Basic Information | |
---|---|
Family ID | F084779 |
Family Type | Metagenome |
Number of Sequences | 112 |
Average Sequence Length | 47 residues |
Representative Sequence | FGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 112 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 95.54 % |
% of genes from short scaffolds (< 2000 bps) | 87.50 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (83.929 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (7.143 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.393 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.107 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.17% β-sheet: 0.00% Coil/Unstructured: 45.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 112 Family Scaffolds |
---|---|---|
PF01717 | Meth_synt_2 | 5.36 |
PF00571 | CBS | 3.57 |
PF00230 | MIP | 3.57 |
PF10503 | Esterase_PHB | 3.57 |
PF13231 | PMT_2 | 3.57 |
PF08448 | PAS_4 | 2.68 |
PF02776 | TPP_enzyme_N | 2.68 |
PF05649 | Peptidase_M13_N | 2.68 |
PF00254 | FKBP_C | 2.68 |
PF13472 | Lipase_GDSL_2 | 1.79 |
PF07676 | PD40 | 1.79 |
PF03544 | TonB_C | 1.79 |
PF08281 | Sigma70_r4_2 | 1.79 |
PF12833 | HTH_18 | 0.89 |
PF00165 | HTH_AraC | 0.89 |
PF07311 | Dodecin | 0.89 |
PF01274 | Malate_synthase | 0.89 |
PF14026 | DUF4242 | 0.89 |
PF07883 | Cupin_2 | 0.89 |
PF05544 | Pro_racemase | 0.89 |
PF13520 | AA_permease_2 | 0.89 |
PF12849 | PBP_like_2 | 0.89 |
PF04909 | Amidohydro_2 | 0.89 |
PF00158 | Sigma54_activat | 0.89 |
PF00580 | UvrD-helicase | 0.89 |
PF00890 | FAD_binding_2 | 0.89 |
PF12796 | Ank_2 | 0.89 |
PF13602 | ADH_zinc_N_2 | 0.89 |
PF05016 | ParE_toxin | 0.89 |
COG ID | Name | Functional Category | % Frequency in 112 Family Scaffolds |
---|---|---|---|
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 5.36 |
COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 3.57 |
COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 2.68 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 1.79 |
COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.89 |
COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.89 |
COG2225 | Malate synthase | Energy production and conversion [C] | 0.89 |
COG3360 | Flavin-binding protein dodecin | General function prediction only [R] | 0.89 |
COG3938 | Proline racemase/hydroxyproline epimerase | Amino acid transport and metabolism [E] | 0.89 |
COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.89 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 83.93 % |
Unclassified | root | N/A | 16.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000891|JGI10214J12806_12337790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300000955|JGI1027J12803_107641822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1454 | Open in IMG/M |
3300000955|JGI1027J12803_107852645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1200 | Open in IMG/M |
3300000956|JGI10216J12902_115561995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
3300004114|Ga0062593_103175367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
3300004157|Ga0062590_100558802 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300004157|Ga0062590_102164845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 581 | Open in IMG/M |
3300004463|Ga0063356_100141875 | All Organisms → cellular organisms → Bacteria | 2717 | Open in IMG/M |
3300004463|Ga0063356_100372623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1819 | Open in IMG/M |
3300004463|Ga0063356_102935111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
3300004643|Ga0062591_100204689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1454 | Open in IMG/M |
3300004808|Ga0062381_10004839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3095 | Open in IMG/M |
3300005290|Ga0065712_10539850 | Not Available | 624 | Open in IMG/M |
3300005293|Ga0065715_10830980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
3300005295|Ga0065707_11045284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300005331|Ga0070670_100011873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7449 | Open in IMG/M |
3300005332|Ga0066388_106118067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300005332|Ga0066388_107749414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300005338|Ga0068868_101082539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
3300005341|Ga0070691_10358319 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300005341|Ga0070691_11008062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300005353|Ga0070669_100670124 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300005444|Ga0070694_101362054 | Not Available | 598 | Open in IMG/M |
3300005526|Ga0073909_10288222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
3300005535|Ga0070684_100907114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 826 | Open in IMG/M |
3300005578|Ga0068854_101308790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300005618|Ga0068864_100317999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
3300005844|Ga0068862_100056474 | All Organisms → cellular organisms → Bacteria | 3364 | Open in IMG/M |
3300006163|Ga0070715_10445278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300006358|Ga0068871_100095667 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
3300006844|Ga0075428_100006531 | All Organisms → cellular organisms → Bacteria | 12966 | Open in IMG/M |
3300006845|Ga0075421_100028833 | All Organisms → cellular organisms → Bacteria | 7011 | Open in IMG/M |
3300006846|Ga0075430_100040116 | All Organisms → cellular organisms → Bacteria | 3963 | Open in IMG/M |
3300006846|Ga0075430_100586907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 919 | Open in IMG/M |
3300006847|Ga0075431_100544385 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300006894|Ga0079215_10223828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 974 | Open in IMG/M |
3300006969|Ga0075419_10166316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1448 | Open in IMG/M |
3300009012|Ga0066710_104863560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300009148|Ga0105243_11685354 | Not Available | 663 | Open in IMG/M |
3300009166|Ga0105100_10552257 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
3300009176|Ga0105242_11028395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 833 | Open in IMG/M |
3300009177|Ga0105248_10634322 | Not Available | 1205 | Open in IMG/M |
3300009177|Ga0105248_12340523 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 608 | Open in IMG/M |
3300010041|Ga0126312_10974655 | Not Available | 620 | Open in IMG/M |
3300010046|Ga0126384_12401766 | Not Available | 510 | Open in IMG/M |
3300010358|Ga0126370_11159080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
3300010359|Ga0126376_13192868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 507 | Open in IMG/M |
3300010361|Ga0126378_11080948 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300010362|Ga0126377_12947929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300010375|Ga0105239_11028051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
3300010398|Ga0126383_11173495 | Not Available | 858 | Open in IMG/M |
3300010398|Ga0126383_11981382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
3300010400|Ga0134122_10839565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300010403|Ga0134123_10509177 | Not Available | 1135 | Open in IMG/M |
3300011119|Ga0105246_11530253 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
3300011439|Ga0137432_1272888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
3300011441|Ga0137452_1082826 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300012358|Ga0137368_10479869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
3300012469|Ga0150984_115701370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300012469|Ga0150984_119127568 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
3300012893|Ga0157284_10025913 | All Organisms → cellular organisms → Bacteria | 1183 | Open in IMG/M |
3300012908|Ga0157286_10172295 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
3300012917|Ga0137395_11022139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300012961|Ga0164302_10010937 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3568 | Open in IMG/M |
3300013307|Ga0157372_10711893 | Not Available | 1168 | Open in IMG/M |
3300013308|Ga0157375_11692805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 749 | Open in IMG/M |
3300014265|Ga0075314_1174999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300014325|Ga0163163_11095852 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300014326|Ga0157380_12418757 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300014745|Ga0157377_10260483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1128 | Open in IMG/M |
3300014875|Ga0180083_1115254 | Not Available | 592 | Open in IMG/M |
3300015372|Ga0132256_102952307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300015373|Ga0132257_100816765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1165 | Open in IMG/M |
3300016357|Ga0182032_12025076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
3300017936|Ga0187821_10156998 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300018027|Ga0184605_10234652 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
3300018081|Ga0184625_10476505 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300018476|Ga0190274_10514505 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300018476|Ga0190274_12845487 | Not Available | 580 | Open in IMG/M |
3300023070|Ga0247755_1139807 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300025324|Ga0209640_10062550 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
3300025885|Ga0207653_10220999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 719 | Open in IMG/M |
3300025905|Ga0207685_10168584 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1006 | Open in IMG/M |
3300025918|Ga0207662_10528395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
3300025926|Ga0207659_10240139 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
3300025926|Ga0207659_10667985 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 889 | Open in IMG/M |
3300025931|Ga0207644_10444201 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300025932|Ga0207690_10410334 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
3300025941|Ga0207711_11426928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
3300025981|Ga0207640_10207200 | Not Available | 1491 | Open in IMG/M |
3300025981|Ga0207640_10880154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 781 | Open in IMG/M |
3300025986|Ga0207658_10227121 | All Organisms → cellular organisms → Bacteria | 1574 | Open in IMG/M |
3300026095|Ga0207676_12019733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300027787|Ga0209074_10283492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300027831|Ga0209797_10003910 | All Organisms → cellular organisms → Bacteria | 7336 | Open in IMG/M |
3300031562|Ga0310886_10027679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 2355 | Open in IMG/M |
3300031720|Ga0307469_12484259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
3300031740|Ga0307468_101488608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
3300031847|Ga0310907_10006866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Labilitrichaceae → Labilithrix → Labilithrix luteola | 3337 | Open in IMG/M |
3300031847|Ga0310907_10036085 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
3300031911|Ga0307412_10854969 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
3300031911|Ga0307412_11438446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
3300031943|Ga0310885_10613604 | Not Available | 604 | Open in IMG/M |
3300031944|Ga0310884_10317082 | Not Available | 874 | Open in IMG/M |
3300031965|Ga0326597_10012256 | All Organisms → cellular organisms → Bacteria | 11306 | Open in IMG/M |
3300032002|Ga0307416_102293195 | Not Available | 640 | Open in IMG/M |
3300032005|Ga0307411_11113924 | Not Available | 712 | Open in IMG/M |
3300032144|Ga0315910_10201322 | Not Available | 1495 | Open in IMG/M |
3300032157|Ga0315912_10178794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1664 | Open in IMG/M |
3300032180|Ga0307471_101624699 | Not Available | 802 | Open in IMG/M |
3300034090|Ga0326723_0314451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 704 | Open in IMG/M |
3300034354|Ga0364943_0352542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 563 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.25% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.36% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.57% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.57% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.57% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.68% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.68% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.68% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.79% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.79% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.79% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.79% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.79% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.89% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.89% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.89% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.89% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.89% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.89% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.89% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.89% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.89% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.89% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.89% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.89% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.89% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014875 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10D | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300023070 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L096-311B-4 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_123377902 | 3300000891 | Soil | FGGAHWSDFGRARLGVVISLEQEYQTANSDLLSRRLLAQTHIEF* |
JGI1027J12803_1076418223 | 3300000955 | Soil | IFGGAHWNQWGRGRLGLVVTMEQLYRTSNSQLLERRLLAQTQIEF* |
JGI1027J12803_1078526454 | 3300000955 | Soil | SQWGRGRLGVVVTLEQVLRAVNSELLERRLLAQTQIEF* |
JGI10216J12902_1155619952 | 3300000956 | Soil | YILGGAHWSQFGRGRVGLVVTWEQLFRVVNSDRLEHRLLAQTHVEF* |
Ga0062593_1031753671 | 3300004114 | Soil | RRRYSFGGAHWSQWGRGRLGVVVTLEQTFRSTNSELLDRRLLAQTQVEF* |
Ga0062590_1005588021 | 3300004157 | Soil | DSQRRYVFGGAHWSQVGRGRLGVVVTLEQSFQTSNSQLLGRRLLGQTPIKF* |
Ga0062590_1021648452 | 3300004157 | Soil | RRYMFGGAHWSQWGRGRLGVVASLEQEFRSVNSELLDRRLLLQTHVEF* |
Ga0063356_1001418751 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RWSEVGRGRLGVVITMQQEYRSAGSQLLERRLLAQTHIEF* |
Ga0063356_1003726231 | 3300004463 | Arabidopsis Thaliana Rhizosphere | IFGGAHWSQVGRGRLGVVVSLEQTTRNAQLLGRRLLAQTHIEF* |
Ga0063356_1029351112 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RRLIFGGAHWSQVGRGRLGVVVSLEQTTRDSQLLGRRLLAQTHVEF* |
Ga0062591_1002046893 | 3300004643 | Soil | PDGSNDSDSQRRLLIGGAHWSQISRARLGVVVSLEQTHQTANSQLLSRRLLAQTHIEF* |
Ga0062381_100048392 | 3300004808 | Wetland Sediment | MGGAHWSQWGRGRVGVVVTLEQLYRVVNSDRLERRLLAQTHVEF* |
Ga0065712_105398501 | 3300005290 | Miscanthus Rhizosphere | RRYMFGGAHWSQWGRGKLGVVISLEQLYRTANSQLEERRLLAQTHIEF* |
Ga0065715_108309802 | 3300005293 | Miscanthus Rhizosphere | AHWSQWGRGRLGVVVTLEQTFRSTNSELLDRRLLAQTQVEF* |
Ga0065707_110452842 | 3300005295 | Switchgrass Rhizosphere | WSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTLIEF* |
Ga0070670_1000118731 | 3300005331 | Switchgrass Rhizosphere | DGSNGTDSQRRYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF* |
Ga0066388_1061180672 | 3300005332 | Tropical Forest Soil | GAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF* |
Ga0066388_1077494142 | 3300005332 | Tropical Forest Soil | DSQRRLMFGGARWSQVGRGRLGVVISLEQTFRMSDSALLDRRLLAQTHVEF* |
Ga0068868_1010825391 | 3300005338 | Miscanthus Rhizosphere | NGTDSQRRYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTLIEF* |
Ga0070691_103583192 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LIVGGAHWSRISRARLGVVVSLEQTHQTSNSQLLDRRLLAQTHIEF* |
Ga0070691_110080621 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | GTDSQRGYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF* |
Ga0070669_1006701243 | 3300005353 | Switchgrass Rhizosphere | SQRRYLFGGAHWSQVGRGRLGVVVTLEQSFQPSNDQLLGRRLLVQTQIQF* |
Ga0070694_1013620542 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | YIFGGAHWTQWARGRLGVVVTLEQTFRTVNRQLLQRRVLAQTHVEF* |
Ga0073909_102882221 | 3300005526 | Surface Soil | SKLSTGRLGVVISLEQTFQGEVSQLTGRRLLVQTDIEF* |
Ga0070684_1009071142 | 3300005535 | Corn Rhizosphere | FGGAHWSQWGRGRLGVVASLEQEFRSVNSELLDRRLLLQTHVEF* |
Ga0068854_1013087902 | 3300005578 | Corn Rhizosphere | GRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF* |
Ga0068864_1003179992 | 3300005618 | Switchgrass Rhizosphere | QRRRTVFGGAHWSDFGRARLGVVISLEQEYQTANSDLLSRRLLAQTHIEF* |
Ga0068862_1000564741 | 3300005844 | Switchgrass Rhizosphere | GSNDSDSQRRLLIGGAHWSQISRARLGVVVSLEQTHQTANSQLLSRRLLAQTHIEF* |
Ga0070715_104452781 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GVTGWAGVGGVDFIQPDTSNEGQAQHRYIFGGAHWRQVGRGRLGIVVTMEQVFQAATSQLTSRRLLAQTHVEF* |
Ga0068871_1000956671 | 3300006358 | Miscanthus Rhizosphere | QRGYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF* |
Ga0075428_10000653111 | 3300006844 | Populus Rhizosphere | SQVGRGRLGVVVSLEQTTRNAQLLGRRLLAQTHIEF* |
Ga0075421_1000288336 | 3300006845 | Populus Rhizosphere | VGRGRLGVVVSLEQTTRNAQLLGRRLLAQTHIEF* |
Ga0075430_1000401164 | 3300006846 | Populus Rhizosphere | RRITFGGAHWSELGRGRLGVVISLQQEYRSAGSQLLERRLLAQTHIEF* |
Ga0075430_1005869071 | 3300006846 | Populus Rhizosphere | ANDSDSRRRYIFGGAHWSQVGRGRLGVVVTLEQIFRTVNSQLLERRLLAQTHVEF* |
Ga0075431_1005443851 | 3300006847 | Populus Rhizosphere | AHWSQVGRGRLGVVVTLEQEYQTANSQLLARRLLAQTHIEF* |
Ga0079215_102238281 | 3300006894 | Agricultural Soil | RLLFGGAHWNEFGRSKIGVVISLDQEYQTSNSQLLSRRLLAQTHIEF* |
Ga0075419_101663162 | 3300006969 | Populus Rhizosphere | DGDTRRRMVFGGAHWSEVGRGRLGVVISLDQEYQTSNSQLLSRRLLAQTHVEF* |
Ga0066710_1048635601 | 3300009012 | Grasslands Soil | DVSNEGAAQHRYVFGGAHWRQVGRGRLGIVVTMEQVFQASTSQLTSRRLLAQTHVEF |
Ga0105243_116853541 | 3300009148 | Miscanthus Rhizosphere | MVFGGAHWSDFGRGKLGVVISLDQEYQTANSQLLSRRLLAQTHVEF* |
Ga0105100_105522572 | 3300009166 | Freshwater Sediment | YVFGGAHWSQVGRGRLGVVVTLEQIYQTVNSQLLDRRLLAQTHVEF* |
Ga0105242_110283952 | 3300009176 | Miscanthus Rhizosphere | FGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF* |
Ga0105248_106343221 | 3300009177 | Switchgrass Rhizosphere | NGTDSQRGYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF* |
Ga0105248_123405232 | 3300009177 | Switchgrass Rhizosphere | MFGGAHWSQWGRGRLGVVVSLEQEFRTTNSELLDRRLLAQTHVEF* |
Ga0126312_109746552 | 3300010041 | Serpentine Soil | DFGRAKLGVVISLDQEYQTANSQLLSRRLLAQTHIEF* |
Ga0126384_124017662 | 3300010046 | Tropical Forest Soil | GGAHWSQWGRGKLGVVISLEQLYRTVNSQLEERRLLAQTHIEF* |
Ga0126370_111590801 | 3300010358 | Tropical Forest Soil | IFGGAHWRQIGTGRLGIVVTMEQVFQAATSQLTERRLLAQTHVEF* |
Ga0126376_131928682 | 3300010359 | Tropical Forest Soil | GGVDFIEPDISNDGLAQHRYIFGGANWRQIGTGRLGIVVTMEQVFQAATSQLTERRLLAQTHVEF* |
Ga0126378_110809481 | 3300010361 | Tropical Forest Soil | NDGLAQHRYIFGGAHWRQIGTGRLGIVVTMEQVFQAATSQLTERRLLAQTHVEF* |
Ga0126377_129479291 | 3300010362 | Tropical Forest Soil | IFGGAHWRQIGSGRLGIVVTMEQVYQASNSLLVSRRLLGQTHVEF* |
Ga0105239_110280511 | 3300010375 | Corn Rhizosphere | SQRRYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTLIEF* |
Ga0126383_111734952 | 3300010398 | Tropical Forest Soil | GGAHWRQIGTGRLGIVVTMEQVFQAATSQLTERRLLAQTHVEF* |
Ga0126383_119813821 | 3300010398 | Tropical Forest Soil | PDTSNDGLAQHRYVFGGAHWRQIGRGRLGIVVTMEQIFQASTSLLTERRLNVQTHVEF* |
Ga0134122_108395653 | 3300010400 | Terrestrial Soil | HWSQWGRGRLGLVVTLEQTFRSTNSELLDRRLLAQTQVEF* |
Ga0134123_105091772 | 3300010403 | Terrestrial Soil | AHWSQVGRGRLGVVISLDQSYRVINSQLTERRLLAQTHIEF* |
Ga0105246_115302532 | 3300011119 | Miscanthus Rhizosphere | RRYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTLIEF* |
Ga0137432_12728881 | 3300011439 | Soil | NAGDQRRRYIVGGAHWSQVGRGRLGVVITLEQEYQTANSQLLSRRLLAQTHIEF* |
Ga0137452_10828263 | 3300011441 | Soil | IFGGAHWSEVGRGRLGVVVSLQQESANSQLFSRRLLAQTHIEF* |
Ga0137368_104798691 | 3300012358 | Vadose Zone Soil | FGGAHWSQVGRGRLGVVVTLEQMFRTVNSQLLERRLLAQTHVEF* |
Ga0150984_1157013701 | 3300012469 | Avena Fatua Rhizosphere | HWSQWGRGRLGVVVTLEQLFRTVNSERLESRLLAQTHVEF* |
Ga0150984_1191275681 | 3300012469 | Avena Fatua Rhizosphere | SNGSDTRRRYIFGGAHWSQWGRGRLGVVVTMEQVFQTSNSQLLERRLLAQTHVEF* |
Ga0157284_100259131 | 3300012893 | Soil | GAHWSQVGRGRLGVVVTLEQSFQTSNSQLLGRRLLGQTQIKF* |
Ga0157286_101722951 | 3300012908 | Soil | RTVFGGAHWSDFGRARLGVVISLEQEYQTANSDLLSRRLLAQTHIEF* |
Ga0137395_110221393 | 3300012917 | Vadose Zone Soil | FGGAHWRQVGRGRLGIVVTMEQVFQAVNSELVERRLRVQTHVEF* |
Ga0164302_100109375 | 3300012961 | Soil | SERRYVFGGAHWSQWGRGKLGVVVSLEQLYRTANSQLEERRLLAQTHIEF* |
Ga0157372_107118931 | 3300013307 | Corn Rhizosphere | TDSQRRYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTLIEF* |
Ga0157375_116928052 | 3300013308 | Miscanthus Rhizosphere | YMFGGAHWSQWGRGRLGVVVSLEQEFRTTNSELLDRRLLAQTHVEF* |
Ga0075314_11749991 | 3300014265 | Natural And Restored Wetlands | RLIFAGAHWSQVGRGRLGVVITLEQVSQTANSQLLERRLLAQTHVEF* |
Ga0163163_110958521 | 3300014325 | Switchgrass Rhizosphere | QRRLIVGGAHWSRISRARLGVVVSLEQTHQTSNSQLLDRRLLAQTHIEF* |
Ga0157380_124187572 | 3300014326 | Switchgrass Rhizosphere | RARLGVVVSLEQTHQTANSQLLSRRLLAQTHIEF* |
Ga0157377_102604832 | 3300014745 | Miscanthus Rhizosphere | WSDFGRARLGVVISLEQEYQTANSDLLSRRLLAQTHIEF* |
Ga0180083_11152541 | 3300014875 | Soil | WSEVGRGRLGVVVSLQQESANSQLFSRRLLAQTHIEF* |
Ga0132256_1029523071 | 3300015372 | Arabidopsis Rhizosphere | RYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHVEF* |
Ga0132257_1008167651 | 3300015373 | Arabidopsis Rhizosphere | RYIFGGAHWSQWGRGRLGVVVTMEQVFQTSNGQLLERRVLAQTHVEF* |
Ga0182032_120250762 | 3300016357 | Soil | FGGANWRQVGRGRLGIVVTLESIFQTSTAQLVSRRLLAQTHVEF |
Ga0187821_101569981 | 3300017936 | Freshwater Sediment | VDLITPDTSDESLKQRRYVFGGAHWRQVGRGRLGIVVTLESIFSSIDSQLLARRLLAQTHVEF |
Ga0184605_102346521 | 3300018027 | Groundwater Sediment | DSDSRRRYIFGGAHWSQVGRGRLGVVVTLEQLFRAINSQLLERRLLAQTHVEF |
Ga0184625_104765051 | 3300018081 | Groundwater Sediment | SDSQRRLIVGGAHWSRISRARLGVVVSLEQTHQTSNSQLLDRRLLAQTHIEF |
Ga0190274_105145052 | 3300018476 | Soil | VGGAHWSRISRARLGVVVSLEQTHQTSNSQLLGRRLLAQTHIEF |
Ga0190274_128454871 | 3300018476 | Soil | SRISRARLGVVVSLEQTHQTSNSQLLDRRLLAQTHIEF |
Ga0247755_11398071 | 3300023070 | Plant Litter | SQRRYVFGGAHWSQVGRGRLGVVVTLEQSFQTSNSQLLGRRLLGQTQIKF |
Ga0209640_100625501 | 3300025324 | Soil | DSRSRYIFGGAHWSQVGRGRLGVVVTLEQEFQAVNSQLLERRLLAQTHIEF |
Ga0207653_102209991 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | DSQRGYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF |
Ga0207685_101685843 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | GVTGWAGVGGVDFIQPDTSNEGQAQHRYIFGGAHWRQVGRGRLGIVVTMEQVFQAATSQLTSRRLLAQTHVEF |
Ga0207662_105283951 | 3300025918 | Switchgrass Rhizosphere | YMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF |
Ga0207659_102401393 | 3300025926 | Miscanthus Rhizosphere | QRRRLVFGGAHWSDVGRGKLGVVISLDQEYQTANSHLLSRRLLAQTHVEF |
Ga0207659_106679851 | 3300025926 | Miscanthus Rhizosphere | TVFGGAHWSDFGRARLGVVISLEQEYQTANSDLLSRRLLAQTHIEF |
Ga0207644_104442012 | 3300025931 | Switchgrass Rhizosphere | AHWSRISRARLGVVVSLEQTHQTSNSQLLDRRLLAQTHIEF |
Ga0207690_104103344 | 3300025932 | Corn Rhizosphere | GSNDSDSQRRLLIGGAHWSQISRARLGVVVSLEQTHQTANSQLLSRRLLAQTHIEF |
Ga0207711_114269282 | 3300025941 | Switchgrass Rhizosphere | SNGTDSQRGYMFGGAHWSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF |
Ga0207640_102072001 | 3300025981 | Corn Rhizosphere | WGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF |
Ga0207640_108801541 | 3300025981 | Corn Rhizosphere | AHWSDFGRARLGVVISLEQEYQTANSDLLSRRLLAQTHIEF |
Ga0207658_102271213 | 3300025986 | Switchgrass Rhizosphere | ISRARLGVVVSLEQTHQTSNSQLLDRRLLAQTHIEF |
Ga0207676_120197332 | 3300026095 | Switchgrass Rhizosphere | QWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTLIEF |
Ga0209074_102834921 | 3300027787 | Agricultural Soil | NGSNGNDSQRRYIFGGAHWNQWGRGRLGLVVTLEQLYRTVNSQLLQRRLLAQTQIEF |
Ga0209797_100039108 | 3300027831 | Wetland Sediment | MGGAHWSQWGRGRVGVVVTLEQLYRVVNSDRLERRLLAQTHVEF |
Ga0310886_100276791 | 3300031562 | Soil | WTEAGTGRFGVVVSLVQEYGSASSQLLSRRLQAQTLIEF |
Ga0307469_124842592 | 3300031720 | Hardwood Forest Soil | YVFGGAHWRQVGRGRLGIVVTMEQVFQATTSQLTSRRLLAQTHVEF |
Ga0307468_1014886082 | 3300031740 | Hardwood Forest Soil | RRYLFGGAHGSQWGRGRLGVVVSLEQLYRTANSQLLERRLLAQTHIEF |
Ga0310907_100068661 | 3300031847 | Soil | DNDTRRRYLFGGAHWTEAGTGRFGVVVSLVQEYGSASSQLLSRRLQAQTLIEF |
Ga0310907_100360854 | 3300031847 | Soil | GRSKIGVVISLDQEYQTANSQLLSRRLLAQTHIEF |
Ga0307412_108549692 | 3300031911 | Rhizosphere | GGAHWSQVGRGRLGIIVSLEQVNGGYGGGGSQLLERRLLGQTHVEF |
Ga0307412_114384461 | 3300031911 | Rhizosphere | EGNSRRRLIFGGAHWSEAGRGRLGVVVSLQQESENSQLQSRRLLAQTHIEF |
Ga0310885_106136041 | 3300031943 | Soil | QVGRGRLGVVITVEQEYQTANSQLLSRRLLAQTHIEF |
Ga0310884_103170821 | 3300031944 | Soil | SQVGRGRLGVVISLDQSYRVINSQLTERRLLAQTHIEF |
Ga0326597_1001225617 | 3300031965 | Soil | MGGAHWSQWGRGRVGVVVTYEQLYRVANSDRLESRLLAQTHVEF |
Ga0307416_1022931952 | 3300032002 | Rhizosphere | GGAHWSQVGRGRLGIVVSLEQVNGGYGGGGSQLLERRLLGQTHVEF |
Ga0307411_111139242 | 3300032005 | Rhizosphere | RGTGQVGAVVTLEQAVRAADSQLVERRLLAQTHIEF |
Ga0315910_102013222 | 3300032144 | Soil | HWSQVGRGRLGVVVSLEQISQTVNSQLLERRLLVQTHVEF |
Ga0315912_101787944 | 3300032157 | Soil | NDGDAKRRVIFGGAHWSRFSLGRMGIVVTLEQVYQTANSQLLERRLLAQTHVEF |
Ga0307471_1016246991 | 3300032180 | Hardwood Forest Soil | AHWSQVGRGKLGIVVTLEQTFQTANSQLLERRLLGQTHIEF |
Ga0326723_0314451_1_141 | 3300034090 | Peat Soil | YTFGGAHWSQVGRGRLGVVVTLEQLYRTVNSQLLERRLLAQTHVEF |
Ga0364943_0352542_3_125 | 3300034354 | Sediment | GAHWSEVGRGRLGVVVSLQQESANSQLFSRRLLAQTHIEF |
⦗Top⦘ |