726	Open in IMG/M
3300000956\|JGI10216J12902_104450572	All Organisms → cellular organisms → Bacteria → Acidobacteria	1130	Open in IMG/M
3300001431\|F14TB_100405290	All Organisms → cellular organisms → Bacteria	1622	Open in IMG/M
3300001431\|F14TB_101402675	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	887	Open in IMG/M
3300002568\|C688J35102_120827446	All Organisms → cellular organisms → Bacteria	1715	Open in IMG/M
3300003163\|Ga0006759J45824_1046381	All Organisms → cellular organisms → Bacteria	532	Open in IMG/M
3300003267\|soilL1_10116740	All Organisms → cellular organisms → Bacteria → Acidobacteria	2463	Open in IMG/M
3300004114\|Ga0062593_100007077	All Organisms → cellular organisms → Bacteria	4877	Open in IMG/M
3300004114\|Ga0062593_100071213	All Organisms → cellular organisms → Bacteria	2300	Open in IMG/M
3300004114\|Ga0062593_100222536	All Organisms → cellular organisms → Bacteria → Acidobacteria	1528	Open in IMG/M
3300004114\|Ga0062593_100262432	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1438	Open in IMG/M
3300004114\|Ga0062593_100283582	All Organisms → cellular organisms → Bacteria → Acidobacteria	1397	Open in IMG/M
3300004114\|Ga0062593_100367108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1268	Open in IMG/M
3300004114\|Ga0062593_101061845	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300004156\|Ga0062589_101855557	All Organisms → cellular organisms → Bacteria	607	Open in IMG/M
3300004156\|Ga0062589_102669150	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300004157\|Ga0062590_100084706	All Organisms → cellular organisms → Bacteria	1938	Open in IMG/M
3300004479\|Ga0062595_100183001	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus	1271	Open in IMG/M
3300005093\|Ga0062594_100082658	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	1830	Open in IMG/M
3300005093\|Ga0062594_100192848	All Organisms → cellular organisms → Bacteria	1408	Open in IMG/M
3300005289\|Ga0065704_10602976	All Organisms → cellular organisms → Bacteria	606	Open in IMG/M
3300005290\|Ga0065712_10365477	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus	769	Open in IMG/M
3300005293\|Ga0065715_10217466	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1286	Open in IMG/M
3300005293\|Ga0065715_10242073	All Organisms → cellular organisms → Bacteria → Acidobacteria	1196	Open in IMG/M
3300005293\|Ga0065715_10319479	All Organisms → cellular organisms → Bacteria	1005	Open in IMG/M
3300005293\|Ga0065715_10871568	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus	584	Open in IMG/M
3300005336\|Ga0070680_100413114	All Organisms → cellular organisms → Bacteria → Acidobacteria	1151	Open in IMG/M
3300005347\|Ga0070668_101055483	All Organisms → cellular organisms → Bacteria → Acidobacteria	732	Open in IMG/M
3300005451\|Ga0066681_10039789	All Organisms → cellular organisms → Bacteria	2526	Open in IMG/M
3300005456\|Ga0070678_101878703	Not Available	565	Open in IMG/M
3300005456\|Ga0070678_102339630	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300005457\|Ga0070662_100822399	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	790	Open in IMG/M
3300005471\|Ga0070698_102024394	Not Available	529	Open in IMG/M
3300005615\|Ga0070702_100156991	All Organisms → cellular organisms → Bacteria	1466	Open in IMG/M
3300005713\|Ga0066905_102023262	All Organisms → cellular organisms → Bacteria	535	Open in IMG/M
3300005764\|Ga0066903_108156534	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	536	Open in IMG/M
3300005840\|Ga0068870_11108472	All Organisms → cellular organisms → Bacteria	569	Open in IMG/M
3300005841\|Ga0068863_100796648	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	942	Open in IMG/M
3300006046\|Ga0066652_100085127	All Organisms → cellular organisms → Bacteria	2507	Open in IMG/M
3300006844\|Ga0075428_100002577	All Organisms → cellular organisms → Bacteria → Proteobacteria	19701	Open in IMG/M
3300006844\|Ga0075428_100545045	All Organisms → cellular organisms → Bacteria → Acidobacteria	1240	Open in IMG/M
3300006854\|Ga0075425_100026146	All Organisms → cellular organisms → Bacteria → Proteobacteria	6443	Open in IMG/M
3300006854\|Ga0075425_102552452	Not Available	565	Open in IMG/M
3300006871\|Ga0075434_100797790	All Organisms → cellular organisms → Bacteria	960	Open in IMG/M
3300006918\|Ga0079216_10516775	All Organisms → cellular organisms → Bacteria	794	Open in IMG/M
3300009012\|Ga0066710_101219478	All Organisms → cellular organisms → Bacteria → Acidobacteria	1166	Open in IMG/M
3300009094\|Ga0111539_10036885	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5907	Open in IMG/M
3300009098\|Ga0105245_11026683	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	869	Open in IMG/M
3300009162\|Ga0075423_11712317	Not Available	677	Open in IMG/M
3300009166\|Ga0105100_10189342	All Organisms → cellular organisms → Bacteria → Acidobacteria	1225	Open in IMG/M
3300011119\|Ga0105246_10610226	All Organisms → cellular organisms → Bacteria	944	Open in IMG/M
3300012201\|Ga0137365_10276865	All Organisms → cellular organisms → Bacteria	1245	Open in IMG/M
3300012208\|Ga0137376_10038191	All Organisms → cellular organisms → Bacteria	3861	Open in IMG/M
3300012212\|Ga0150985_105128096	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1933	Open in IMG/M
3300012212\|Ga0150985_110987346	All Organisms → cellular organisms → Bacteria	908	Open in IMG/M
3300012212\|Ga0150985_112364134	All Organisms → cellular organisms → Bacteria	826	Open in IMG/M
3300012469\|Ga0150984_113705502	Not Available	500	Open in IMG/M
3300012469\|Ga0150984_116892137	All Organisms → cellular organisms → Bacteria	795	Open in IMG/M
3300012469\|Ga0150984_117178452	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	595	Open in IMG/M
3300012469\|Ga0150984_121424933	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300012944\|Ga0137410_10471908	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1022	Open in IMG/M
3300012951\|Ga0164300_10308577	All Organisms → cellular organisms → Bacteria → Acidobacteria	831	Open in IMG/M
3300012961\|Ga0164302_10409068	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus	928	Open in IMG/M
3300012989\|Ga0164305_11375765	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	620	Open in IMG/M
3300012989\|Ga0164305_11519668	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	594	Open in IMG/M
3300014745\|Ga0157377_10815389	All Organisms → cellular organisms → Bacteria	689	Open in IMG/M
3300015371\|Ga0132258_13424101	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	1088	Open in IMG/M
3300015372\|Ga0132256_102455749	Not Available	623	Open in IMG/M
3300015373\|Ga0132257_101185045	All Organisms → cellular organisms → Bacteria	966	Open in IMG/M
3300018066\|Ga0184617_1114043	All Organisms → cellular organisms → Bacteria	767	Open in IMG/M
3300018084\|Ga0184629_10015341	All Organisms → cellular organisms → Bacteria	3068	Open in IMG/M
3300018422\|Ga0190265_10571487	All Organisms → cellular organisms → Bacteria → Acidobacteria	1248	Open in IMG/M
3300018429\|Ga0190272_11786947	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	641	Open in IMG/M
3300018433\|Ga0066667_11308402	Not Available	633	Open in IMG/M
3300018476\|Ga0190274_10097474	All Organisms → cellular organisms → Bacteria → Acidobacteria	2325	Open in IMG/M
3300018476\|Ga0190274_10955674	All Organisms → cellular organisms → Bacteria	928	Open in IMG/M
3300019377\|Ga0190264_11513665	All Organisms → cellular organisms → Bacteria	584	Open in IMG/M
3300020006\|Ga0193735_1045671	All Organisms → cellular organisms → Bacteria → Acidobacteria	1312	Open in IMG/M
3300021339\|Ga0193706_1196432	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium	545	Open in IMG/M
3300021972\|Ga0193737_1057966	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	550	Open in IMG/M
3300022534\|Ga0224452_1070838	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	1051	Open in IMG/M
3300022756\|Ga0222622_10060483	All Organisms → cellular organisms → Bacteria → Acidobacteria	2183	Open in IMG/M
3300022756\|Ga0222622_10115590	All Organisms → cellular organisms → Bacteria	1677	Open in IMG/M
3300022756\|Ga0222622_10318947	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	1075	Open in IMG/M
3300022880\|Ga0247792_1090929	Not Available	617	Open in IMG/M
3300025908\|Ga0207643_11031761	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300025917\|Ga0207660_11106006	Not Available	646	Open in IMG/M
3300025923\|Ga0207681_11266530	All Organisms → cellular organisms → Bacteria	619	Open in IMG/M
3300025926\|Ga0207659_10528754	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	1001	Open in IMG/M
3300025937\|Ga0207669_11458200	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300025938\|Ga0207704_11232848	All Organisms → cellular organisms → Bacteria → Terrabacteria group	638	Open in IMG/M
3300025940\|Ga0207691_10319977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1330	Open in IMG/M
3300025961\|Ga0207712_11117955	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300027552\|Ga0209982_1041163	All Organisms → cellular organisms → Bacteria → Acidobacteria	737	Open in IMG/M
3300027907\|Ga0207428_10156887	All Organisms → cellular organisms → Bacteria	1730	Open in IMG/M
3300028380\|Ga0268265_10242955	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1590	Open in IMG/M
3300028381\|Ga0268264_10697832	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1008	Open in IMG/M
3300028784\|Ga0307282_10071200	All Organisms → cellular organisms → Bacteria	1581	Open in IMG/M
3300028802\|Ga0307503_10402409	All Organisms → cellular organisms → Bacteria	715	Open in IMG/M
3300028828\|Ga0307312_10950522	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	569	Open in IMG/M
3300031716\|Ga0310813_10583185	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	987	Open in IMG/M
3300031716\|Ga0310813_11051511	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300031858\|Ga0310892_10406752	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	887	Open in IMG/M
3300034644\|Ga0370548_092774	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Lignipirellula → Lignipirellula cremea	601	Open in IMG/M
3300034661\|Ga0314782_149217	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Candidatus Laterigemmans → Candidatus Laterigemmans baculatus	572	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	58.93%
Host-Associated	Host-Associated	41.07%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	52.68%
Plants	Host-Associated → Plants	41.07%
Aquatic	Environmental → Aquatic	6.25%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	52.68%
Rhizosphere	Host-Associated → Plants → Rhizosphere	21.43%
Rhizoplane	Host-Associated → Plants → Rhizoplane	19.64%
Sediment	Environmental → Aquatic → Sediment	5.36%
Freshwater	Environmental → Aquatic → Freshwater	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	44.64%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	11.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	10.71%
Loam	Environmental → Terrestrial → Soil → Loam	8.04%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.25%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.36%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.79%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.89%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	18.75%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	14.29%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	11.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	10.71%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	9.82%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.25%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.36%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.57%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.68%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.79%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.79%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.79%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.89%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	16.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	11.61%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.04%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.14%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	6.25%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	4.46%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	3.57%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	2.68%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.68%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	2.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.68%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.79%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.79%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.79%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.79%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.79%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.79%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.89%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.89%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.89%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.89%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.89%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.89%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.89%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.89%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886011	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000789	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000890	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003163	Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only)	Host-Associated	Open in IMG/M
3300003267	Sugarcane bulk soil Sample L1	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental	Open in IMG/M
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated	Open in IMG/M
3300005451	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental	Open in IMG/M
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012951	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300018066	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental	Open in IMG/M
3300021339	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1	Environmental	Open in IMG/M
3300021972	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2	Environmental	Open in IMG/M
3300022534	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300022880	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6	Environmental	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028784	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300028828	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300034644	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034661	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MRS1b_0766.00000050	2162886011	Miscanthus Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSHR
MBSR1b_0187.00007870	2162886012	Miscanthus Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR
ICCgaii200_07800512	2228664021	Soil	MTRTLGAAIGVAVILLFFASLTFEQNRVLTMARAAVGSHR
INPhiseqgaiiFebDRAFT_1015875884	3300000364	Soil	MNRTFGRTFGAALGVVIVLLFFASLTIEQNRVVSIARATVGSHR*
JGI1027J11758_124713373	3300000789	Soil	AALGVVIVLLFFASLTIEQNRVVSIARATVGSHR*
JGI11643J12802_102400363	3300000890	Soil	MTRTLGAAIGVAVILLFFASLTFEQNRVLTMARAAVGSHR*
JGI1027J12803_1013712222	3300000955	Soil	PRGGVITMNRTFGRTFGAALGVVIVLLFFASLTIEQNRVVSIARATVGSHR*
JGI10216J12902_1003283523	3300000956	Soil	MTRTLGAALGIVIVVLFFASLNTEQNRVVAVARAAAASHK*
JGI10216J12902_1044505721	3300000956	Soil	MTRTLGAALGVVIIILFFASLNTEQNRVVAFARASAASQK*
F14TB_1004052904	3300001431	Soil	MSRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARAAVGSHR*
F14TB_1014026753	3300001431	Soil	MTRTLGAAIGVAIILLFFASLTFEQNRVLTIARATAGSHR*
C688J35102_1208274462	3300002568	Soil	MTRTLGAALGVAIVLLFFASLTFEQHRVLTIAHATVGSHR*
Ga0006759J45824_10463811	3300003163	Avena Fatua Rhizosphere	GVCMTRTLGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR*
soilL1_101167404	3300003267	Sugarcane Root And Bulk Soil	MTRTLGAALGVAIVLLFFASLTFEQNRVTSLIARATQSARR*
Ga0062593_1000070775	3300004114	Soil	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSHR*
Ga0062593_1000712133	3300004114	Soil	MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARAAVGSHR*
Ga0062593_1002225362	3300004114	Soil	MTRTFGAALGVVVVLLFFASLTVEQNRVVSMARATVGWHK*
Ga0062593_1002624323	3300004114	Soil	PNKTLWRCNAMTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR*
Ga0062593_1002835822	3300004114	Soil	MTRTFGAALGVVVVLLFFASLTFEQNRVVSYARAAAMARK*
Ga0062593_1003671083	3300004114	Soil	GRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR*
Ga0062593_1010618451	3300004114	Soil	GRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR*
Ga0062589_1018555572	3300004156	Soil	RTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR*
Ga0062589_1026691501	3300004156	Soil	MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR*
Ga0062590_1000847062	3300004157	Soil	MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR*
Ga0062595_1001830012	3300004479	Soil	MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATASSHR*
Ga0062594_1000826583	3300005093	Soil	LLDYFPNKTLWRCNAMTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR*
Ga0062594_1001928483	3300005093	Soil	MNRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR*
Ga0065704_106029762	3300005289	Switchgrass Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRAVTLARSVATSHR*
Ga0065712_103654772	3300005290	Miscanthus Rhizosphere	MTRTLGAALGVVIVLLFFASLNVEQNRVVAMARAVVGSQK*
Ga0065715_102174662	3300005293	Miscanthus Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTAVGSHR*
Ga0065715_102420732	3300005293	Miscanthus Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATVGSHR*
Ga0065715_103194792	3300005293	Miscanthus Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR*
Ga0065715_108715682	3300005293	Miscanthus Rhizosphere	MTRTLGAALGVVIIILFFASLNTEQNRVVAFARSSVASQK*
Ga0070680_1004131142	3300005336	Corn Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTAVGSRR*
Ga0070668_1010554831	3300005347	Switchgrass Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARAAVGSHR*
Ga0066681_100397892	3300005451	Soil	MTRTVGAAIGVVVIVLFFASLTIEQNRALTLARAPIASHR*
Ga0070678_1018787032	3300005456	Miscanthus Rhizosphere	MTRTLGAALGVVVVLLFFASLTIEQNRVLSMARATVGWQK*
Ga0070678_1023396301	3300005456	Miscanthus Rhizosphere	PIGKSLWRCNSMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR*
Ga0070662_1008223992	3300005457	Corn Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATVSSHR*
Ga0070698_1020243942	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	MTRTFGAALGVVVVLLFFASLTFEQNRVVSFARAAAIPHK*
Ga0070702_1001569911	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	PIGKSLWRCNSMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR*
Ga0066905_1020232622	3300005713	Tropical Forest Soil	RTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR*
Ga0066903_1081565342	3300005764	Tropical Forest Soil	MTRTFGAALGVVIVLLFFASLTIEQNRVVTMARTTVGAHR*
Ga0068870_111084722	3300005840	Miscanthus Rhizosphere	MSRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR*
Ga0068863_1007966482	3300005841	Switchgrass Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSH
Ga0066652_1000851273	3300006046	Soil	MTRTLGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR*
Ga0075428_10000257712	3300006844	Populus Rhizosphere	MTRTLGAAIGVAVILLFFASLTFEQNRVLTIARAAVGSHR*
Ga0075428_1005450452	3300006844	Populus Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRAVTLARSVVTSHR*
Ga0075425_1000261466	3300006854	Populus Rhizosphere	MTRTVGAAIGVVVVLLFFASLTIEQNRALTLARAPIASHR*
Ga0075425_1025524521	3300006854	Populus Rhizosphere	MTRTFGAALGVVIVLLFFASLTIEQNRVVTVARATVGAHR*
Ga0075434_1007977901	3300006871	Populus Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARANVGSHR*
Ga0079216_105167752	3300006918	Agricultural Soil	MTRTVGAAIGAVVMLLFFASLSNEHNRVLSMARATIGWQK*
Ga0066710_1012194782	3300009012	Grasslands Soil	MTRTFGAALGVVVVLLFFASLTVEQNRVVGFARAAAVSRK
Ga0111539_100368856	3300009094	Populus Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRAVTLARSVVSSHR*
Ga0105245_110266831	3300009098	Miscanthus Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGS
Ga0075423_117123171	3300009162	Populus Rhizosphere	MTRTVGAAIGVVVVLLFFASLTIEQNRVVSLARTTVTSHK*
Ga0105100_101893422	3300009166	Freshwater Sediment	MTRTLGAAIGAVLMLLFFATLNNEHNRVLSMARASMGWQK*
Ga0105246_106102261	3300011119	Miscanthus Rhizosphere	IGKSLWRCNPMSRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR*
Ga0137365_102768653	3300012201	Vadose Zone Soil	MTRTFGAALGVVVVLLFFASLTVEQNRVVSLDARAAAVARK*
Ga0137376_100381914	3300012208	Vadose Zone Soil	MTRTFGAALGVVVVLLFFASLTVEQNRVVSLDARAAAVVRK*
Ga0150985_1051280964	3300012212	Avena Fatua Rhizosphere	WRWIAMTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTTVGSHR*
Ga0150985_1109873463	3300012212	Avena Fatua Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARAAVGSHR*
Ga0150985_1123641342	3300012212	Avena Fatua Rhizosphere	FISMTRTFGAALGVVVVLLFFASLTIEQNRVVSVARATIGSHK*
Ga0150984_1137055022	3300012469	Avena Fatua Rhizosphere	MTRTLGAALGVLVVLLFFASLTTEQNRVLSMARATIGWQK*
Ga0150984_1168921372	3300012469	Avena Fatua Rhizosphere	RWIAMTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTTVGSHR*
Ga0150984_1171784522	3300012469	Avena Fatua Rhizosphere	MTRTVGAALGVVVVLLFFASLTMEQNRVVSIARATIGSHK*
Ga0150984_1214249332	3300012469	Avena Fatua Rhizosphere	GVCMTRTLGAALGVAIVLLFFASLTIEQNRVLTIARTAVGSHR*
Ga0137410_104719081	3300012944	Vadose Zone Soil	MNRTFGRTFGAALGVVIILLFFASLTIEQNRVLSIARATVGSHR*
Ga0164300_103085773	3300012951	Soil	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR*
Ga0164302_104090682	3300012961	Soil	VTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR*
Ga0164305_113757651	3300012989	Soil	GAALGVVVVLLFFASLTFEQNRVVSFARAAAMARK*
Ga0164305_115196682	3300012989	Soil	MTRTFGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR*
Ga0157377_108153892	3300014745	Miscanthus Rhizosphere	RTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLARATVGSHR*
Ga0132258_134241013	3300015371	Arabidopsis Rhizosphere	WRCIAMTRTLGAALGVAIVLLFFASLTFEQNRVLTIARATVGSHR*
Ga0132256_1024557492	3300015372	Arabidopsis Rhizosphere	MTRTFGAALGVVIVLLFFASLTIEQNRVVTVARATVGAH
Ga0132257_1011850451	3300015373	Arabidopsis Rhizosphere	TFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR*
Ga0184617_11140432	3300018066	Groundwater Sediment	MTRTFGAALGVVVVLLFFASLTFEQNRIVSLDNRAAAVARK
Ga0184629_100153414	3300018084	Groundwater Sediment	MTRTFGAALGAVIVLLFFASLSFEQNRVVSMARATVGWHK
Ga0190265_105714873	3300018422	Soil	MSRTIGAAIGAVLMLLFFATLNNEHNRVLSMARASMGWQK
Ga0190272_117869471	3300018429	Soil	RKAIWGGCEMTRTFGAALGVVIVLLFFASLNTEQNRVVAVARAAAASHK
Ga0066667_113084021	3300018433	Grasslands Soil	MTRTLGAALGVAIVLLFFASLTIEQNRVLTIARAAVGSHR
Ga0190274_100974743	3300018476	Soil	MTRTLGAALGVVVVLLFFASLTIEQNRVMSMARATVGWQK
Ga0190274_109556742	3300018476	Soil	MTRTLGAAIGVVIVILFFASLNTEQNRVVAVARAAASSHK
Ga0190264_115136652	3300019377	Soil	MTRTIGAAIGAVVMLLFFATLTNEHNRVLSMARATIGWQK
Ga0193735_10456712	3300020006	Soil	MTRTFGAALGVVVVLLFFASLTFEQNRVASFARTAPVARK
Ga0193706_11964321	3300021339	Soil	MTRTLGAALGVVIIILFFASLNTEQNRVVAFARASAASQK
Ga0193737_10579662	3300021972	Soil	MTRTLGAALGVVIVVLFFASLNTEQNRVVAVARAAAASHK
Ga0224452_10708383	3300022534	Groundwater Sediment	MTRTFGAALGVVIVLLFFASLTVEQNRVVAVARAAAVPQK
Ga0222622_100604833	3300022756	Groundwater Sediment	MTRTLGAALGVVVVLLFFASLTIEQNRVLSMARATVGWQK
Ga0222622_101155904	3300022756	Groundwater Sediment	MTRTLGAALGVVIIILFFASLNTEQNRVVAFARSSAASQK
Ga0222622_103189472	3300022756	Groundwater Sediment	MTRTFGAALGVVVVLLFFASLNFEQNRAVSLDARAAAVARK
Ga0247792_10909292	3300022880	Soil	MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARAAVGSHR
Ga0207643_110317612	3300025908	Miscanthus Rhizosphere	MSRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR
Ga0207660_111060062	3300025917	Corn Rhizosphere	MTRTLGAAIGFAFVLLFFASLTFEQNRVLTMARAAHMTNRLTFFA
Ga0207681_112665302	3300025923	Switchgrass Rhizosphere	MNAGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR
Ga0207659_105287542	3300025926	Miscanthus Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARATVGSHR
Ga0207669_114582001	3300025937	Miscanthus Rhizosphere	MNRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSMARATVGSHR
Ga0207704_112328481	3300025938	Miscanthus Rhizosphere	KSLWRCNSMNRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR
Ga0207691_103199771	3300025940	Miscanthus Rhizosphere	SFPSNRKSLWRCNPMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR
Ga0207712_111179551	3300025961	Switchgrass Rhizosphere	MSRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSIARATVGSHR
Ga0209982_10411632	3300027552	Arabidopsis Thaliana Rhizosphere	MTRTLGAALGIVIVVLFFASLNTEQKRVVAVARAAAASHK
Ga0207428_101568873	3300027907	Populus Rhizosphere	MTRTLGAAIGVAVILLFFASLTFEQNRVLTIARAAVGSHR
Ga0268265_102429553	3300028380	Switchgrass Rhizosphere	MTRTLGAALGVAIVLLFFASLTFEQNRVLTIARTAVGSHR
Ga0268264_106978322	3300028381	Switchgrass Rhizosphere	MTRTFGRTFGAALGVLFVLLFFASLTLEQNRVLSLAR
Ga0307282_100712002	3300028784	Soil	MTRTFGAAIGVVVVLLFFASLTFEQNRVVSFARTAAVARK
Ga0307503_104024092	3300028802	Soil	MTRTFGAALGVVIVLLFFASLTIEQNRVVSVARATVSHR
Ga0307312_109505222	3300028828	Soil	MTRTFGAALGVVVVLLFFASLTFEQNRVVSLDARAAAVARK
Ga0310813_105831852	3300031716	Soil	MTRTLGAAIGAAVVLLFFASLTFEQNRVLTIARAAVGSHR
Ga0310813_110515112	3300031716	Soil	IGKSLWRCNSMTRTFGRTFGAALGVLFVLLFFASLTIEQNRVLSIARASVGSHR
Ga0310892_104067521	3300031858	Soil	MTRTLGAAIGVAVVLLFFASLTFEQNRVLTIARSAVGSHR
Ga0370548_092774_27_149	3300034644	Soil	MTRTFGAALGVVVVLLFFASLTFEQNRVQSFARAAAVAHK
Ga0314782_149217_465_572	3300034661	Soil	GAAIGVAVVLLFFASLTFEQNRVLTIARAAVGSHR

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F084863

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences