| Basic Information | |
|---|---|
| Family ID | F084860 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 112 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MPLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 112 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 86.61 % |
| % of genes near scaffold ends (potentially truncated) | 19.64 % |
| % of genes from short scaffolds (< 2000 bps) | 83.04 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.107 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.536 % of family members) |
| Environment Ontology (ENVO) | Unclassified (53.571 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (68.750 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 112 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 4.46 |
| PF02738 | MoCoBD_1 | 4.46 |
| PF00270 | DEAD | 2.68 |
| PF11874 | DUF3394 | 0.89 |
| PF03965 | Penicillinase_R | 0.89 |
| PF13432 | TPR_16 | 0.89 |
| PF00271 | Helicase_C | 0.89 |
| PF02897 | Peptidase_S9_N | 0.89 |
| PF02653 | BPD_transp_2 | 0.89 |
| PF00903 | Glyoxalase | 0.89 |
| PF00753 | Lactamase_B | 0.89 |
| COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
|---|---|---|---|
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 0.89 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 0.89 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.89 |
| COG3682 | Transcriptional regulator, CopY/TcrY family | Transcription [K] | 0.89 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.11 % |
| Unclassified | root | N/A | 0.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_14002602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
| 3300000956|JGI10216J12902_107884958 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
| 3300001431|F14TB_102572534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300004643|Ga0062591_101134975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300005328|Ga0070676_11264826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
| 3300005331|Ga0070670_101633252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300005353|Ga0070669_100058200 | All Organisms → cellular organisms → Bacteria | 2836 | Open in IMG/M |
| 3300005365|Ga0070688_100469709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
| 3300005367|Ga0070667_101866179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300005543|Ga0070672_100032164 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3957 | Open in IMG/M |
| 3300005543|Ga0070672_100071525 | All Organisms → cellular organisms → Bacteria | 2760 | Open in IMG/M |
| 3300005543|Ga0070672_100087011 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300005543|Ga0070672_100175751 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300005543|Ga0070672_100263641 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300005543|Ga0070672_100387919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1196 | Open in IMG/M |
| 3300005564|Ga0070664_100015692 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6199 | Open in IMG/M |
| 3300005578|Ga0068854_100009278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6348 | Open in IMG/M |
| 3300005617|Ga0068859_100819248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
| 3300005618|Ga0068864_102490917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300005718|Ga0068866_10570284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300005719|Ga0068861_101731626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300005836|Ga0074470_10903824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300005843|Ga0068860_100212475 | All Organisms → cellular organisms → Bacteria | 1877 | Open in IMG/M |
| 3300006046|Ga0066652_100998363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
| 3300006755|Ga0079222_11160439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300006755|Ga0079222_12236102 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300006844|Ga0075428_102411099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300006881|Ga0068865_101194468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300006894|Ga0079215_11552082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300006918|Ga0079216_11873316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300006954|Ga0079219_10925970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300007004|Ga0079218_10000097 | All Organisms → cellular organisms → Bacteria | 18530 | Open in IMG/M |
| 3300007004|Ga0079218_10163437 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1645 | Open in IMG/M |
| 3300009092|Ga0105250_10110253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1127 | Open in IMG/M |
| 3300009094|Ga0111539_10546328 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1350 | Open in IMG/M |
| 3300009156|Ga0111538_10755963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1231 | Open in IMG/M |
| 3300009176|Ga0105242_11435563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
| 3300009177|Ga0105248_10149573 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2634 | Open in IMG/M |
| 3300009177|Ga0105248_10496554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1376 | Open in IMG/M |
| 3300009177|Ga0105248_12867190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300009678|Ga0105252_10286112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300011119|Ga0105246_11680365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300012038|Ga0137431_1245364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300012212|Ga0150985_108392826 | All Organisms → cellular organisms → Bacteria | 2437 | Open in IMG/M |
| 3300012892|Ga0157294_10191650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 596 | Open in IMG/M |
| 3300012955|Ga0164298_10899678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300012964|Ga0153916_10162634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2190 | Open in IMG/M |
| 3300014326|Ga0157380_10402737 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1299 | Open in IMG/M |
| 3300015371|Ga0132258_10240114 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4421 | Open in IMG/M |
| 3300015371|Ga0132258_11437890 | All Organisms → cellular organisms → Bacteria | 1742 | Open in IMG/M |
| 3300015374|Ga0132255_102950479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300017792|Ga0163161_11900223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300017965|Ga0190266_10027554 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
| 3300018051|Ga0184620_10221532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300018083|Ga0184628_10000610 | All Organisms → cellular organisms → Bacteria | 18787 | Open in IMG/M |
| 3300018469|Ga0190270_10013995 | All Organisms → cellular organisms → Bacteria | 4696 | Open in IMG/M |
| 3300018469|Ga0190270_10440158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1221 | Open in IMG/M |
| 3300018469|Ga0190270_11704315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 684 | Open in IMG/M |
| 3300018469|Ga0190270_11753543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 675 | Open in IMG/M |
| 3300018469|Ga0190270_12613188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300018476|Ga0190274_10320350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1456 | Open in IMG/M |
| 3300018476|Ga0190274_10398253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1334 | Open in IMG/M |
| 3300018476|Ga0190274_10608166 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
| 3300018476|Ga0190274_12517496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300018481|Ga0190271_10137180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2336 | Open in IMG/M |
| 3300018481|Ga0190271_10205940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1963 | Open in IMG/M |
| 3300018481|Ga0190271_11890798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 707 | Open in IMG/M |
| 3300019361|Ga0173482_10193558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300019377|Ga0190264_11708990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300020027|Ga0193752_1057207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1681 | Open in IMG/M |
| 3300021082|Ga0210380_10113256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
| 3300023070|Ga0247755_1142517 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300025899|Ga0207642_10003147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5176 | Open in IMG/M |
| 3300025900|Ga0207710_10613913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300025901|Ga0207688_10387401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 865 | Open in IMG/M |
| 3300025903|Ga0207680_10260435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1200 | Open in IMG/M |
| 3300025907|Ga0207645_10900844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300025908|Ga0207643_10203905 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300025908|Ga0207643_10592476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300025918|Ga0207662_10009073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5463 | Open in IMG/M |
| 3300025923|Ga0207681_10213984 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1487 | Open in IMG/M |
| 3300025923|Ga0207681_11870520 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300025925|Ga0207650_10261097 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1405 | Open in IMG/M |
| 3300025925|Ga0207650_10894023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300025925|Ga0207650_11757557 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300025926|Ga0207659_10813202 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300025926|Ga0207659_11295774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300025936|Ga0207670_10069186 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
| 3300025940|Ga0207691_10085560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2830 | Open in IMG/M |
| 3300025940|Ga0207691_10170905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1903 | Open in IMG/M |
| 3300025941|Ga0207711_10584091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1042 | Open in IMG/M |
| 3300025972|Ga0207668_11008098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300026075|Ga0207708_11133250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300026088|Ga0207641_10493107 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300026116|Ga0207674_10547104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300026116|Ga0207674_10912073 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300026142|Ga0207698_10922190 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
| 3300027886|Ga0209486_10000089 | All Organisms → cellular organisms → Bacteria | 44232 | Open in IMG/M |
| 3300028379|Ga0268266_10216500 | Not Available | 1759 | Open in IMG/M |
| 3300028379|Ga0268266_11610523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300028380|Ga0268265_10925464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300028381|Ga0268264_10947053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300031170|Ga0307498_10224551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 668 | Open in IMG/M |
| 3300031943|Ga0310885_10360178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300032002|Ga0307416_103322740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300032012|Ga0310902_10958828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300032144|Ga0315910_10224257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1415 | Open in IMG/M |
| 3300032157|Ga0315912_10681118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300032157|Ga0315912_10877769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300032421|Ga0310812_10124474 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300034147|Ga0364925_0155058 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
| 3300034676|Ga0314801_171802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.71% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 10.71% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 7.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.25% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 5.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.89% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.89% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300023070 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_140026022 | 3300000363 | Soil | MSLAVTVASVVLSVTLVAVLLGYLIHRNAERHDSQGGR* |
| JGI10216J12902_1078849582 | 3300000956 | Soil | MPLPVIVVGVVLSVTLVAVLLGYLVHRNAEHNDHEGSRR* |
| F14TB_1025725342 | 3300001431 | Soil | AVTVAVVVLSVTLVAVLLGYLIHRNAERHDSQGGR* |
| Ga0062591_1011349752 | 3300004643 | Soil | MPLPVIVVGIVLSVTLVAVLVGYLVHRNAEHNDREGSRR* |
| Ga0070676_112648262 | 3300005328 | Miscanthus Rhizosphere | MPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR* |
| Ga0070670_1016332521 | 3300005331 | Switchgrass Rhizosphere | RMSLAATVVSIVLGVTLVAGLLGYLVHRNAGRHDSKGVR* |
| Ga0070669_1000582002 | 3300005353 | Switchgrass Rhizosphere | MPLPVIVVGIVLSVTLVVVLFGYLIHRNAEHNDREGSRR* |
| Ga0070688_1004697091 | 3300005365 | Switchgrass Rhizosphere | MPLPVIVVAIVLSVTLVAVLLGYLVHRNAEHNDREGSRR* |
| Ga0070667_1018661792 | 3300005367 | Switchgrass Rhizosphere | MPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGSRR* |
| Ga0070672_1000321643 | 3300005543 | Miscanthus Rhizosphere | MSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGNR* |
| Ga0070672_1000715253 | 3300005543 | Miscanthus Rhizosphere | MPLAVTVSLIVLCVTLVGVFIGYLVHKNADRHDSEGGR* |
| Ga0070672_1000870113 | 3300005543 | Miscanthus Rhizosphere | MSLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR* |
| Ga0070672_1001757512 | 3300005543 | Miscanthus Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR* |
| Ga0070672_1002636412 | 3300005543 | Miscanthus Rhizosphere | MPLAVTVVSIVLCVTLVVVLLGYLVHRNAERHDSKGDRS* |
| Ga0070672_1003879192 | 3300005543 | Miscanthus Rhizosphere | MMPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR* |
| Ga0070664_1000156923 | 3300005564 | Corn Rhizosphere | MPLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR* |
| Ga0068854_1000092783 | 3300005578 | Corn Rhizosphere | MSLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGNR* |
| Ga0068859_1008192482 | 3300005617 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGVR* |
| Ga0068864_1024909171 | 3300005618 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGGR* |
| Ga0068866_105702841 | 3300005718 | Miscanthus Rhizosphere | VTVVLVVLSVTLVAVLLGYLVHRNAERHDSRGGR* |
| Ga0068861_1017316262 | 3300005719 | Switchgrass Rhizosphere | MSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGGR* |
| Ga0074470_109038242 | 3300005836 | Sediment (Intertidal) | MPLAATVVSIVLCVTIVAVLLGYLVHRNAERHDSKGDRS* |
| Ga0068860_1002124753 | 3300005843 | Switchgrass Rhizosphere | MSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKG |
| Ga0066652_1009983631 | 3300006046 | Soil | PLPVTVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR* |
| Ga0079222_111604392 | 3300006755 | Agricultural Soil | MSLAATVVSIVLSVTLVAVLLGYLVHRNADRHDSKGSR* |
| Ga0079222_122361022 | 3300006755 | Agricultural Soil | MTLAATVASVVLSVTLVAVLLGYLIHRNAERHDSQGGR* |
| Ga0075428_1024110992 | 3300006844 | Populus Rhizosphere | MSLAATVASVVLIVTLVAVFLGYLVHRNAERHDSKGGR* |
| Ga0068865_1011944682 | 3300006881 | Miscanthus Rhizosphere | MPLPVTVTLVVLALTLVGVLLGYLIHRNAERHDAEGGR* |
| Ga0079215_115520822 | 3300006894 | Agricultural Soil | MQLAFTVALVVLCVTLVAVALGFFVQRNAERHDSQGGR* |
| Ga0079216_118733162 | 3300006918 | Agricultural Soil | MSLAATVASVVLIVTLVAVLLGYLVHRNAERLDSQGGR* |
| Ga0079219_109259701 | 3300006954 | Agricultural Soil | MALAVTVVSIVLCVTLVAVLLGYLVHRNAERHDAKGGR* |
| Ga0079218_100000972 | 3300007004 | Agricultural Soil | MQLAFTVALVVLCVTLVAVALGFFVQRNAERHDSEGGR* |
| Ga0079218_101634373 | 3300007004 | Agricultural Soil | MPLPVIVVGVVLSVTLVAVLLGYLVHRNAEHNDREGSRR* |
| Ga0105250_101102532 | 3300009092 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGIR* |
| Ga0111539_105463282 | 3300009094 | Populus Rhizosphere | MPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR* |
| Ga0111538_107559632 | 3300009156 | Populus Rhizosphere | MMPLPVIVVGIVLSVTLVAVLVGYLVHRNAEHNDREGSRR* |
| Ga0105242_114355632 | 3300009176 | Miscanthus Rhizosphere | MSLAVTVVLVVLSVTLVAVLLGYLVHRNAERHDSKGGR* |
| Ga0105248_101495734 | 3300009177 | Switchgrass Rhizosphere | MMPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGSRR* |
| Ga0105248_104965542 | 3300009177 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGNR* |
| Ga0105248_128671902 | 3300009177 | Switchgrass Rhizosphere | MSLAVTVVSIVLCVTLVVVLLGYLVHRNAERHDSKGDRS* |
| Ga0105252_102861122 | 3300009678 | Soil | MQLAFTVALVVLCVTLVAVSLGFLVQRNAERHDSEGGR* |
| Ga0105246_116803652 | 3300011119 | Miscanthus Rhizosphere | RSRMSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGGR* |
| Ga0137431_12453641 | 3300012038 | Soil | MQLAFSVVLVVLSVTIVAVVLGYLVQRNAERHDSEGGR* |
| Ga0150985_1083928263 | 3300012212 | Avena Fatua Rhizosphere | MSLAVTVVSIVASVTLVAVFLGYLVHRNADRHDSKGGR* |
| Ga0157294_101916502 | 3300012892 | Soil | MMPLPVIVVGIVLSVTLVVVLFGYLIHRNAEHNDREGSRR* |
| Ga0164298_108996782 | 3300012955 | Soil | MSLAATVVSIVLIVTLVAVLLGYLVHRNAERHDSKGIR* |
| Ga0153916_101626342 | 3300012964 | Freshwater Wetlands | MQLAATVVGVVLLVTVVTAVLGILIQKNAERHDREGGRR* |
| Ga0157380_104027372 | 3300014326 | Switchgrass Rhizosphere | MMPLPVIVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR* |
| Ga0132258_102401144 | 3300015371 | Arabidopsis Rhizosphere | MPLPVTVVSIVLAVTLVAVFVGYLVHKNAERHDREGGR* |
| Ga0132258_114378902 | 3300015371 | Arabidopsis Rhizosphere | MSLAATVVTIVLGVTLVAVLLGYLVHRNAERHDSKGTR* |
| Ga0132255_1029504792 | 3300015374 | Arabidopsis Rhizosphere | MSLATTVVSIVLSVTLVAVLLGYLVHRNAERHDSKGNR* |
| Ga0163161_119002231 | 3300017792 | Switchgrass Rhizosphere | MPLAVTVVLVVLSVTIAAVLIGYLIHKNAERHDREGGR |
| Ga0190266_100275542 | 3300017965 | Soil | MQLAFTVALVVLCVTLVAVALGYLVQRNAERHDSEGGR |
| Ga0184620_102215322 | 3300018051 | Groundwater Sediment | MSLAVTVVSIVLCVTLVVVLLGYFVHRNAERHDSKGGR |
| Ga0184628_100006102 | 3300018083 | Groundwater Sediment | MPLPVTVSLVVLCVTLVGVFIGYLVHKNADRHDSEGGR |
| Ga0190270_100139954 | 3300018469 | Soil | MPLPVMVTVVVLVFTLVGVLVGYLIHRNAERHDAEGGR |
| Ga0190270_104401581 | 3300018469 | Soil | MQLAFSVVLVVLSVTLVAVVLGYLVQRNAERHDSQGGR |
| Ga0190270_117043152 | 3300018469 | Soil | MPLPVTVTLVVLLFTLVGVLVGYLIHRNADRHDGEGGR |
| Ga0190270_117535432 | 3300018469 | Soil | MSLAVIVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR |
| Ga0190270_126131882 | 3300018469 | Soil | MPLPVMVGSVVLLFTLVAVLIGYLVHKNADRHDAEGGR |
| Ga0190274_103203502 | 3300018476 | Soil | MPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR |
| Ga0190274_103982533 | 3300018476 | Soil | MPLPVTVTLVVLSFTLVGVLVGYLIHRNADRHDGERGR |
| Ga0190274_106081662 | 3300018476 | Soil | MPLPVMVGSVVLLFTLVGVLIGYLVHKNADRHDAEGGR |
| Ga0190274_125174962 | 3300018476 | Soil | MPLPVIVVGIVLSVTLVAVLLGYLVHKNAEHNDREGGRR |
| Ga0190271_101371802 | 3300018481 | Soil | MPLPVMVTVVVLVFTLVGVLVGYLIHRNADRHDAEGGR |
| Ga0190271_102059403 | 3300018481 | Soil | MPLPVIVVGVVLSVTLVAVLLGYLVHKNAEHNDREGGRR |
| Ga0190271_118907982 | 3300018481 | Soil | MPLPVTVTLVVLIITLVGVLLGYLIHRNADRHDGEGGR |
| Ga0173482_101935582 | 3300019361 | Soil | MPLPVIVVGIVLSVTLVAVLVGYLVHRNAEHNDREGSRR |
| Ga0190264_117089902 | 3300019377 | Soil | MPLPVIVVGVVLSVTLVVVLLGYLIHKNAEHNDREGSRR |
| Ga0193752_10572073 | 3300020027 | Soil | MPLPVSVVSVVLCVTLVVLVVGYLVQKNAERHDRERGPR |
| Ga0210380_101132562 | 3300021082 | Groundwater Sediment | MPLPVTVTLVVLALTLVGVLLGYLIHRNAERHDAEGGR |
| Ga0247755_11425171 | 3300023070 | Plant Litter | LGVAPDEVQMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR |
| Ga0207642_100031473 | 3300025899 | Miscanthus Rhizosphere | MSLAATVVSIVLSVTLVAVLLGYLVHRNAERHDSKGNR |
| Ga0207710_106139132 | 3300025900 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGVR |
| Ga0207688_103874012 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR |
| Ga0207680_102604352 | 3300025903 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR |
| Ga0207645_109008442 | 3300025907 | Miscanthus Rhizosphere | MMPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR |
| Ga0207643_102039051 | 3300025908 | Miscanthus Rhizosphere | MPLAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR |
| Ga0207643_105924762 | 3300025908 | Miscanthus Rhizosphere | MSLDATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR |
| Ga0207662_100090733 | 3300025918 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGNR |
| Ga0207681_102139843 | 3300025923 | Switchgrass Rhizosphere | MPLPVIVVGIVLSVTLVVVLFGYLIHRNAEHNDREGSRR |
| Ga0207681_118705201 | 3300025923 | Switchgrass Rhizosphere | GVAPDEVQMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR |
| Ga0207650_102610973 | 3300025925 | Switchgrass Rhizosphere | MSLAATVVSIVLCVTLVAVLLGYLVQRNAERHDSKGSR |
| Ga0207650_108940231 | 3300025925 | Switchgrass Rhizosphere | MPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGS |
| Ga0207650_117575571 | 3300025925 | Switchgrass Rhizosphere | LRTRVRMSLAATVVSIVLGVTLVAGLLGYLVHRNAGRHDSKGVR |
| Ga0207659_108132022 | 3300025926 | Miscanthus Rhizosphere | RSMMPLPVIVVGIVLSVTLVAVLLGYLVHRNAEHNDREGSRR |
| Ga0207659_112957742 | 3300025926 | Miscanthus Rhizosphere | MPLPVTVVGIVLGVTLVAVLLGYLVHRNAEHNDSEGSRR |
| Ga0207670_100691863 | 3300025936 | Switchgrass Rhizosphere | MSLAVTVVSIVLGVTFLAVLLGYLVHRNAERHDAKGG |
| Ga0207691_100855602 | 3300025940 | Miscanthus Rhizosphere | MPLAVTVSLIVLCVTLVGVFIGYLVHKNADRHDSEGGR |
| Ga0207691_101709052 | 3300025940 | Miscanthus Rhizosphere | MPLPVIVVGIVLSVTLVAVLVGYLIHRNAEHNDREGSRR |
| Ga0207711_105840912 | 3300025941 | Switchgrass Rhizosphere | MPLPVIVVGIVLSVTLVAVLVGYLVHKNAEHNDREGSRR |
| Ga0207668_110080981 | 3300025972 | Switchgrass Rhizosphere | PLPVTVTLVVLALTLVGVLLGYLIHRNAERHDAEGGR |
| Ga0207708_111332501 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLPVTVTLIVLIVTLVGVVVGYLVHRNADRHDAEGGR |
| Ga0207641_104931073 | 3300026088 | Switchgrass Rhizosphere | AATVVSIVLGVTLVAVLLGYLVHRNAERHDSKGTR |
| Ga0207674_105471041 | 3300026116 | Corn Rhizosphere | MSLAVTVVLVVLSVTLVAVFLGYLVHRNAERHDSQ |
| Ga0207674_109120731 | 3300026116 | Corn Rhizosphere | MSLAATVVSIVLSVTLVAVFLGYLVHRNAERHDSKGNR |
| Ga0207698_109221903 | 3300026142 | Corn Rhizosphere | TLSKEPRVRMSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSKGVR |
| Ga0209486_100000897 | 3300027886 | Agricultural Soil | MQLAFTVALVVLCVTLVAVALGFFVQRNAERHDSEGGR |
| Ga0268266_102165003 | 3300028379 | Switchgrass Rhizosphere | MPLPVTVVGIVLGVTLVAVLLGYLVHRNAEHNDREGSRR |
| Ga0268266_116105232 | 3300028379 | Switchgrass Rhizosphere | LAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGNR |
| Ga0268265_109254642 | 3300028380 | Switchgrass Rhizosphere | MALAVTVVSIVLCVTLVAVLLGYLVHRNAERHDSKGGR |
| Ga0268264_109470532 | 3300028381 | Switchgrass Rhizosphere | MSLAATVVSIVLGVTLVAVLLGYLVHRNADRHDSK |
| Ga0307498_102245512 | 3300031170 | Soil | MSLAVTVVLVVLSVTLVAVLLGYLVHRNAERHDSKGGR |
| Ga0310885_103601781 | 3300031943 | Soil | LLGVAPDEVQMPLPVTVTLVVLIVTLVGVLLGYLVHRNADRHDAEGGR |
| Ga0307416_1033227401 | 3300032002 | Rhizosphere | RVMMPLAVTVVGVVLSVTLVAVLLGYLVHRNAEHNDREGSRR |
| Ga0310902_109588281 | 3300032012 | Soil | AATVASVVLSVTLVAVLLGYLIHRNAERHDSQGGR |
| Ga0315910_102242573 | 3300032144 | Soil | MSLAATVTFVVLCVTLVAVLLGYLVQKNAERHDSQGGR |
| Ga0315912_106811182 | 3300032157 | Soil | MQLAVTVVSVVLSVTLVSVLLGYLVHRNAERHDREGGR |
| Ga0315912_108777692 | 3300032157 | Soil | MPLPVIVVGVVLSVTLVVVLLGYLVHRNAEHNDRDGGRR |
| Ga0310812_101244742 | 3300032421 | Soil | MSLAATVVSIVLGVTLVAGLLGYLVHRNADRHDSKGVR |
| Ga0364925_0155058_674_790 | 3300034147 | Sediment | MSLAATVASVVLVVTLVAVFLGYLVHRNAERHDSQGGR |
| Ga0314801_171802_154_270 | 3300034676 | Soil | MSLAVTVVSIVLCVTLVAVLLGYLVHRNADRHDSKGGR |
| ⦗Top⦘ |